aboutsummaryrefslogtreecommitdiff
diff options
context:
space:
mode:
authorAndroid Build Coastguard Worker <android-build-coastguard-worker@google.com>2021-07-15 02:03:18 +0000
committerAndroid Build Coastguard Worker <android-build-coastguard-worker@google.com>2021-07-15 02:03:18 +0000
commitff731ebd221b24e63e67b02c4bf0195e883ece90 (patch)
tree97a85c8ac40ee60ac80a8663fc1d5fb86e9c6e27
parent438636a3ae0c2e35045b77e39fde3a9d8574a72b (diff)
parent21614c26b375549510764d972695cf34d27d2662 (diff)
downloadbrotli-ff731ebd221b24e63e67b02c4bf0195e883ece90.tar.gz
Change-Id: I5f9d99879301e03d11ff693c91be6b4c131777be
-rw-r--r--.gitattributes54
-rw-r--r--.github/workflows/fuzz.yml23
-rw-r--r--.gitignore1
-rw-r--r--.travis.yml41
-rwxr-xr-xAndroid.bp116
-rw-r--r--BUILD10
-rw-r--r--CMakeLists.txt85
-rw-r--r--METADATA9
l---------NOTICE1
-rw-r--r--README2
-rw-r--r--README.md21
-rwxr-xr-xbootstrap4
-rw-r--r--c/common/constants.c15
-rw-r--r--c/common/constants.h136
-rw-r--r--c/common/context.c156
-rw-r--r--[-rwxr-xr-x]c/common/context.h156
-rw-r--r--[-rwxr-xr-x]c/common/dictionary.bin.brbin51687 -> 51687 bytes
-rw-r--r--c/common/dictionary.c11
-rw-r--r--c/common/platform.c22
-rw-r--r--[-rwxr-xr-x]c/common/platform.h60
-rw-r--r--[-rwxr-xr-x]c/common/transform.c62
-rw-r--r--[-rwxr-xr-x]c/common/transform.h5
-rw-r--r--c/common/version.h4
-rw-r--r--c/dec/bit_reader.c28
-rw-r--r--c/dec/bit_reader.h74
-rw-r--r--c/dec/decode.c604
-rw-r--r--c/dec/huffman.h18
-rw-r--r--c/dec/prefix.h18
-rw-r--r--c/dec/state.c23
-rw-r--r--c/dec/state.h181
-rw-r--r--c/enc/backward_references.c15
-rw-r--r--c/enc/backward_references.h9
-rw-r--r--c/enc/backward_references_hq.c84
-rw-r--r--c/enc/backward_references_hq.h19
-rw-r--r--c/enc/backward_references_inc.h38
-rw-r--r--c/enc/block_splitter.c6
-rw-r--r--c/enc/block_splitter_inc.h21
-rw-r--r--c/enc/brotli_bit_stream.c43
-rw-r--r--c/enc/cluster_inc.h9
-rw-r--r--c/enc/command.c28
-rw-r--r--c/enc/command.h24
-rw-r--r--c/enc/compress_fragment_two_pass.c2
-rw-r--r--c/enc/dictionary_hash.c2926
-rw-r--r--c/enc/dictionary_hash.h3
-rw-r--r--c/enc/encode.c143
-rw-r--r--[-rwxr-xr-x]c/enc/encoder_dict.c5
-rw-r--r--[-rwxr-xr-x]c/enc/encoder_dict.h4
-rw-r--r--c/enc/entropy_encode.c2
-rw-r--r--c/enc/entropy_encode.h4
-rw-r--r--c/enc/fast_log.c105
-rw-r--r--c/enc/fast_log.h119
-rw-r--r--c/enc/find_match_length.h5
-rw-r--r--c/enc/hash.h170
-rw-r--r--[-rwxr-xr-x]c/enc/hash_composite_inc.h115
-rw-r--r--c/enc/hash_forgetful_chain_inc.h137
-rw-r--r--c/enc/hash_longest_match64_inc.h100
-rw-r--r--c/enc/hash_longest_match_inc.h103
-rw-r--r--c/enc/hash_longest_match_quickly_inc.h151
-rw-r--r--[-rwxr-xr-x]c/enc/hash_rolling_inc.h50
-rw-r--r--c/enc/hash_to_binary_tree_inc.h77
-rw-r--r--c/enc/memory.h36
-rw-r--r--c/enc/metablock.c50
-rw-r--r--c/enc/metablock_inc.h2
-rw-r--r--[-rwxr-xr-x]c/enc/params.h4
-rw-r--r--c/enc/ringbuffer.h5
-rw-r--r--c/enc/utf8_util.c2
-rw-r--r--c/enc/write_bits.h52
-rw-r--r--c/include/brotli/encode.h23
-rw-r--r--c/include/brotli/port.h14
-rw-r--r--c/tools/brotli.c83
-rw-r--r--compiler_config_setting.bzl28
-rw-r--r--docs/constants.h.347
-rw-r--r--docs/encode.h.316
-rw-r--r--go/WORKSPACE11
-rw-r--r--go/cbrotli/cbrotli_test.go4
-rw-r--r--go/cbrotli/go.mod1
-rw-r--r--go/cbrotli/reader.go3
-rw-r--r--java/BUILD12
-rw-r--r--java/WORKSPACE20
-rw-r--r--java/org/brotli/common/BUILD11
-rw-r--r--java/org/brotli/common/SharedDictionaryType.java15
-rw-r--r--java/org/brotli/dec/BUILD54
-rw-r--r--java/org/brotli/dec/BitReader.java31
-rw-r--r--java/org/brotli/dec/BitReaderTest.java19
-rw-r--r--java/org/brotli/dec/BrotliInputStream.java12
-rw-r--r--java/org/brotli/dec/CompoundDictionaryTest.java63
-rw-r--r--java/org/brotli/dec/Decode.java840
-rw-r--r--java/org/brotli/dec/Dictionary.java43
-rw-r--r--java/org/brotli/dec/DictionaryData.java28
-rw-r--r--[-rwxr-xr-x]java/org/brotli/dec/EagerStreamTest.java2
-rw-r--r--java/org/brotli/dec/Huffman.java17
-rw-r--r--java/org/brotli/dec/SetDictionaryTest.java5
-rw-r--r--java/org/brotli/dec/State.java27
-rw-r--r--java/org/brotli/dec/SynthTest.java669
-rw-r--r--java/org/brotli/dec/Transform.java183
-rw-r--r--java/org/brotli/dec/TransformTest.java14
-rw-r--r--java/org/brotli/dec/Utils.java15
-rw-r--r--java/org/brotli/dec/build_defs.bzl34
-rw-r--r--java/org/brotli/dec/pom.xml35
-rw-r--r--java/org/brotli/dec/proguard.pgcfg (renamed from java/org/brotli/dec/proguard.cfg)0
-rw-r--r--java/org/brotli/enc/BUILD14
-rw-r--r--java/org/brotli/enc/PreparedDictionary.java16
-rw-r--r--java/org/brotli/enc/PreparedDictionaryGenerator.java185
-rw-r--r--java/org/brotli/pom.xml4
-rw-r--r--java/org/brotli/wrapper/common/BUILD7
-rw-r--r--java/org/brotli/wrapper/common/common_jni.cc2
-rw-r--r--java/org/brotli/wrapper/dec/BUILD9
-rw-r--r--java/org/brotli/wrapper/dec/BrotliInputStream.java4
-rw-r--r--java/org/brotli/wrapper/dec/Decoder.java4
-rw-r--r--java/org/brotli/wrapper/dec/DecoderJNI.java3
-rw-r--r--[-rwxr-xr-x]java/org/brotli/wrapper/dec/EagerStreamTest.java2
-rw-r--r--java/org/brotli/wrapper/enc/BUILD9
-rw-r--r--[-rwxr-xr-x]java/org/brotli/wrapper/enc/EmptyInputTest.java0
-rw-r--r--java/org/brotli/wrapper/enc/EncoderJNI.java6
-rw-r--r--js/WORKSPACE12
-rw-r--r--js/decode.js1155
-rw-r--r--[-rwxr-xr-x]js/decode.min.js3
-rw-r--r--python/_brotli.cc19
-rw-r--r--[-rwxr-xr-x]python/bro.py0
-rw-r--r--python/tests/decompress_test.py4
-rw-r--r--python/tests/decompressor_test.py9
-rw-r--r--[-rwxr-xr-x]research/BUILD0
-rw-r--r--research/brotli_decoder.c1
-rw-r--r--[-rwxr-xr-x]research/dictionary_generator.cc144
-rw-r--r--research/draw_histogram.cc25
-rw-r--r--[-rwxr-xr-x]research/durchschlag.cc0
-rw-r--r--[-rwxr-xr-x]research/durchschlag.h0
-rw-r--r--[-rwxr-xr-x]research/sieve.cc0
-rw-r--r--[-rwxr-xr-x]research/sieve.h0
-rw-r--r--scripts/.bintray.json2
-rwxr-xr-xscripts/.travis.sh3
-rw-r--r--scripts/appveyor.yml4
-rw-r--r--scripts/libbrotlicommon.pc.in2
-rw-r--r--scripts/libbrotlidec.pc.in2
-rw-r--r--scripts/libbrotlienc.pc.in2
-rw-r--r--scripts/sources.lst5
-rw-r--r--setup.py9
-rwxr-xr-xtests/roundtrip_test.sh24
138 files changed, 7344 insertions, 3333 deletions
diff --git a/.gitattributes b/.gitattributes
new file mode 100644
index 0000000..8915918
--- /dev/null
+++ b/.gitattributes
@@ -0,0 +1,54 @@
+tests/testdata/* binary
+
+# Exclude everything
+**/** export-ignore
+
+# Add top-level files
+bootstrap !export-ignore
+BUILD !export-ignore
+CMakeLists.txt !export-ignore
+compiler_config_setting.bzl !export-ignore
+configure !export-ignore
+configure-cmake !export-ignore
+configure.ac !export-ignore
+CONTRIBUTING.md !export-ignore
+LICENSE !export-ignore
+Makefile !export-ignore
+Makefile.am !export-ignore
+MANIFEST.in !export-ignore
+premake5.lua !export-ignore
+README !export-ignore
+README.md !export-ignore
+setup.py !export-ignore
+setup.cfg !export-ignore
+WORKSPACE !export-ignore
+
+# Add sources
+c !export-ignore
+c/** !export-ignore
+c/common/dictionary.bin* export-ignore
+c/fuzz export-ignore
+
+# Add man pages
+docs !export-ignore
+docs/** !export-ignore
+docs/brotli-comparison-study-2015-09-22.pdf export-ignore
+
+# Add python bindings + tests
+python !export-ignore
+python/** !export-ignore
+
+# Add more build files.
+scripts !export-ignore
+scripts/sources.lst !export-ignore
+scripts/libbrotli*.pc.in !export-ignore
+
+# Add testdata
+tests !export-ignore
+tests/*.sh !export-ignore
+tests/*.cmake !export-ignore
+tests/testdata !export-ignore
+tests/testdata/empty !export-ignore
+tests/testdata/empty.compressed !export-ignore
+tests/testdata/ukkonooa !export-ignore
+tests/testdata/ukkonooa.compressed !export-ignore
diff --git a/.github/workflows/fuzz.yml b/.github/workflows/fuzz.yml
new file mode 100644
index 0000000..f0f5dcc
--- /dev/null
+++ b/.github/workflows/fuzz.yml
@@ -0,0 +1,23 @@
+name: CIFuzz
+on: [pull_request]
+jobs:
+ Fuzzing:
+ runs-on: ubuntu-latest
+ steps:
+ - name: Build Fuzzers
+ uses: google/oss-fuzz/infra/cifuzz/actions/build_fuzzers@master
+ with:
+ oss-fuzz-project-name: 'brotli'
+ dry-run: false
+ - name: Run Fuzzers
+ uses: google/oss-fuzz/infra/cifuzz/actions/run_fuzzers@master
+ with:
+ oss-fuzz-project-name: 'brotli'
+ fuzz-seconds: 600
+ dry-run: false
+ - name: Upload Crash
+ uses: actions/upload-artifact@v1
+ if: failure()
+ with:
+ name: artifacts
+ path: ./out/artifacts
diff --git a/.gitignore b/.gitignore
index e3a69e6..1e269cb 100644
--- a/.gitignore
+++ b/.gitignore
@@ -1,5 +1,6 @@
# C
*.o
+*.obj
bin/
buildfiles/
**/obj/
diff --git a/.travis.yml b/.travis.yml
index 5cfeafc..068e680 100644
--- a/.travis.yml
+++ b/.travis.yml
@@ -44,27 +44,27 @@ matrix:
## Test that fuzzer is compiling / working.
###
- os: linux
- env: BUILD_SYSTEM=fuzz C_COMPILER=clang-5.0 CXX_COMPILER=clang++-5.0 ASAN_OPTIONS=detect_leaks=0
+ env: BUILD_SYSTEM=fuzz C_COMPILER=clang-7 CXX_COMPILER=clang++-7 ASAN_OPTIONS=detect_leaks=0
addons:
apt:
sources:
- ubuntu-toolchain-r-test
- - llvm-toolchain-trusty-5.0
+ - llvm-toolchain-xenial-7
packages:
- - clang-5.0
+ - clang-7
###
## clang on Linux
###
- os: linux
- env: BUILD_SYSTEM=cmake C_COMPILER=clang-5.0 CXX_COMPILER=clang++-5.0
+ env: BUILD_SYSTEM=cmake C_COMPILER=clang-7 CXX_COMPILER=clang++-7
addons:
apt:
sources:
- - llvm-toolchain-trusty-5.0
+ - llvm-toolchain-xenial-7
- ubuntu-toolchain-r-test
packages:
- - clang-5.0
+ - clang-7
- os: linux
env: BUILD_SYSTEM=cmake C_COMPILER=clang-3.5 CXX_COMPILER=clang++-3.5
addons:
@@ -92,8 +92,9 @@ matrix:
###
## PGI Community Edition on Linux
###
- - os: linux
- env: BUILD_SYSTEM=cmake C_COMPILER=pgcc CXX_COMPILER=pgc++
+ # Installer is currently broken
+ #- os: linux
+ # env: BUILD_SYSTEM=cmake C_COMPILER=pgcc CXX_COMPILER=pgc++
###
## Python 2.7 and 3.6 builds on Linux
@@ -145,35 +146,38 @@ matrix:
## Sanitizers
###
- os: linux
- env: BUILD_SYSTEM=cmake C_COMPILER=clang-5.0 CXX_COMPILER=clang++-5.0 SANITIZER=address ASAN_OPTIONS=detect_leaks=0
+ env: BUILD_SYSTEM=cmake C_COMPILER=clang-7 CXX_COMPILER=clang++-7 SANITIZER=address ASAN_OPTIONS=detect_leaks=0
addons:
apt:
sources:
- ubuntu-toolchain-r-test
- - llvm-toolchain-trusty-5.0
+ - llvm-toolchain-xenial-7
packages:
- - clang-5.0
+ - clang-7
- os: linux
- env: BUILD_SYSTEM=cmake C_COMPILER=clang-5.0 CXX_COMPILER=clang++-5.0 SANITIZER=thread
+ env: BUILD_SYSTEM=cmake C_COMPILER=clang-7 CXX_COMPILER=clang++-7 SANITIZER=thread
addons:
apt:
sources:
- ubuntu-toolchain-r-test
- - llvm-toolchain-trusty-5.0
+ - llvm-toolchain-xenial-7
packages:
- - clang-5.0
+ - clang-7
- os: linux
- env: BUILD_SYSTEM=cmake C_COMPILER=clang-5.0 CXX_COMPILER=clang++-5.0 SANITIZER=undefined CFLAGS="-fno-sanitize-recover=undefined,integer"
+ env: BUILD_SYSTEM=cmake C_COMPILER=clang-7 CXX_COMPILER=clang++-7 SANITIZER=undefined CFLAGS="-fno-sanitize-recover=undefined,integer"
addons:
apt:
sources:
- ubuntu-toolchain-r-test
- - llvm-toolchain-trusty-5.0
+ - llvm-toolchain-xenial-7
packages:
- - clang-5.0
+ - clang-7
- os: linux
env: BUILD_SYSTEM=maven
+ jdk:
+ # maven + jdk11 + javadoc == trouble
+ - openjdk10
language: java
- os: linux
@@ -192,8 +196,7 @@ matrix:
- os: osx
env: BUILD_SYSTEM=bazel
- # Latest image with Java 1.8 (required to install Bazel).
- osx_image: xcode9.3
+ osx_image: xcode11.3
language: java
before_install:
diff --git a/Android.bp b/Android.bp
index 2ff2594..03b4914 100755
--- a/Android.bp
+++ b/Android.bp
@@ -13,11 +13,46 @@
// limitations under the License.
//
+package {
+ default_applicable_licenses: ["external_brotli_license"],
+}
+
+// Added automatically by a large-scale-change that took the approach of
+// 'apply every license found to every target'. While this makes sure we respect
+// every license restriction, it may not be entirely correct.
+//
+// e.g. GPL in an MIT project might only apply to the contrib/ directory.
+//
+// Please consider splitting the single license below into multiple licenses,
+// taking care not to lose any license_kind information, and overriding the
+// default license using the 'licenses: [...]' property on targets as needed.
+//
+// For unused files, consider creating a 'fileGroup' with "//visibility:private"
+// to attach the license to, and including a comment whether the files may be
+// used in the current project.
+// See: http://go/android-license-faq
+license {
+ name: "external_brotli_license",
+ visibility: [":__subpackages__"],
+ license_kinds: [
+ "SPDX-license-identifier-BSD",
+ "SPDX-license-identifier-MIT",
+ "SPDX-license-identifier-Unlicense",
+ "legacy_permissive",
+ "legacy_unencumbered",
+ ],
+ license_text: [
+ "LICENSE",
+ ],
+}
+
cc_library_static {
name: "libbrotli",
host_supported: true,
vendor_available: true,
recovery_available: true,
+ ramdisk_available: true,
+ vendor_ramdisk_available: true,
apex_available: [
"//apex_available:platform",
@@ -29,6 +64,7 @@ cc_library_static {
"//external/bsdiff:__subpackages__",
"//external/puffin:__subpackages__",
"//packages/modules/adb:__subpackages__",
+ "//system/core/fs_mgr/libsnapshot:__subpackages__",
"//system/update_engine:__subpackages__",
],
@@ -78,3 +114,83 @@ java_library {
exclude_srcs: ["java/**/*Test.java"],
sdk_version: "current",
}
+
+// TODO(b/171429704): Remove this genrule and use the fuzz_data.zip
+// directly in brotli-fuzzer when a corpus_zip option is available.
+genrule {
+ name: "brotli-fuzzer-corpus",
+ srcs: ["java/org/brotli/integration/fuzz_data.zip"],
+ cmd: "mkdir -p $(genDir)/c/fuzz && " +
+ "unzip -q $(in) -d $(genDir)/c/fuzz",
+ out: [
+ "c/fuzz/04bdd9f35a2881027adddb039026623cd2e86664",
+ "c/fuzz/04dc2c1dc1f4612d4dc4892f4444983f2064c252",
+ "c/fuzz/05a79f06cf3f67f726dae68d18a2290f6c9a50c9",
+ "c/fuzz/05b3606442abab241ede01c3b34d1d73afc580d1",
+ "c/fuzz/065977e9fc84bab81eada79880b4481fece00616",
+ "c/fuzz/08e61f98cc5e260e8d9b853bf9d5c1d9c7a9fc4d",
+ "c/fuzz/155b07e636d98a80a53e667caef9e11370cef995",
+ "c/fuzz/2ad192eab5c0f6e50f0c64777811ae9111bad918",
+ "c/fuzz/2b1cba1e32deab80f440d886d1be7ca43733e878",
+ "c/fuzz/2fe9bc36724f80651a75cde84233a4832afec947",
+ "c/fuzz/312287bfd6732b264b54f9d5eda69f79c73898da",
+ "c/fuzz/3254df93e6003641dfc55522f594335e2c871b8f",
+ "c/fuzz/35a8db906eb1834b8acefd0bb9236ab8dc2ebbfe",
+ "c/fuzz/3a8e0fefadd562f706a16ec84c67646ba7ddcf29",
+ "c/fuzz/3edbdb6fcdb1ff53428af36bc4982f4611303eae",
+ "c/fuzz/477f2aa9b6ca0ff2ef72365d227baabb4855646e",
+ "c/fuzz/49fab0752d21ca89e4da04bdbb86dc7abb6b77e9",
+ "c/fuzz/4b809bfcd95342116053b0c057c878f08c1178b9",
+ "c/fuzz/523dfcdc31b2cb3b0f4715faa2be89b3d0a1d373",
+ "c/fuzz/54fd1711209fb1c0781092374132c66e79e2241b",
+ "c/fuzz/5515e03743624befa68a626382b605829300448d",
+ "c/fuzz/5be2ace579d7b0d816c31db7e65dc3245f1e09a6",
+ "c/fuzz/6f672b1c3c8643ce5083f6efee790b29459cbb47",
+ "c/fuzz/6fb6157dc83d29ef5d4da645e4a078179f54f405",
+ "c/fuzz/70eaba097fdbde0c63159f194ec4cec0f201acd8",
+ "c/fuzz/725ce4c76aa864430d7f4cae9e4cc4fbdd889f5e",
+ "c/fuzz/73231c6592f195ffd41100b8706d1138ff6893b9",
+ "c/fuzz/754f38420c156404309fa05f1ed773be47336882",
+ "c/fuzz/7730f322fb995dd3495d6e69906ff1f5b3cd876f",
+ "c/fuzz/7b74620c59451546866d80c0629ec01221246f59",
+ "c/fuzz/7b9cde6a96a7446f6951cca66266284db28be916",
+ "c/fuzz/7cc01983b79447178179e59af8a56cf4f45b9f8f",
+ "c/fuzz/7d3783cb4414c6098f7ac49ebaa8d2122eb06a0e",
+ "c/fuzz/7ecfeb33839bb8cea5027eb9fc7e5689799e704c",
+ "c/fuzz/7f88ed32938bef52eeaf3d3defedbfd2df87f895",
+ "c/fuzz/90450c570b868c4db80473b978529f6ec6dde20d",
+ "c/fuzz/9590340f604e5c729dbf8b54e25715fd18adb318",
+ "c/fuzz/a3491e5bbd78932592cd02dbff09cd05ca36e2e9",
+ "c/fuzz/a848e83a76d026b01bdfc2c0a6ac841564a97347",
+ "c/fuzz/a8abd012eb59b862bf9bc1ea443d2f35a1a2e222",
+ "c/fuzz/abcaee2817f06af41383c41a7e0920f1cc5a14ec",
+ "c/fuzz/ac81161dd772b1c7a47aa5cefed1ec3d8ac442af",
+ "c/fuzz/aec354d02df9ddb8d4e9ebb0c2771f1325cc2b89",
+ "c/fuzz/c01afbfde5a6ff0e5b0873f9d1ab8742293a375e",
+ "c/fuzz/c18cc3b3c69a07404a2c3cc756ed2d18f3dd4348",
+ "c/fuzz/c46fa7f0b56a80fcf8b1a8a6cbc24e4139b59a6b",
+ "c/fuzz/c51ab436e7332470ea2fd3d68ddbc3d0c43cf7ea",
+ "c/fuzz/c95701b41f06e892874d3001b32c64510c33c178",
+ "c/fuzz/d2b552c1f35b645332e7f63dea404046fdc8577b",
+ "c/fuzz/d6b5b93e87be7082e917d4bcc4d3436f34978d4b",
+ "c/fuzz/d75a03333816807599eadcb043a298ffa8c83378",
+ "c/fuzz/da39a3ee5e6b4b0d3255bfef95601890afd80709",
+ "c/fuzz/dc37d2e46439be3aa4bf23102f0960adbf13aae1",
+ "c/fuzz/de7c798e9523bd7e8350f3a391248cc9700bc4b4",
+ "c/fuzz/e1346339b452f86470a562335958bb6729f66bb2",
+ "c/fuzz/e6d0943f26000ee2306f10b1c1d44ab23619b20a",
+ "c/fuzz/ed22dce9884f67e05bcc082ba9b11424cf6e0449",
+ "c/fuzz/f5c1dc2f4906adb429197a011692b71bc1db856a",
+ "c/fuzz/fb1d6415c35cf9d7807e05e14179537e2019e635",
+ ],
+}
+
+cc_fuzz {
+ name: "brotli-fuzzer",
+ static_libs: ["libbrotli"],
+ srcs: ["c/fuzz/decode_fuzzer.c"],
+ corpus: [":brotli-fuzzer-corpus"],
+ fuzz_config: {
+ componentid: 128577
+ },
+}
diff --git a/BUILD b/BUILD
index 4ce4ad4..4c9b57a 100644
--- a/BUILD
+++ b/BUILD
@@ -39,11 +39,9 @@ config_setting(
visibility = ["//visibility:public"],
)
-config_setting(
- name = "msvc",
- values = {"compiler": "msvc-cl"},
- visibility = ["//visibility:public"],
-)
+load(":compiler_config_setting.bzl", "create_msvc_config")
+
+create_msvc_config()
STRICT_C_OPTIONS = select({
":msvc": [],
@@ -101,7 +99,7 @@ cc_library(
name = "brotli_inc",
hdrs = [":public_headers"],
copts = STRICT_C_OPTIONS,
- includes = ["c/include"],
+ strip_include_prefix = "c/include",
)
cc_library(
diff --git a/CMakeLists.txt b/CMakeLists.txt
index fc45f80..4ff3401 100644
--- a/CMakeLists.txt
+++ b/CMakeLists.txt
@@ -6,6 +6,26 @@ cmake_minimum_required(VERSION 2.8.6)
project(brotli C)
+if(NOT CMAKE_BUILD_TYPE AND NOT CMAKE_CONFIGURATION_TYPES)
+ message(STATUS "Setting build type to Release as none was specified.")
+ set(CMAKE_BUILD_TYPE "Release" CACHE STRING "Choose the type of build." FORCE)
+else()
+ message(STATUS "Build type is '${CMAKE_BUILD_TYPE}'")
+endif()
+
+include(CheckCSourceCompiles)
+check_c_source_compiles(
+ "#if defined(__EMSCRIPTEN__)
+ int main() {return 0;}
+ #endif"
+ BROTLI_EMSCRIPTEN
+)
+if (BROTLI_EMSCRIPTEN)
+ message("-- Compiler is EMSCRIPTEN")
+else()
+ message("-- Compiler is not EMSCRIPTEN")
+endif()
+
# If Brotli is being bundled in another project, we don't want to
# install anything. However, we want to let people override this, so
# we'll use the BROTLI_BUNDLED_MODE variable to let them do that; just
@@ -97,13 +117,16 @@ if(NOT LOG2_RES)
CHECK_FUNCTION_EXISTS(log2 LOG2_LIBM_RES)
if(LOG2_LIBM_RES)
set(LIBM_LIBRARY "m")
+ add_definitions(-DBROTLI_HAVE_LOG2=1)
else()
- message(FATAL_ERROR "log2() not found")
+ add_definitions(-DBROTLI_HAVE_LOG2=0)
endif()
set(CMAKE_REQUIRED_LIBRARIES "${orig_req_libs}")
unset(LOG2_LIBM_RES)
unset(orig_req_libs)
+else()
+ add_definitions(-DBROTLI_HAVE_LOG2=1)
endif()
unset(LOG2_RES)
@@ -137,10 +160,16 @@ endfunction()
transform_sources_list("scripts/sources.lst" "${CMAKE_CURRENT_BINARY_DIR}/sources.lst.cmake")
include("${CMAKE_CURRENT_BINARY_DIR}/sources.lst.cmake")
-add_library(brotlicommon SHARED ${BROTLI_COMMON_C})
-add_library(brotlidec SHARED ${BROTLI_DEC_C})
-add_library(brotlienc SHARED ${BROTLI_ENC_C})
+if(BROTLI_EMSCRIPTEN)
+ set(BROTLI_SHARED_LIBS "")
+else()
+ set(BROTLI_SHARED_LIBS brotlicommon brotlidec brotlienc)
+ add_library(brotlicommon SHARED ${BROTLI_COMMON_C})
+ add_library(brotlidec SHARED ${BROTLI_DEC_C})
+ add_library(brotlienc SHARED ${BROTLI_ENC_C})
+endif()
+set(BROTLI_STATIC_LIBS brotlicommon-static brotlidec-static brotlienc-static)
add_library(brotlicommon-static STATIC ${BROTLI_COMMON_C})
add_library(brotlidec-static STATIC ${BROTLI_DEC_C})
add_library(brotlienc-static STATIC ${BROTLI_ENC_C})
@@ -148,24 +177,28 @@ add_library(brotlienc-static STATIC ${BROTLI_ENC_C})
# Older CMake versions does not understand INCLUDE_DIRECTORIES property.
include_directories(${BROTLI_INCLUDE_DIRS})
-foreach(lib brotlicommon brotlidec brotlienc)
+foreach(lib IN LISTS BROTLI_SHARED_LIBS)
target_compile_definitions(${lib} PUBLIC "BROTLI_SHARED_COMPILATION" )
string(TOUPPER "${lib}" LIB)
- set_target_properties (${lib} PROPERTIES DEFINE_SYMBOL "${LIB}_SHARED_COMPILATION" )
+ set_target_properties (${lib} PROPERTIES DEFINE_SYMBOL "${LIB}_SHARED_COMPILATION")
endforeach()
-foreach(lib brotlicommon brotlidec brotlienc brotlicommon-static brotlidec-static brotlienc-static)
+foreach(lib IN LISTS BROTLI_SHARED_LIBS BROTLI_STATIC_LIBS)
target_link_libraries(${lib} ${LIBM_LIBRARY})
set_property(TARGET ${lib} APPEND PROPERTY INCLUDE_DIRECTORIES ${BROTLI_INCLUDE_DIRS})
set_target_properties(${lib} PROPERTIES
VERSION "${BROTLI_ABI_COMPATIBILITY}.${BROTLI_ABI_AGE}.${BROTLI_ABI_REVISION}"
- SOVERSION "${BROTLI_ABI_COMPATIBILITY}"
- POSITION_INDEPENDENT_CODE TRUE)
+ SOVERSION "${BROTLI_ABI_COMPATIBILITY}")
+ if(NOT BROTLI_EMSCRIPTEN)
+ set_target_properties(${lib} PROPERTIES POSITION_INDEPENDENT_CODE TRUE)
+ endif()
set_property(TARGET ${lib} APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES "${BROTLI_INCLUDE_DIRS}")
endforeach()
+if(NOT BROTLI_EMSCRIPTEN)
target_link_libraries(brotlidec brotlicommon)
target_link_libraries(brotlienc brotlicommon)
+endif()
target_link_libraries(brotlidec-static brotlicommon-static)
target_link_libraries(brotlienc-static brotlicommon-static)
@@ -186,6 +219,7 @@ add_executable(brotli ${BROTLI_CLI_C})
target_link_libraries(brotli ${BROTLI_LIBRARIES_STATIC})
# Installation
+if(NOT BROTLI_EMSCRIPTEN)
if(NOT BROTLI_BUNDLED_MODE)
install(
TARGETS brotli
@@ -210,7 +244,8 @@ if(NOT BROTLI_BUNDLED_MODE)
DIRECTORY ${BROTLI_INCLUDE_DIRS}/brotli
DESTINATION "${CMAKE_INSTALL_INCLUDEDIR}"
)
-endif()
+endif() # BROTLI_BUNDLED_MODE
+endif() # BROTLI_EMSCRIPTEN
# Tests
@@ -268,17 +303,21 @@ if(NOT BROTLI_DISABLE_TESTS)
set(OUTPUT_FILE "${CMAKE_CURRENT_BINARY_DIR}/${OUTPUT_NAME}")
set(INPUT_FILE "${CMAKE_CURRENT_SOURCE_DIR}/${INPUT}")
- foreach(quality 1 6 9 11)
- add_test(NAME "${BROTLI_TEST_PREFIX}roundtrip/${INPUT}/${quality}"
- COMMAND "${CMAKE_COMMAND}"
- -DBROTLI_WRAPPER=${BROTLI_WRAPPER}
- -DBROTLI_WRAPPER_LD_PREFIX=${BROTLI_WRAPPER_LD_PREFIX}
- -DBROTLI_CLI=$<TARGET_FILE:brotli>
- -DQUALITY=${quality}
- -DINPUT=${INPUT_FILE}
- -DOUTPUT=${OUTPUT_FILE}.${quality}
- -P ${CMAKE_CURRENT_SOURCE_DIR}/tests/run-roundtrip-test.cmake)
- endforeach()
+ if (EXISTS "${INPUT_FILE}")
+ foreach(quality 1 6 9 11)
+ add_test(NAME "${BROTLI_TEST_PREFIX}roundtrip/${INPUT}/${quality}"
+ COMMAND "${CMAKE_COMMAND}"
+ -DBROTLI_WRAPPER=${BROTLI_WRAPPER}
+ -DBROTLI_WRAPPER_LD_PREFIX=${BROTLI_WRAPPER_LD_PREFIX}
+ -DBROTLI_CLI=$<TARGET_FILE:brotli>
+ -DQUALITY=${quality}
+ -DINPUT=${INPUT_FILE}
+ -DOUTPUT=${OUTPUT_FILE}.${quality}
+ -P ${CMAKE_CURRENT_SOURCE_DIR}/tests/run-roundtrip-test.cmake)
+ endforeach()
+ else()
+ message(WARNING "Test file ${INPUT} does not exist.")
+ endif()
endforeach()
file(GLOB_RECURSE
@@ -366,6 +405,7 @@ transform_pc_file("scripts/libbrotlidec.pc.in" "${CMAKE_CURRENT_BINARY_DIR}/libb
transform_pc_file("scripts/libbrotlienc.pc.in" "${CMAKE_CURRENT_BINARY_DIR}/libbrotlienc.pc" "${BROTLI_VERSION}")
+if(NOT BROTLI_EMSCRIPTEN)
if(NOT BROTLI_BUNDLED_MODE)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/libbrotlicommon.pc"
DESTINATION "${CMAKE_INSTALL_LIBDIR}/pkgconfig")
@@ -373,7 +413,8 @@ if(NOT BROTLI_BUNDLED_MODE)
DESTINATION "${CMAKE_INSTALL_LIBDIR}/pkgconfig")
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/libbrotlienc.pc"
DESTINATION "${CMAKE_INSTALL_LIBDIR}/pkgconfig")
-endif()
+endif() # BROTLI_BUNDLED_MODE
+endif() # BROTLI_EMSCRIPTEN
if (ENABLE_COVERAGE STREQUAL "yes")
SETUP_TARGET_FOR_COVERAGE(coverage test coverage)
diff --git a/METADATA b/METADATA
index 68e065a..6433111 100644
--- a/METADATA
+++ b/METADATA
@@ -9,10 +9,11 @@ third_party {
type: GIT
value: "https://github.com/google/brotli.git"
}
- version: "v1.0.7"
+ version: "v1.0.9"
+ license_type: NOTICE
last_upgrade_date {
- year: 2018
- month: 10
- day: 29
+ year: 2020
+ month: 8
+ day: 27
}
}
diff --git a/NOTICE b/NOTICE
deleted file mode 120000
index 7a694c9..0000000
--- a/NOTICE
+++ /dev/null
@@ -1 +0,0 @@
-LICENSE \ No newline at end of file
diff --git a/README b/README
index 3fb3f22..dea7291 100644
--- a/README
+++ b/README
@@ -1,4 +1,4 @@
-BROTLI DATA COMPRESSIOM LIBRARY
+BROTLI DATA COMPRESSION LIBRARY
Brotli is a generic-purpose lossless compression algorithm that compresses data
using a combination of a modern variant of the LZ77 algorithm, Huffman coding
diff --git a/README.md b/README.md
index f832bd4..3bacbbc 100644
--- a/README.md
+++ b/README.md
@@ -1,5 +1,11 @@
<p align="center"><img src="https://brotli.org/brotli.svg" alt="Brotli" width="64"></p>
+# SECURITY NOTE
+
+Please consider updating brotli to version 1.0.9 (latest).
+
+Version 1.0.9 contains a fix to "integer overflow" problem. This happens when "one-shot" decoding API is used (or input chunk for streaming API is not limited), input size (chunk size) is larger than 2GiB, and input contains uncompressed blocks. After the overflow happens, `memcpy` is invoked with a gigantic `num` value, that will likely cause the crash.
+
### Introduction
Brotli is a generic-purpose lossless compression algorithm that compresses data
@@ -17,9 +23,22 @@ https://groups.google.com/forum/#!forum/brotli
[![TravisCI Build Status](https://travis-ci.org/google/brotli.svg?branch=master)](https://travis-ci.org/google/brotli)
[![AppVeyor Build Status](https://ci.appveyor.com/api/projects/status/github/google/brotli?branch=master&svg=true)](https://ci.appveyor.com/project/szabadka/brotli)
+[![Fuzzing Status](https://oss-fuzz-build-logs.storage.googleapis.com/badges/brotli.svg)](https://oss-fuzz-build-logs.storage.googleapis.com/index.html#brotli)
### Build instructions
+#### Vcpkg
+
+You can download and install brotli using the [vcpkg](https://github.com/Microsoft/vcpkg/) dependency manager:
+
+ git clone https://github.com/Microsoft/vcpkg.git
+ cd vcpkg
+ ./bootstrap-vcpkg.sh
+ ./vcpkg integrate install
+ vcpkg install brotli
+
+The brotli port in vcpkg is kept up to date by Microsoft team members and community contributors. If the version is out of date, please [create an issue or pull request](https://github.com/Microsoft/vcpkg) on the vcpkg repository.
+
#### Autotools-style CMake
[configure-cmake](https://github.com/nemequ/configure-cmake) is an
@@ -32,7 +51,7 @@ The basic commands to build, test and install brotli are:
$ make
$ make test
$ make install
-
+
By default, debug binaries are built. To generate "release" `Makefile` specify `--disable-debug` option to `configure-cmake`.
#### Bazel
diff --git a/bootstrap b/bootstrap
index 64aca2c..92d458f 100755
--- a/bootstrap
+++ b/bootstrap
@@ -1,5 +1,9 @@
# !/bin/sh -e
+if [ `uname -s` = "Darwin" ]; then
+echo "WARNING: OSX autogen build is not supported"
+fi
+
REQUIRED='is required, but not installed.'
bc -v >/dev/null 2>&1 || { echo >&2 "'bc' $REQUIRED"; exit 1; }
if [ `uname -s` != "FreeBSD" ]; then
diff --git a/c/common/constants.c b/c/common/constants.c
new file mode 100644
index 0000000..6bad9f6
--- /dev/null
+++ b/c/common/constants.c
@@ -0,0 +1,15 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include "./constants.h"
+
+const BrotliPrefixCodeRange
+ _kBrotliPrefixCodeRanges[BROTLI_NUM_BLOCK_LEN_SYMBOLS] = {
+ {1, 2}, {5, 2}, {9, 2}, {13, 2}, {17, 3}, {25, 3},
+ {33, 3}, {41, 3}, {49, 4}, {65, 4}, {81, 4}, {97, 4},
+ {113, 5}, {145, 5}, {177, 5}, {209, 5}, {241, 6}, {305, 6},
+ {369, 7}, {497, 8}, {753, 9}, {1265, 10}, {2289, 11}, {4337, 12},
+ {8433, 13}, {16625, 24}};
diff --git a/c/common/constants.h b/c/common/constants.h
index d1b88d1..e848195 100644
--- a/c/common/constants.h
+++ b/c/common/constants.h
@@ -4,9 +4,18 @@
See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
*/
+/**
+ * @file
+ * Common constants used in decoder and encoder API.
+ */
+
#ifndef BROTLI_COMMON_CONSTANTS_H_
#define BROTLI_COMMON_CONSTANTS_H_
+#include "./platform.h"
+#include <brotli/port.h>
+#include <brotli/types.h>
+
/* Specification: 7.3. Encoding of the context map */
#define BROTLI_CONTEXT_MAP_MAX_RLE 16
@@ -29,12 +38,31 @@
#define BROTLI_INITIAL_REPEATED_CODE_LENGTH 8
/* "Large Window Brotli" */
+
+/**
+ * The theoretical maximum number of distance bits specified for large window
+ * brotli, for 64-bit encoders and decoders. Even when in practice 32-bit
+ * encoders and decoders only support up to 30 max distance bits, the value is
+ * set to 62 because it affects the large window brotli file format.
+ * Specifically, it affects the encoding of simple huffman tree for distances,
+ * see Specification RFC 7932 chapter 3.4.
+ */
#define BROTLI_LARGE_MAX_DISTANCE_BITS 62U
#define BROTLI_LARGE_MIN_WBITS 10
+/**
+ * The maximum supported large brotli window bits by the encoder and decoder.
+ * Large window brotli allows up to 62 bits, however the current encoder and
+ * decoder, designed for 32-bit integers, only support up to 30 bits maximum.
+ */
#define BROTLI_LARGE_MAX_WBITS 30
/* Specification: 4. Encoding of distances */
#define BROTLI_NUM_DISTANCE_SHORT_CODES 16
+/**
+ * Maximal number of "postfix" bits.
+ *
+ * Number of "postfix" bits is stored as 2 bits in meta-block header.
+ */
#define BROTLI_MAX_NPOSTFIX 3
#define BROTLI_MAX_NDIRECT 120
#define BROTLI_MAX_DISTANCE_BITS 24U
@@ -45,9 +73,22 @@
#define BROTLI_NUM_DISTANCE_SYMBOLS \
BROTLI_DISTANCE_ALPHABET_SIZE( \
BROTLI_MAX_NDIRECT, BROTLI_MAX_NPOSTFIX, BROTLI_LARGE_MAX_DISTANCE_BITS)
+
+/* ((1 << 26) - 4) is the maximal distance that can be expressed in RFC 7932
+ brotli stream using NPOSTFIX = 0 and NDIRECT = 0. With other NPOSTFIX and
+ NDIRECT values distances up to ((1 << 29) + 88) could be expressed. */
#define BROTLI_MAX_DISTANCE 0x3FFFFFC
+
+/* ((1 << 31) - 4) is the safe distance limit. Using this number as a limit
+ allows safe distance calculation without overflows, given the distance
+ alphabet size is limited to corresponding size
+ (see kLargeWindowDistanceCodeLimits). */
#define BROTLI_MAX_ALLOWED_DISTANCE 0x7FFFFFFC
+
+/* Specification: 4. Encoding of Literal Insertion Lengths and Copy Lengths */
+#define BROTLI_NUM_INS_COPY_CODES 24
+
/* 7.1. Context modes and context ID lookup for literals */
/* "context IDs for literals are in the range of 0..63" */
#define BROTLI_LITERAL_CONTEXT_BITS 6
@@ -61,4 +102,99 @@
#define BROTLI_WINDOW_GAP 16
#define BROTLI_MAX_BACKWARD_LIMIT(W) (((size_t)1 << (W)) - BROTLI_WINDOW_GAP)
+typedef struct BrotliDistanceCodeLimit {
+ uint32_t max_alphabet_size;
+ uint32_t max_distance;
+} BrotliDistanceCodeLimit;
+
+/* This function calculates maximal size of distance alphabet, such that the
+ distances greater than the given values can not be represented.
+
+ This limits are designed to support fast and safe 32-bit decoders.
+ "32-bit" means that signed integer values up to ((1 << 31) - 1) could be
+ safely expressed.
+
+ Brotli distance alphabet symbols do not represent consecutive distance
+ ranges. Each distance alphabet symbol (excluding direct distances and short
+ codes), represent interleaved (for NPOSTFIX > 0) range of distances.
+ A "group" of consecutive (1 << NPOSTFIX) symbols represent non-interleaved
+ range. Two consecutive groups require the same amount of "extra bits".
+
+ It is important that distance alphabet represents complete "groups".
+ To avoid complex logic on encoder side about interleaved ranges
+ it was decided to restrict both sides to complete distance code "groups".
+ */
+BROTLI_UNUSED_FUNCTION BrotliDistanceCodeLimit BrotliCalculateDistanceCodeLimit(
+ uint32_t max_distance, uint32_t npostfix, uint32_t ndirect) {
+ BrotliDistanceCodeLimit result;
+ /* Marking this function as unused, because not all files
+ including "constants.h" use it -> compiler warns about that. */
+ BROTLI_UNUSED(&BrotliCalculateDistanceCodeLimit);
+ if (max_distance <= ndirect) {
+ /* This case never happens / exists only for the sake of completeness. */
+ result.max_alphabet_size = max_distance + BROTLI_NUM_DISTANCE_SHORT_CODES;
+ result.max_distance = max_distance;
+ return result;
+ } else {
+ /* The first prohibited value. */
+ uint32_t forbidden_distance = max_distance + 1;
+ /* Subtract "directly" encoded region. */
+ uint32_t offset = forbidden_distance - ndirect - 1;
+ uint32_t ndistbits = 0;
+ uint32_t tmp;
+ uint32_t half;
+ uint32_t group;
+ /* Postfix for the last dcode in the group. */
+ uint32_t postfix = (1u << npostfix) - 1;
+ uint32_t extra;
+ uint32_t start;
+ /* Remove postfix and "head-start". */
+ offset = (offset >> npostfix) + 4;
+ /* Calculate the number of distance bits. */
+ tmp = offset / 2;
+ /* Poor-man's log2floor, to avoid extra dependencies. */
+ while (tmp != 0) {ndistbits++; tmp = tmp >> 1;}
+ /* One bit is covered with subrange addressing ("half"). */
+ ndistbits--;
+ /* Find subrange. */
+ half = (offset >> ndistbits) & 1;
+ /* Calculate the "group" part of dcode. */
+ group = ((ndistbits - 1) << 1) | half;
+ /* Calculated "group" covers the prohibited distance value. */
+ if (group == 0) {
+ /* This case is added for correctness; does not occur for limit > 128. */
+ result.max_alphabet_size = ndirect + BROTLI_NUM_DISTANCE_SHORT_CODES;
+ result.max_distance = ndirect;
+ return result;
+ }
+ /* Decrement "group", so it is the last permitted "group". */
+ group--;
+ /* After group was decremented, ndistbits and half must be recalculated. */
+ ndistbits = (group >> 1) + 1;
+ /* The last available distance in the subrange has all extra bits set. */
+ extra = (1u << ndistbits) - 1;
+ /* Calculate region start. NB: ndistbits >= 1. */
+ start = (1u << (ndistbits + 1)) - 4;
+ /* Move to subregion. */
+ start += (group & 1) << ndistbits;
+ /* Calculate the alphabet size. */
+ result.max_alphabet_size = ((group << npostfix) | postfix) + ndirect +
+ BROTLI_NUM_DISTANCE_SHORT_CODES + 1;
+ /* Calculate the maximal distance representable by alphabet. */
+ result.max_distance = ((start + extra) << npostfix) + postfix + ndirect + 1;
+ return result;
+ }
+}
+
+/* Represents the range of values belonging to a prefix code:
+ [offset, offset + 2^nbits) */
+typedef struct {
+ uint16_t offset;
+ uint8_t nbits;
+} BrotliPrefixCodeRange;
+
+/* "Soft-private", it is exported, but not "advertised" as API. */
+BROTLI_COMMON_API extern const BrotliPrefixCodeRange
+ _kBrotliPrefixCodeRanges[BROTLI_NUM_BLOCK_LEN_SYMBOLS];
+
#endif /* BROTLI_COMMON_CONSTANTS_H_ */
diff --git a/c/common/context.c b/c/common/context.c
new file mode 100644
index 0000000..2c2dceb
--- /dev/null
+++ b/c/common/context.c
@@ -0,0 +1,156 @@
+#include "./context.h"
+
+#include <brotli/types.h>
+
+/* Common context lookup table for all context modes. */
+const uint8_t _kBrotliContextLookupTable[2048] = {
+ /* CONTEXT_LSB6, last byte. */
+ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
+ 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
+ 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
+ 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
+ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
+ 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
+ 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
+ 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
+ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
+ 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
+ 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
+ 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
+ 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
+ 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
+ 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
+ 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
+
+ /* CONTEXT_LSB6, second last byte, */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+
+ /* CONTEXT_MSB6, last byte. */
+ 0, 0, 0, 0, 1, 1, 1, 1, 2, 2, 2, 2, 3, 3, 3, 3,
+ 4, 4, 4, 4, 5, 5, 5, 5, 6, 6, 6, 6, 7, 7, 7, 7,
+ 8, 8, 8, 8, 9, 9, 9, 9, 10, 10, 10, 10, 11, 11, 11, 11,
+ 12, 12, 12, 12, 13, 13, 13, 13, 14, 14, 14, 14, 15, 15, 15, 15,
+ 16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, 19, 19, 19, 19,
+ 20, 20, 20, 20, 21, 21, 21, 21, 22, 22, 22, 22, 23, 23, 23, 23,
+ 24, 24, 24, 24, 25, 25, 25, 25, 26, 26, 26, 26, 27, 27, 27, 27,
+ 28, 28, 28, 28, 29, 29, 29, 29, 30, 30, 30, 30, 31, 31, 31, 31,
+ 32, 32, 32, 32, 33, 33, 33, 33, 34, 34, 34, 34, 35, 35, 35, 35,
+ 36, 36, 36, 36, 37, 37, 37, 37, 38, 38, 38, 38, 39, 39, 39, 39,
+ 40, 40, 40, 40, 41, 41, 41, 41, 42, 42, 42, 42, 43, 43, 43, 43,
+ 44, 44, 44, 44, 45, 45, 45, 45, 46, 46, 46, 46, 47, 47, 47, 47,
+ 48, 48, 48, 48, 49, 49, 49, 49, 50, 50, 50, 50, 51, 51, 51, 51,
+ 52, 52, 52, 52, 53, 53, 53, 53, 54, 54, 54, 54, 55, 55, 55, 55,
+ 56, 56, 56, 56, 57, 57, 57, 57, 58, 58, 58, 58, 59, 59, 59, 59,
+ 60, 60, 60, 60, 61, 61, 61, 61, 62, 62, 62, 62, 63, 63, 63, 63,
+
+ /* CONTEXT_MSB6, second last byte, */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+
+ /* CONTEXT_UTF8, last byte. */
+ /* ASCII range. */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 4, 4, 0, 0, 4, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 8, 12, 16, 12, 12, 20, 12, 16, 24, 28, 12, 12, 32, 12, 36, 12,
+ 44, 44, 44, 44, 44, 44, 44, 44, 44, 44, 32, 32, 24, 40, 28, 12,
+ 12, 48, 52, 52, 52, 48, 52, 52, 52, 48, 52, 52, 52, 52, 52, 48,
+ 52, 52, 52, 52, 52, 48, 52, 52, 52, 52, 52, 24, 12, 28, 12, 12,
+ 12, 56, 60, 60, 60, 56, 60, 60, 60, 56, 60, 60, 60, 60, 60, 56,
+ 60, 60, 60, 60, 60, 56, 60, 60, 60, 60, 60, 24, 12, 28, 12, 0,
+ /* UTF8 continuation byte range. */
+ 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
+ 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
+ 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
+ 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
+ /* UTF8 lead byte range. */
+ 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
+ 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
+ 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
+ 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
+
+ /* CONTEXT_UTF8 second last byte. */
+ /* ASCII range. */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1, 1,
+ 1, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1,
+ 1, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
+ 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 1, 1, 1, 1, 0,
+ /* UTF8 continuation byte range. */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ /* UTF8 lead byte range. */
+ 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+
+ /* CONTEXT_SIGNED, last byte, same as the above values shifted by 3 bits. */
+ 0, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8,
+ 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
+ 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
+ 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
+ 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
+ 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
+ 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
+ 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
+ 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
+ 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
+ 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
+ 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
+ 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
+ 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
+ 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
+ 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 56,
+
+ /* CONTEXT_SIGNED, second last byte. */
+ 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+ 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
+ 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
+ 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
+ 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
+ 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
+ 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
+ 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
+ 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
+ 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
+ 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
+ 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
+ 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
+ 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 7,
+};
diff --git a/c/common/context.h b/c/common/context.h
index 24b3eb4..685a279 100755..100644
--- a/c/common/context.h
+++ b/c/common/context.h
@@ -88,6 +88,7 @@
#ifndef BROTLI_COMMON_CONTEXT_H_
#define BROTLI_COMMON_CONTEXT_H_
+#include <brotli/port.h>
#include <brotli/types.h>
typedef enum ContextType {
@@ -97,163 +98,14 @@ typedef enum ContextType {
CONTEXT_SIGNED = 3
} ContextType;
+/* "Soft-private", it is exported, but not "advertised" as API. */
/* Common context lookup table for all context modes. */
-static const uint8_t kContextLookup[2048] = {
- /* CONTEXT_LSB6, last byte. */
- 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
- 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
- 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
- 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
- 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
- 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
- 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
- 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
- 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
- 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
- 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
- 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
-
- /* CONTEXT_LSB6, second last byte, */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-
- /* CONTEXT_MSB6, last byte. */
- 0, 0, 0, 0, 1, 1, 1, 1, 2, 2, 2, 2, 3, 3, 3, 3,
- 4, 4, 4, 4, 5, 5, 5, 5, 6, 6, 6, 6, 7, 7, 7, 7,
- 8, 8, 8, 8, 9, 9, 9, 9, 10, 10, 10, 10, 11, 11, 11, 11,
- 12, 12, 12, 12, 13, 13, 13, 13, 14, 14, 14, 14, 15, 15, 15, 15,
- 16, 16, 16, 16, 17, 17, 17, 17, 18, 18, 18, 18, 19, 19, 19, 19,
- 20, 20, 20, 20, 21, 21, 21, 21, 22, 22, 22, 22, 23, 23, 23, 23,
- 24, 24, 24, 24, 25, 25, 25, 25, 26, 26, 26, 26, 27, 27, 27, 27,
- 28, 28, 28, 28, 29, 29, 29, 29, 30, 30, 30, 30, 31, 31, 31, 31,
- 32, 32, 32, 32, 33, 33, 33, 33, 34, 34, 34, 34, 35, 35, 35, 35,
- 36, 36, 36, 36, 37, 37, 37, 37, 38, 38, 38, 38, 39, 39, 39, 39,
- 40, 40, 40, 40, 41, 41, 41, 41, 42, 42, 42, 42, 43, 43, 43, 43,
- 44, 44, 44, 44, 45, 45, 45, 45, 46, 46, 46, 46, 47, 47, 47, 47,
- 48, 48, 48, 48, 49, 49, 49, 49, 50, 50, 50, 50, 51, 51, 51, 51,
- 52, 52, 52, 52, 53, 53, 53, 53, 54, 54, 54, 54, 55, 55, 55, 55,
- 56, 56, 56, 56, 57, 57, 57, 57, 58, 58, 58, 58, 59, 59, 59, 59,
- 60, 60, 60, 60, 61, 61, 61, 61, 62, 62, 62, 62, 63, 63, 63, 63,
-
- /* CONTEXT_MSB6, second last byte, */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
-
- /* CONTEXT_UTF8, last byte. */
- /* ASCII range. */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 4, 4, 0, 0, 4, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 8, 12, 16, 12, 12, 20, 12, 16, 24, 28, 12, 12, 32, 12, 36, 12,
- 44, 44, 44, 44, 44, 44, 44, 44, 44, 44, 32, 32, 24, 40, 28, 12,
- 12, 48, 52, 52, 52, 48, 52, 52, 52, 48, 52, 52, 52, 52, 52, 48,
- 52, 52, 52, 52, 52, 48, 52, 52, 52, 52, 52, 24, 12, 28, 12, 12,
- 12, 56, 60, 60, 60, 56, 60, 60, 60, 56, 60, 60, 60, 60, 60, 56,
- 60, 60, 60, 60, 60, 56, 60, 60, 60, 60, 60, 24, 12, 28, 12, 0,
- /* UTF8 continuation byte range. */
- 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
- 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
- 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
- 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1, 0, 1,
- /* UTF8 lead byte range. */
- 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
- 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
- 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
- 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3, 2, 3,
-
- /* CONTEXT_UTF8 second last byte. */
- /* ASCII range. */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1, 1,
- 1, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1,
- 1, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
- 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 1, 1, 1, 1, 0,
- /* UTF8 continuation byte range. */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- /* UTF8 lead byte range. */
- 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
-
- /* CONTEXT_SIGNED, last byte, same as the above values shifted by 3 bits. */
- 0, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8, 8,
- 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
- 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
- 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16, 16,
- 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
- 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
- 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
- 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24, 24,
- 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
- 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
- 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
- 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32, 32,
- 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
- 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
- 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40,
- 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 48, 56,
-
- /* CONTEXT_SIGNED, second last byte. */
- 0, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
- 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2,
- 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
- 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
- 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
- 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3, 3,
- 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
- 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
- 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
- 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
- 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
- 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
- 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5, 5,
- 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 6, 7,
-};
+BROTLI_COMMON_API extern const uint8_t _kBrotliContextLookupTable[2048];
typedef const uint8_t* ContextLut;
/* typeof(MODE) == ContextType; returns ContextLut */
-#define BROTLI_CONTEXT_LUT(MODE) (&kContextLookup[(MODE) << 9])
+#define BROTLI_CONTEXT_LUT(MODE) (&_kBrotliContextLookupTable[(MODE) << 9])
/* typeof(LUT) == ContextLut */
#define BROTLI_CONTEXT(P1, P2, LUT) ((LUT)[P1] | ((LUT) + 256)[P2])
diff --git a/c/common/dictionary.bin.br b/c/common/dictionary.bin.br
index 6a55d42..6a55d42 100755..100644
--- a/c/common/dictionary.bin.br
+++ b/c/common/dictionary.bin.br
Binary files differ
diff --git a/c/common/dictionary.c b/c/common/dictionary.c
index 64822a3..f9e3041 100644
--- a/c/common/dictionary.c
+++ b/c/common/dictionary.c
@@ -5,12 +5,13 @@
*/
#include "./dictionary.h"
+#include "./platform.h"
#if defined(__cplusplus) || defined(c_plusplus)
extern "C" {
#endif
-#ifndef BROTLI_EXTERNAL_DICTIONARY_DATA
+#if !defined(BROTLI_EXTERNAL_DICTIONARY_DATA)
static const uint8_t kBrotliDictionaryData[] =
{
116,105,109,101,100,111,119,110,108,105,102,101,108,101,102,116,98,97,99,107,99,
@@ -5862,7 +5863,11 @@ static const uint8_t kBrotliDictionaryData[] =
;
#endif /* !BROTLI_EXTERNAL_DICTIONARY_DATA */
+#if !defined(BROTLI_EXTERNAL_DICTIONARY_DATA)
+static const BrotliDictionary kBrotliDictionary = {
+#else
static BrotliDictionary kBrotliDictionary = {
+#endif
/* size_bits_by_length */
{
0, 0, 0, 0, 10, 10, 11, 11,
@@ -5895,9 +5900,13 @@ const BrotliDictionary* BrotliGetDictionary() {
}
void BrotliSetDictionaryData(const uint8_t* data) {
+#if defined(BROTLI_EXTERNAL_DICTIONARY_DATA)
if (!!data && !kBrotliDictionary.data) {
kBrotliDictionary.data = data;
}
+#else
+ BROTLI_UNUSED(data); // Appease -Werror=unused-parameter
+#endif
}
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/c/common/platform.c b/c/common/platform.c
new file mode 100644
index 0000000..aef39e9
--- /dev/null
+++ b/c/common/platform.c
@@ -0,0 +1,22 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include <stdlib.h>
+
+#include "./platform.h"
+#include <brotli/types.h>
+
+/* Default brotli_alloc_func */
+void* BrotliDefaultAllocFunc(void* opaque, size_t size) {
+ BROTLI_UNUSED(opaque);
+ return malloc(size);
+}
+
+/* Default brotli_free_func */
+void BrotliDefaultFreeFunc(void* opaque, void* address) {
+ BROTLI_UNUSED(opaque);
+ free(address);
+}
diff --git a/c/common/platform.h b/c/common/platform.h
index 84c448c..f5ca443 100755..100644
--- a/c/common/platform.h
+++ b/c/common/platform.h
@@ -24,12 +24,11 @@
#define BROTLI_COMMON_PLATFORM_H_
#include <string.h> /* memcpy */
-#include <stdlib.h> /* malloc, free */
#include <brotli/port.h>
#include <brotli/types.h>
-#if defined(OS_LINUX) || defined(OS_CYGWIN)
+#if defined(OS_LINUX) || defined(OS_CYGWIN) || defined(__EMSCRIPTEN__)
#include <endian.h>
#elif defined(OS_FREEBSD)
#include <machine/endian.h>
@@ -41,6 +40,10 @@
#define BROTLI_X_BIG_ENDIAN BIG_ENDIAN
#endif
+#if BROTLI_MSVC_VERSION_CHECK(12, 0, 0)
+#include <intrin.h>
+#endif
+
#if defined(BROTLI_ENABLE_LOG) || defined(BROTLI_DEBUG)
#include <assert.h>
#include <stdio.h>
@@ -308,8 +311,7 @@ static BROTLI_INLINE void BrotliUnalignedWrite64(void* p, uint64_t v) {
}
#else /* BROTLI_ALIGNED_READ */
/* Unaligned memory access is allowed: just cast pointer to requested type. */
-#if defined(ADDRESS_SANITIZER) || defined(THREAD_SANITIZER) || \
- defined(MEMORY_SANITIZER)
+#if BROTLI_SANITIZED
/* Consider we have an unaligned load/store of 4 bytes from address 0x...05.
AddressSanitizer will treat it as a 3-byte access to the range 05:07 and
will miss a bug if 08 is the first unaddressable byte.
@@ -334,7 +336,7 @@ extern "C" {
#define BrotliUnalignedRead32 __sanitizer_unaligned_load32
#define BrotliUnalignedRead64 __sanitizer_unaligned_load64
#define BrotliUnalignedWrite64 __sanitizer_unaligned_store64
-#else
+#else /* BROTLI_SANITIZED */
static BROTLI_INLINE uint16_t BrotliUnalignedRead16(const void* p) {
return *(const uint16_t*)p;
}
@@ -356,7 +358,7 @@ static BROTLI_INLINE void BrotliUnalignedWrite64(void* p, uint64_t v) {
typedef BROTLI_ALIGNED(1) uint64_t brotli_unaligned_uint64_t;
static BROTLI_INLINE uint64_t BrotliUnalignedRead64(const void* p) {
- return (uint64_t) ((brotli_unaligned_uint64_t*) p)[0];
+ return (uint64_t) ((const brotli_unaligned_uint64_t*) p)[0];
}
static BROTLI_INLINE void BrotliUnalignedWrite64(void* p, uint64_t v) {
brotli_unaligned_uint64_t* dwords = (brotli_unaligned_uint64_t*) p;
@@ -374,7 +376,7 @@ static BROTLI_INLINE void BrotliUnalignedWrite64(void* p, uint64_t v) {
}
#endif /* BROTLI_GNUC_HAS_ATTRIBUTE(aligned, 2, 7, 0) */
#endif /* BROTLI_64_BITS */
-#endif /* ASAN / TSAN / MSAN */
+#endif /* BROTLI_SANITIZED */
#endif /* BROTLI_ALIGNED_READ */
#if BROTLI_LITTLE_ENDIAN
@@ -466,20 +468,20 @@ static BROTLI_INLINE void BROTLI_UNALIGNED_STORE64LE(void* p, uint64_t v) {
#endif
#if defined(BROTLI_ENABLE_LOG)
-#define BROTLI_DCHECK(x) assert(x)
#define BROTLI_LOG(x) printf x
#else
-#define BROTLI_DCHECK(x)
#define BROTLI_LOG(x)
#endif
#if defined(BROTLI_DEBUG) || defined(BROTLI_ENABLE_LOG)
+#define BROTLI_DCHECK(x) assert(x)
static BROTLI_INLINE void BrotliDump(const char* f, int l, const char* fn) {
fprintf(stderr, "%s:%d (%s)\n", f, l, fn);
fflush(stderr);
}
#define BROTLI_DUMP() BrotliDump(__FILE__, __LINE__, __FUNCTION__)
#else
+#define BROTLI_DCHECK(x)
#define BROTLI_DUMP() (void)(0)
#endif
@@ -523,17 +525,41 @@ BROTLI_MIN_MAX(size_t) BROTLI_MIN_MAX(uint32_t) BROTLI_MIN_MAX(uint8_t)
(A)[(J)] = __brotli_swap_tmp; \
}
-/* Default brotli_alloc_func */
-static void* BrotliDefaultAllocFunc(void* opaque, size_t size) {
- BROTLI_UNUSED(opaque);
- return malloc(size);
+#if BROTLI_64_BITS
+#if BROTLI_GNUC_HAS_BUILTIN(__builtin_ctzll, 3, 4, 0) || \
+ BROTLI_INTEL_VERSION_CHECK(16, 0, 0)
+#define BROTLI_TZCNT64 __builtin_ctzll
+#elif BROTLI_MSVC_VERSION_CHECK(12, 0, 0)
+#if defined(BROTLI_TARGET_X64)
+#define BROTLI_TZCNT64 _tzcnt_u64
+#else /* BROTLI_TARGET_X64 */
+static BROTLI_INLINE uint32_t BrotliBsf64Msvc(uint64_t x) {
+ uint32_t lsb;
+ _BitScanForward64(&lsb, x);
+ return lsb;
}
+#define BROTLI_TZCNT64 BrotliBsf64Msvc
+#endif /* BROTLI_TARGET_X64 */
+#endif /* __builtin_ctzll */
+#endif /* BROTLI_64_BITS */
-/* Default brotli_free_func */
-static void BrotliDefaultFreeFunc(void* opaque, void* address) {
- BROTLI_UNUSED(opaque);
- free(address);
+#if BROTLI_GNUC_HAS_BUILTIN(__builtin_clz, 3, 4, 0) || \
+ BROTLI_INTEL_VERSION_CHECK(16, 0, 0)
+#define BROTLI_BSR32(x) (31u ^ (uint32_t)__builtin_clz(x))
+#elif BROTLI_MSVC_VERSION_CHECK(12, 0, 0)
+static BROTLI_INLINE uint32_t BrotliBsr32Msvc(uint32_t x) {
+ unsigned long msb;
+ _BitScanReverse(&msb, x);
+ return (uint32_t)msb;
}
+#define BROTLI_BSR32 BrotliBsr32Msvc
+#endif /* __builtin_clz */
+
+/* Default brotli_alloc_func */
+BROTLI_COMMON_API void* BrotliDefaultAllocFunc(void* opaque, size_t size);
+
+/* Default brotli_free_func */
+BROTLI_COMMON_API void BrotliDefaultFreeFunc(void* opaque, void* address);
BROTLI_UNUSED_FUNCTION void BrotliSuppressUnusedFunctions(void) {
BROTLI_UNUSED(&BrotliSuppressUnusedFunctions);
diff --git a/c/common/transform.c b/c/common/transform.c
index 426e635..f8fa433 100755..100644
--- a/c/common/transform.c
+++ b/c/common/transform.c
@@ -24,8 +24,8 @@ static const char kPrefixSuffix[217] =
/* 8x _0 _ _3 _8 _C _E _ _1 _7 _F */
" not \3er \3al \4ful \4ive \5less \4es"
/* Ax _5 _9 _D _2 _7 _D */
- "t \4ize \2\xc2\xa0\4ous \5 the \2e \0";
-/* Cx _2 _7___ ___ _A _F _5 _8 */
+ "t \4ize \2\xc2\xa0\4ous \5 the \2e "; /* \0 - implicit trailing zero. */
+/* Cx _2 _7___ ___ _A _F _5 _8 */
static const uint16_t kPrefixSuffixMap[50] = {
0x00, 0x02, 0x05, 0x0E, 0x13, 0x16, 0x18, 0x1E, 0x23, 0x25,
@@ -160,12 +160,13 @@ static const uint8_t kTransformsData[] = {
0, BROTLI_TRANSFORM_UPPERCASE_FIRST, 34,
};
-static BrotliTransforms kBrotliTransforms = {
+static const BrotliTransforms kBrotliTransforms = {
sizeof(kPrefixSuffix),
(const uint8_t*)kPrefixSuffix,
kPrefixSuffixMap,
sizeof(kTransformsData) / (3 * sizeof(kTransformsData[0])),
kTransformsData,
+ NULL, /* no extra parameters */
{0, 12, 27, 23, 42, 63, 56, 48, 59, 64}
};
@@ -190,6 +191,48 @@ static int ToUpperCase(uint8_t* p) {
return 3;
}
+static int Shift(uint8_t* word, int word_len, uint16_t parameter) {
+ /* Limited sign extension: scalar < (1 << 24). */
+ uint32_t scalar =
+ (parameter & 0x7FFFu) + (0x1000000u - (parameter & 0x8000u));
+ if (word[0] < 0x80) {
+ /* 1-byte rune / 0sssssss / 7 bit scalar (ASCII). */
+ scalar += (uint32_t)word[0];
+ word[0] = (uint8_t)(scalar & 0x7Fu);
+ return 1;
+ } else if (word[0] < 0xC0) {
+ /* Continuation / 10AAAAAA. */
+ return 1;
+ } else if (word[0] < 0xE0) {
+ /* 2-byte rune / 110sssss AAssssss / 11 bit scalar. */
+ if (word_len < 2) return 1;
+ scalar += (uint32_t)((word[1] & 0x3Fu) | ((word[0] & 0x1Fu) << 6u));
+ word[0] = (uint8_t)(0xC0 | ((scalar >> 6u) & 0x1F));
+ word[1] = (uint8_t)((word[1] & 0xC0) | (scalar & 0x3F));
+ return 2;
+ } else if (word[0] < 0xF0) {
+ /* 3-byte rune / 1110ssss AAssssss BBssssss / 16 bit scalar. */
+ if (word_len < 3) return word_len;
+ scalar += (uint32_t)((word[2] & 0x3Fu) | ((word[1] & 0x3Fu) << 6u) |
+ ((word[0] & 0x0Fu) << 12u));
+ word[0] = (uint8_t)(0xE0 | ((scalar >> 12u) & 0x0F));
+ word[1] = (uint8_t)((word[1] & 0xC0) | ((scalar >> 6u) & 0x3F));
+ word[2] = (uint8_t)((word[2] & 0xC0) | (scalar & 0x3F));
+ return 3;
+ } else if (word[0] < 0xF8) {
+ /* 4-byte rune / 11110sss AAssssss BBssssss CCssssss / 21 bit scalar. */
+ if (word_len < 4) return word_len;
+ scalar += (uint32_t)((word[3] & 0x3Fu) | ((word[2] & 0x3Fu) << 6u) |
+ ((word[1] & 0x3Fu) << 12u) | ((word[0] & 0x07u) << 18u));
+ word[0] = (uint8_t)(0xF0 | ((scalar >> 18u) & 0x07));
+ word[1] = (uint8_t)((word[1] & 0xC0) | ((scalar >> 12u) & 0x3F));
+ word[2] = (uint8_t)((word[2] & 0xC0) | ((scalar >> 6u) & 0x3F));
+ word[3] = (uint8_t)((word[3] & 0xC0) | (scalar & 0x3F));
+ return 4;
+ }
+ return 1;
+}
+
int BrotliTransformDictionaryWord(uint8_t* dst, const uint8_t* word, int len,
const BrotliTransforms* transforms, int transform_idx) {
int idx = 0;
@@ -221,6 +264,19 @@ int BrotliTransformDictionaryWord(uint8_t* dst, const uint8_t* word, int len,
uppercase += step;
len -= step;
}
+ } else if (t == BROTLI_TRANSFORM_SHIFT_FIRST) {
+ uint16_t param = (uint16_t)(transforms->params[transform_idx * 2]
+ + (transforms->params[transform_idx * 2 + 1] << 8u));
+ Shift(&dst[idx - len], len, param);
+ } else if (t == BROTLI_TRANSFORM_SHIFT_ALL) {
+ uint16_t param = (uint16_t)(transforms->params[transform_idx * 2]
+ + (transforms->params[transform_idx * 2 + 1] << 8u));
+ uint8_t* shift = &dst[idx - len];
+ while (len > 0) {
+ int step = Shift(shift, len, param);
+ shift += step;
+ len -= step;
+ }
}
}
{
diff --git a/c/common/transform.h b/c/common/transform.h
index 456c12d..b6f86cc 100755..100644
--- a/c/common/transform.h
+++ b/c/common/transform.h
@@ -37,6 +37,8 @@ enum BrotliWordTransformType {
BROTLI_TRANSFORM_OMIT_FIRST_7 = 18,
BROTLI_TRANSFORM_OMIT_FIRST_8 = 19,
BROTLI_TRANSFORM_OMIT_FIRST_9 = 20,
+ BROTLI_TRANSFORM_SHIFT_FIRST = 21,
+ BROTLI_TRANSFORM_SHIFT_ALL = 22,
BROTLI_NUM_TRANSFORM_TYPES /* Counts transforms, not a transform itself. */
};
@@ -50,6 +52,9 @@ typedef struct BrotliTransforms {
uint32_t num_transforms;
/* Each entry is a [prefix_id, transform, suffix_id] triplet. */
const uint8_t* transforms;
+ /* Shift for BROTLI_TRANSFORM_SHIFT_FIRST and BROTLI_TRANSFORM_SHIFT_ALL,
+ must be NULL if and only if no such transforms are present. */
+ const uint8_t* params;
/* Indices of transforms like ["", BROTLI_TRANSFORM_OMIT_LAST_#, ""].
0-th element corresponds to ["", BROTLI_TRANSFORM_IDENTITY, ""].
-1, if cut-off transform does not exist. */
diff --git a/c/common/version.h b/c/common/version.h
index 0d0d0c7..01b2998 100644
--- a/c/common/version.h
+++ b/c/common/version.h
@@ -14,13 +14,13 @@
BrotliEncoderVersion methods. */
/* Semantic version, calculated as (MAJOR << 24) | (MINOR << 12) | PATCH */
-#define BROTLI_VERSION 0x1000007
+#define BROTLI_VERSION 0x1000009
/* This macro is used by build system to produce Libtool-friendly soname. See
https://www.gnu.org/software/libtool/manual/html_node/Libtool-versioning.html
*/
/* ABI version, calculated as (CURRENT << 24) | (REVISION << 12) | AGE */
-#define BROTLI_ABI_VERSION 0x1007000
+#define BROTLI_ABI_VERSION 0x1009000
#endif /* BROTLI_COMMON_VERSION_H_ */
diff --git a/c/dec/bit_reader.c b/c/dec/bit_reader.c
index 722fd90..7f7b256 100644
--- a/c/dec/bit_reader.c
+++ b/c/dec/bit_reader.c
@@ -15,6 +15,17 @@
extern "C" {
#endif
+const uint32_t kBrotliBitMask[33] = { 0x00000000,
+ 0x00000001, 0x00000003, 0x00000007, 0x0000000F,
+ 0x0000001F, 0x0000003F, 0x0000007F, 0x000000FF,
+ 0x000001FF, 0x000003FF, 0x000007FF, 0x00000FFF,
+ 0x00001FFF, 0x00003FFF, 0x00007FFF, 0x0000FFFF,
+ 0x0001FFFF, 0x0003FFFF, 0x0007FFFF, 0x000FFFFF,
+ 0x001FFFFF, 0x003FFFFF, 0x007FFFFF, 0x00FFFFFF,
+ 0x01FFFFFF, 0x03FFFFFF, 0x07FFFFFF, 0x0FFFFFFF,
+ 0x1FFFFFFF, 0x3FFFFFFF, 0x7FFFFFFF, 0xFFFFFFFF
+};
+
void BrotliInitBitReader(BrotliBitReader* const br) {
br->val_ = 0;
br->bit_pos_ = sizeof(br->val_) << 3;
@@ -43,6 +54,23 @@ BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br) {
return BROTLI_TRUE;
}
+BROTLI_BOOL BrotliSafeReadBits32Slow(BrotliBitReader* const br,
+ uint32_t n_bits, uint32_t* val) {
+ uint32_t low_val;
+ uint32_t high_val;
+ BrotliBitReaderState memento;
+ BROTLI_DCHECK(n_bits <= 32);
+ BROTLI_DCHECK(n_bits > 24);
+ BrotliBitReaderSaveState(br, &memento);
+ if (!BrotliSafeReadBits(br, 16, &low_val) ||
+ !BrotliSafeReadBits(br, n_bits - 16, &high_val)) {
+ BrotliBitReaderRestoreState(br, &memento);
+ return BROTLI_FALSE;
+ }
+ *val = low_val | (high_val << 16);
+ return BROTLI_TRUE;
+}
+
#if defined(__cplusplus) || defined(c_plusplus)
} /* extern "C" */
#endif
diff --git a/c/dec/bit_reader.h b/c/dec/bit_reader.h
index c06e914..22bc060 100644
--- a/c/dec/bit_reader.h
+++ b/c/dec/bit_reader.h
@@ -11,6 +11,7 @@
#include <string.h> /* memcpy */
+#include "../common/constants.h"
#include "../common/platform.h"
#include <brotli/types.h>
@@ -20,16 +21,7 @@ extern "C" {
#define BROTLI_SHORT_FILL_BIT_WINDOW_READ (sizeof(brotli_reg_t) >> 1)
-static const uint32_t kBitMask[33] = { 0x00000000,
- 0x00000001, 0x00000003, 0x00000007, 0x0000000F,
- 0x0000001F, 0x0000003F, 0x0000007F, 0x000000FF,
- 0x000001FF, 0x000003FF, 0x000007FF, 0x00000FFF,
- 0x00001FFF, 0x00003FFF, 0x00007FFF, 0x0000FFFF,
- 0x0001FFFF, 0x0003FFFF, 0x0007FFFF, 0x000FFFFF,
- 0x001FFFFF, 0x003FFFFF, 0x007FFFFF, 0x00FFFFFF,
- 0x01FFFFFF, 0x03FFFFFF, 0x07FFFFFF, 0x0FFFFFFF,
- 0x1FFFFFFF, 0x3FFFFFFF, 0x7FFFFFFF, 0xFFFFFFFF
-};
+BROTLI_INTERNAL extern const uint32_t kBrotliBitMask[33];
static BROTLI_INLINE uint32_t BitMask(uint32_t n) {
if (BROTLI_IS_CONSTANT(n) || BROTLI_HAS_UBFX) {
@@ -37,7 +29,7 @@ static BROTLI_INLINE uint32_t BitMask(uint32_t n) {
"Unsigned Bit Field Extract" UBFX instruction on ARM. */
return ~((0xFFFFFFFFu) << n);
} else {
- return kBitMask[n];
+ return kBrotliBitMask[n];
}
}
@@ -65,6 +57,12 @@ BROTLI_INTERNAL void BrotliInitBitReader(BrotliBitReader* const br);
reading. */
BROTLI_INTERNAL BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br);
+/* Fallback for BrotliSafeReadBits32. Extracted as noninlined method to unburden
+ the main code-path. Never called for RFC brotli streams, required only for
+ "large-window" mode and other extensions. */
+BROTLI_INTERNAL BROTLI_NOINLINE BROTLI_BOOL BrotliSafeReadBits32Slow(
+ BrotliBitReader* const br, uint32_t n_bits, uint32_t* val);
+
static BROTLI_INLINE void BrotliBitReaderSaveState(
BrotliBitReader* const from, BrotliBitReaderState* to) {
to->val_ = from->val_;
@@ -87,8 +85,11 @@ static BROTLI_INLINE uint32_t BrotliGetAvailableBits(
}
/* Returns amount of unread bytes the bit reader still has buffered from the
- BrotliInput, including whole bytes in br->val_. */
+ BrotliInput, including whole bytes in br->val_. Result is capped with
+ maximal ring-buffer size (larger number won't be utilized anyway). */
static BROTLI_INLINE size_t BrotliGetRemainingBytes(BrotliBitReader* br) {
+ static const size_t kCap = (size_t)1 << BROTLI_LARGE_MAX_WBITS;
+ if (br->avail_in > kCap) return kCap;
return br->avail_in + (BrotliGetAvailableBits(br) >> 3);
}
@@ -237,15 +238,17 @@ static BROTLI_INLINE void BrotliBitReaderUnload(BrotliBitReader* br) {
static BROTLI_INLINE void BrotliTakeBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
*val = (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
- BROTLI_LOG(("[BrotliReadBits] %d %d %d val: %6x\n",
+ BROTLI_LOG(("[BrotliTakeBits] %d %d %d val: %6x\n",
(int)br->avail_in, (int)br->bit_pos_, (int)n_bits, (int)*val));
BrotliDropBits(br, n_bits);
}
/* Reads the specified number of bits from |br| and advances the bit pos.
- Assumes that there is enough input to perform BrotliFillBitWindow. */
-static BROTLI_INLINE uint32_t BrotliReadBits(
+ Assumes that there is enough input to perform BrotliFillBitWindow.
+ Up to 24 bits are allowed to be requested from this method. */
+static BROTLI_INLINE uint32_t BrotliReadBits24(
BrotliBitReader* const br, uint32_t n_bits) {
+ BROTLI_DCHECK(n_bits <= 24);
if (BROTLI_64_BITS || (n_bits <= 16)) {
uint32_t val;
BrotliFillBitWindow(br, n_bits);
@@ -262,10 +265,32 @@ static BROTLI_INLINE uint32_t BrotliReadBits(
}
}
+/* Same as BrotliReadBits24, but allows reading up to 32 bits. */
+static BROTLI_INLINE uint32_t BrotliReadBits32(
+ BrotliBitReader* const br, uint32_t n_bits) {
+ BROTLI_DCHECK(n_bits <= 32);
+ if (BROTLI_64_BITS || (n_bits <= 16)) {
+ uint32_t val;
+ BrotliFillBitWindow(br, n_bits);
+ BrotliTakeBits(br, n_bits, &val);
+ return val;
+ } else {
+ uint32_t low_val;
+ uint32_t high_val;
+ BrotliFillBitWindow(br, 16);
+ BrotliTakeBits(br, 16, &low_val);
+ BrotliFillBitWindow(br, 16);
+ BrotliTakeBits(br, n_bits - 16, &high_val);
+ return low_val | (high_val << 16);
+ }
+}
+
/* Tries to read the specified amount of bits. Returns BROTLI_FALSE, if there
- is not enough input. |n_bits| MUST be positive. */
+ is not enough input. |n_bits| MUST be positive.
+ Up to 24 bits are allowed to be requested from this method. */
static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits(
BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
+ BROTLI_DCHECK(n_bits <= 24);
while (BrotliGetAvailableBits(br) < n_bits) {
if (!BrotliPullByte(br)) {
return BROTLI_FALSE;
@@ -275,6 +300,23 @@ static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits(
return BROTLI_TRUE;
}
+/* Same as BrotliSafeReadBits, but allows reading up to 32 bits. */
+static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits32(
+ BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
+ BROTLI_DCHECK(n_bits <= 32);
+ if (BROTLI_64_BITS || (n_bits <= 24)) {
+ while (BrotliGetAvailableBits(br) < n_bits) {
+ if (!BrotliPullByte(br)) {
+ return BROTLI_FALSE;
+ }
+ }
+ BrotliTakeBits(br, n_bits, val);
+ return BROTLI_TRUE;
+ } else {
+ return BrotliSafeReadBits32Slow(br, n_bits, val);
+ }
+}
+
/* Advances the bit reader position to the next byte boundary and verifies
that any skipped bits are set to zero. */
static BROTLI_INLINE BROTLI_BOOL BrotliJumpToByteBoundary(BrotliBitReader* br) {
diff --git a/c/dec/decode.c b/c/dec/decode.c
index 08bd76c..ae5a3d3 100644
--- a/c/dec/decode.c
+++ b/c/dec/decode.c
@@ -41,7 +41,8 @@ extern "C" {
/* We need the slack region for the following reasons:
- doing up to two 16-byte copies for fast backward copying
- - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
+ - inserting transformed dictionary word:
+ 5 prefix + 24 base + 8 suffix */
static const uint32_t kRingBufferWriteAheadSlack = 42;
static const uint8_t kCodeLengthCodeOrder[BROTLI_CODE_LENGTH_CODES] = {
@@ -274,7 +275,8 @@ static BrotliDecoderErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
s->loop_counter = i;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- if (i + 1 == s->size_nibbles && s->size_nibbles > 4 && bits == 0) {
+ if (i + 1 == (int)s->size_nibbles && s->size_nibbles > 4 &&
+ bits == 0) {
return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_NIBBLE);
}
s->meta_block_remaining_len |= (int)(bits << (i * 4));
@@ -323,7 +325,8 @@ static BrotliDecoderErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
s->loop_counter = i;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- if (i + 1 == s->size_nibbles && s->size_nibbles > 1 && bits == 0) {
+ if (i + 1 == (int)s->size_nibbles && s->size_nibbles > 1 &&
+ bits == 0) {
return BROTLI_FAILURE(
BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
}
@@ -470,32 +473,34 @@ static BROTLI_INLINE uint32_t Log2Floor(uint32_t x) {
Totally 1..4 symbols are read, 1..11 bits each.
The list of symbols MUST NOT contain duplicates. */
static BrotliDecoderErrorCode ReadSimpleHuffmanSymbols(
- uint32_t alphabet_size, uint32_t max_symbol, BrotliDecoderState* s) {
+ uint32_t alphabet_size_max, uint32_t alphabet_size_limit,
+ BrotliDecoderState* s) {
/* max_bits == 1..11; symbol == 0..3; 1..44 bits will be read. */
BrotliBitReader* br = &s->br;
- uint32_t max_bits = Log2Floor(alphabet_size - 1);
- uint32_t i = s->sub_loop_counter;
- uint32_t num_symbols = s->symbol;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
+ uint32_t max_bits = Log2Floor(alphabet_size_max - 1);
+ uint32_t i = h->sub_loop_counter;
+ uint32_t num_symbols = h->symbol;
while (i <= num_symbols) {
uint32_t v;
if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
- s->sub_loop_counter = i;
- s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_READ;
+ h->sub_loop_counter = i;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_READ;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- if (v >= max_symbol) {
+ if (v >= alphabet_size_limit) {
return
BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
}
- s->symbols_lists_array[i] = (uint16_t)v;
- BROTLI_LOG_UINT(s->symbols_lists_array[i]);
+ h->symbols_lists_array[i] = (uint16_t)v;
+ BROTLI_LOG_UINT(h->symbols_lists_array[i]);
++i;
}
for (i = 0; i < num_symbols; ++i) {
uint32_t k = i + 1;
for (; k <= num_symbols; ++k) {
- if (s->symbols_lists_array[i] == s->symbols_lists_array[k]) {
+ if (h->symbols_lists_array[i] == h->symbols_lists_array[k]) {
return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
}
}
@@ -588,27 +593,28 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
static BrotliDecoderErrorCode ReadSymbolCodeLengths(
uint32_t alphabet_size, BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
- uint32_t symbol = s->symbol;
- uint32_t repeat = s->repeat;
- uint32_t space = s->space;
- uint32_t prev_code_len = s->prev_code_len;
- uint32_t repeat_code_len = s->repeat_code_len;
- uint16_t* symbol_lists = s->symbol_lists;
- uint16_t* code_length_histo = s->code_length_histo;
- int* next_symbol = s->next_symbol;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
+ uint32_t symbol = h->symbol;
+ uint32_t repeat = h->repeat;
+ uint32_t space = h->space;
+ uint32_t prev_code_len = h->prev_code_len;
+ uint32_t repeat_code_len = h->repeat_code_len;
+ uint16_t* symbol_lists = h->symbol_lists;
+ uint16_t* code_length_histo = h->code_length_histo;
+ int* next_symbol = h->next_symbol;
if (!BrotliWarmupBitReader(br)) {
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
while (symbol < alphabet_size && space > 0) {
- const HuffmanCode* p = s->table;
+ const HuffmanCode* p = h->table;
uint32_t code_len;
BROTLI_HC_MARK_TABLE_FOR_FAST_LOAD(p);
if (!BrotliCheckInputAmount(br, BROTLI_SHORT_FILL_BIT_WINDOW_READ)) {
- s->symbol = symbol;
- s->repeat = repeat;
- s->prev_code_len = prev_code_len;
- s->repeat_code_len = repeat_code_len;
- s->space = space;
+ h->symbol = symbol;
+ h->repeat = repeat;
+ h->prev_code_len = prev_code_len;
+ h->repeat_code_len = repeat_code_len;
+ h->space = space;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
BrotliFillBitWindow16(br);
@@ -630,16 +636,17 @@ static BrotliDecoderErrorCode ReadSymbolCodeLengths(
symbol_lists, code_length_histo, next_symbol);
}
}
- s->space = space;
+ h->space = space;
return BROTLI_DECODER_SUCCESS;
}
static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
uint32_t alphabet_size, BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
BROTLI_BOOL get_byte = BROTLI_FALSE;
- while (s->symbol < alphabet_size && s->space > 0) {
- const HuffmanCode* p = s->table;
+ while (h->symbol < alphabet_size && h->space > 0) {
+ const HuffmanCode* p = h->table;
uint32_t code_len;
uint32_t available_bits;
uint32_t bits = 0;
@@ -659,9 +666,9 @@ static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
code_len = BROTLI_HC_FAST_LOAD_VALUE(p); /* code_len == 0..17 */
if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
BrotliDropBits(br, BROTLI_HC_FAST_LOAD_BITS(p));
- ProcessSingleCodeLength(code_len, &s->symbol, &s->repeat, &s->space,
- &s->prev_code_len, s->symbol_lists, s->code_length_histo,
- s->next_symbol);
+ ProcessSingleCodeLength(code_len, &h->symbol, &h->repeat, &h->space,
+ &h->prev_code_len, h->symbol_lists, h->code_length_histo,
+ h->next_symbol);
} else { /* code_len == 16..17, extra_bits == 2..3 */
uint32_t extra_bits = code_len - 14U;
uint32_t repeat_delta = (bits >> BROTLI_HC_FAST_LOAD_BITS(p)) &
@@ -672,9 +679,9 @@ static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
}
BrotliDropBits(br, BROTLI_HC_FAST_LOAD_BITS(p) + extra_bits);
ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
- &s->symbol, &s->repeat, &s->space, &s->prev_code_len,
- &s->repeat_code_len, s->symbol_lists, s->code_length_histo,
- s->next_symbol);
+ &h->symbol, &h->repeat, &h->space, &h->prev_code_len,
+ &h->repeat_code_len, h->symbol_lists, h->code_length_histo,
+ h->next_symbol);
}
}
return BROTLI_DECODER_SUCCESS;
@@ -684,9 +691,10 @@ static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
Each code is 2..4 bits long. In total 30..72 bits are used. */
static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
- uint32_t num_codes = s->repeat;
- unsigned space = s->space;
- uint32_t i = s->sub_loop_counter;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
+ uint32_t num_codes = h->repeat;
+ unsigned space = h->space;
+ uint32_t i = h->sub_loop_counter;
for (; i < BROTLI_CODE_LENGTH_CODES; ++i) {
const uint8_t code_len_idx = kCodeLengthCodeOrder[i];
uint32_t ix;
@@ -699,21 +707,21 @@ static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
ix = 0;
}
if (kCodeLengthPrefixLength[ix] > available_bits) {
- s->sub_loop_counter = i;
- s->repeat = num_codes;
- s->space = space;
- s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
+ h->sub_loop_counter = i;
+ h->repeat = num_codes;
+ h->space = space;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
}
v = kCodeLengthPrefixValue[ix];
BrotliDropBits(br, kCodeLengthPrefixLength[ix]);
- s->code_length_code_lengths[code_len_idx] = (uint8_t)v;
- BROTLI_LOG_ARRAY_INDEX(s->code_length_code_lengths, code_len_idx);
+ h->code_length_code_lengths[code_len_idx] = (uint8_t)v;
+ BROTLI_LOG_ARRAY_INDEX(h->code_length_code_lengths, code_len_idx);
if (v != 0) {
space = space - (32U >> v);
++num_codes;
- ++s->code_length_histo[v];
+ ++h->code_length_histo[v];
if (space - 1U >= 32U) {
/* space is 0 or wrapped around. */
break;
@@ -737,49 +745,48 @@ static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
encoded with predefined entropy code. 32 - 74 bits are used.
B.2) Decoded table is used to decode code lengths of symbols in resulting
Huffman table. In worst case 3520 bits are read. */
-static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
- uint32_t max_symbol,
+static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size_max,
+ uint32_t alphabet_size_limit,
HuffmanCode* table,
uint32_t* opt_table_size,
BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
- /* Unnecessary masking, but might be good for safety. */
- alphabet_size &= 0x7FF;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
/* State machine. */
for (;;) {
- switch (s->substate_huffman) {
+ switch (h->substate_huffman) {
case BROTLI_STATE_HUFFMAN_NONE:
- if (!BrotliSafeReadBits(br, 2, &s->sub_loop_counter)) {
+ if (!BrotliSafeReadBits(br, 2, &h->sub_loop_counter)) {
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- BROTLI_LOG_UINT(s->sub_loop_counter);
+ BROTLI_LOG_UINT(h->sub_loop_counter);
/* The value is used as follows:
1 for simple code;
0 for no skipping, 2 skips 2 code lengths, 3 skips 3 code lengths */
- if (s->sub_loop_counter != 1) {
- s->space = 32;
- s->repeat = 0; /* num_codes */
- memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo[0]) *
+ if (h->sub_loop_counter != 1) {
+ h->space = 32;
+ h->repeat = 0; /* num_codes */
+ memset(&h->code_length_histo[0], 0, sizeof(h->code_length_histo[0]) *
(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1));
- memset(&s->code_length_code_lengths[0], 0,
- sizeof(s->code_length_code_lengths));
- s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
+ memset(&h->code_length_code_lengths[0], 0,
+ sizeof(h->code_length_code_lengths));
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
continue;
}
/* Fall through. */
case BROTLI_STATE_HUFFMAN_SIMPLE_SIZE:
/* Read symbols, codes & code lengths directly. */
- if (!BrotliSafeReadBits(br, 2, &s->symbol)) { /* num_symbols */
- s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
+ if (!BrotliSafeReadBits(br, 2, &h->symbol)) { /* num_symbols */
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- s->sub_loop_counter = 0;
+ h->sub_loop_counter = 0;
/* Fall through. */
case BROTLI_STATE_HUFFMAN_SIMPLE_READ: {
BrotliDecoderErrorCode result =
- ReadSimpleHuffmanSymbols(alphabet_size, max_symbol, s);
+ ReadSimpleHuffmanSymbols(alphabet_size_max, alphabet_size_limit, s);
if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
@@ -788,21 +795,21 @@ static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
case BROTLI_STATE_HUFFMAN_SIMPLE_BUILD: {
uint32_t table_size;
- if (s->symbol == 3) {
+ if (h->symbol == 3) {
uint32_t bits;
if (!BrotliSafeReadBits(br, 1, &bits)) {
- s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
- s->symbol += bits;
+ h->symbol += bits;
}
- BROTLI_LOG_UINT(s->symbol);
+ BROTLI_LOG_UINT(h->symbol);
table_size = BrotliBuildSimpleHuffmanTable(
- table, HUFFMAN_TABLE_BITS, s->symbols_lists_array, s->symbol);
+ table, HUFFMAN_TABLE_BITS, h->symbols_lists_array, h->symbol);
if (opt_table_size) {
*opt_table_size = table_size;
}
- s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
return BROTLI_DECODER_SUCCESS;
}
@@ -813,44 +820,45 @@ static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
- BrotliBuildCodeLengthsHuffmanTable(s->table,
- s->code_length_code_lengths,
- s->code_length_histo);
- memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo));
+ BrotliBuildCodeLengthsHuffmanTable(h->table,
+ h->code_length_code_lengths,
+ h->code_length_histo);
+ memset(&h->code_length_histo[0], 0, sizeof(h->code_length_histo));
for (i = 0; i <= BROTLI_HUFFMAN_MAX_CODE_LENGTH; ++i) {
- s->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
- s->symbol_lists[s->next_symbol[i]] = 0xFFFF;
+ h->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
+ h->symbol_lists[h->next_symbol[i]] = 0xFFFF;
}
- s->symbol = 0;
- s->prev_code_len = BROTLI_INITIAL_REPEATED_CODE_LENGTH;
- s->repeat = 0;
- s->repeat_code_len = 0;
- s->space = 32768;
- s->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
+ h->symbol = 0;
+ h->prev_code_len = BROTLI_INITIAL_REPEATED_CODE_LENGTH;
+ h->repeat = 0;
+ h->repeat_code_len = 0;
+ h->space = 32768;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
}
/* Fall through. */
case BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS: {
uint32_t table_size;
- BrotliDecoderErrorCode result = ReadSymbolCodeLengths(max_symbol, s);
+ BrotliDecoderErrorCode result = ReadSymbolCodeLengths(
+ alphabet_size_limit, s);
if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
- result = SafeReadSymbolCodeLengths(max_symbol, s);
+ result = SafeReadSymbolCodeLengths(alphabet_size_limit, s);
}
if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
- if (s->space != 0) {
- BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", (int)s->space));
+ if (h->space != 0) {
+ BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", (int)h->space));
return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_HUFFMAN_SPACE);
}
table_size = BrotliBuildHuffmanTable(
- table, HUFFMAN_TABLE_BITS, s->symbol_lists, s->code_length_histo);
+ table, HUFFMAN_TABLE_BITS, h->symbol_lists, h->code_length_histo);
if (opt_table_size) {
*opt_table_size = table_size;
}
- s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
return BROTLI_DECODER_SUCCESS;
}
@@ -867,8 +875,8 @@ static BROTLI_INLINE uint32_t ReadBlockLength(const HuffmanCode* table,
uint32_t code;
uint32_t nbits;
code = ReadSymbol(table, br);
- nbits = kBlockLengthPrefixCode[code].nbits; /* nbits == 2..24 */
- return kBlockLengthPrefixCode[code].offset + BrotliReadBits(br, nbits);
+ nbits = _kBrotliPrefixCodeRanges[code].nbits; /* nbits == 2..24 */
+ return _kBrotliPrefixCodeRanges[code].offset + BrotliReadBits24(br, nbits);
}
/* WARNING: if state is not BROTLI_STATE_READ_BLOCK_LENGTH_NONE, then
@@ -886,13 +894,14 @@ static BROTLI_INLINE BROTLI_BOOL SafeReadBlockLength(
}
{
uint32_t bits;
- uint32_t nbits = kBlockLengthPrefixCode[index].nbits; /* nbits == 2..24 */
+ uint32_t nbits = _kBrotliPrefixCodeRanges[index].nbits;
+ uint32_t offset = _kBrotliPrefixCodeRanges[index].offset;
if (!BrotliSafeReadBits(br, nbits, &bits)) {
s->block_length_index = index;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX;
return BROTLI_FALSE;
}
- *result = kBlockLengthPrefixCode[index].offset + bits;
+ *result = offset + bits;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
return BROTLI_TRUE;
}
@@ -952,22 +961,22 @@ static BROTLI_NOINLINE void InverseMoveToFrontTransform(
/* Decodes a series of Huffman table using ReadHuffmanCode function. */
static BrotliDecoderErrorCode HuffmanTreeGroupDecode(
HuffmanTreeGroup* group, BrotliDecoderState* s) {
- if (s->substate_tree_group != BROTLI_STATE_TREE_GROUP_LOOP) {
- s->next = group->codes;
- s->htree_index = 0;
- s->substate_tree_group = BROTLI_STATE_TREE_GROUP_LOOP;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
+ if (h->substate_tree_group != BROTLI_STATE_TREE_GROUP_LOOP) {
+ h->next = group->codes;
+ h->htree_index = 0;
+ h->substate_tree_group = BROTLI_STATE_TREE_GROUP_LOOP;
}
- while (s->htree_index < group->num_htrees) {
+ while (h->htree_index < group->num_htrees) {
uint32_t table_size;
- BrotliDecoderErrorCode result =
- ReadHuffmanCode(group->alphabet_size, group->max_symbol,
- s->next, &table_size, s);
+ BrotliDecoderErrorCode result = ReadHuffmanCode(group->alphabet_size_max,
+ group->alphabet_size_limit, h->next, &table_size, s);
if (result != BROTLI_DECODER_SUCCESS) return result;
- group->htrees[s->htree_index] = s->next;
- s->next += table_size;
- ++s->htree_index;
+ group->htrees[h->htree_index] = h->next;
+ h->next += table_size;
+ ++h->htree_index;
}
- s->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
+ h->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
return BROTLI_DECODER_SUCCESS;
}
@@ -985,15 +994,16 @@ static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
BrotliDecoderState* s) {
BrotliBitReader* br = &s->br;
BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
+ BrotliMetablockHeaderArena* h = &s->arena.header;
- switch ((int)s->substate_context_map) {
+ switch ((int)h->substate_context_map) {
case BROTLI_STATE_CONTEXT_MAP_NONE:
result = DecodeVarLenUint8(s, br, num_htrees);
if (result != BROTLI_DECODER_SUCCESS) {
return result;
}
(*num_htrees)++;
- s->context_index = 0;
+ h->context_index = 0;
BROTLI_LOG_UINT(context_map_size);
BROTLI_LOG_UINT(*num_htrees);
*context_map_arg =
@@ -1005,7 +1015,7 @@ static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
memset(*context_map_arg, 0, (size_t)context_map_size);
return BROTLI_DECODER_SUCCESS;
}
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_READ_PREFIX;
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_READ_PREFIX;
/* Fall through. */
case BROTLI_STATE_CONTEXT_MAP_READ_PREFIX: {
@@ -1016,38 +1026,38 @@ static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if ((bits & 1) != 0) { /* Use RLE for zeros. */
- s->max_run_length_prefix = (bits >> 1) + 1;
+ h->max_run_length_prefix = (bits >> 1) + 1;
BrotliDropBits(br, 5);
} else {
- s->max_run_length_prefix = 0;
+ h->max_run_length_prefix = 0;
BrotliDropBits(br, 1);
}
- BROTLI_LOG_UINT(s->max_run_length_prefix);
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_HUFFMAN;
+ BROTLI_LOG_UINT(h->max_run_length_prefix);
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_HUFFMAN;
}
/* Fall through. */
case BROTLI_STATE_CONTEXT_MAP_HUFFMAN: {
- uint32_t alphabet_size = *num_htrees + s->max_run_length_prefix;
+ uint32_t alphabet_size = *num_htrees + h->max_run_length_prefix;
result = ReadHuffmanCode(alphabet_size, alphabet_size,
- s->context_map_table, NULL, s);
+ h->context_map_table, NULL, s);
if (result != BROTLI_DECODER_SUCCESS) return result;
- s->code = 0xFFFF;
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_DECODE;
+ h->code = 0xFFFF;
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_DECODE;
}
/* Fall through. */
case BROTLI_STATE_CONTEXT_MAP_DECODE: {
- uint32_t context_index = s->context_index;
- uint32_t max_run_length_prefix = s->max_run_length_prefix;
+ uint32_t context_index = h->context_index;
+ uint32_t max_run_length_prefix = h->max_run_length_prefix;
uint8_t* context_map = *context_map_arg;
- uint32_t code = s->code;
+ uint32_t code = h->code;
BROTLI_BOOL skip_preamble = (code != 0xFFFF);
while (context_index < context_map_size || skip_preamble) {
if (!skip_preamble) {
- if (!SafeReadSymbol(s->context_map_table, br, &code)) {
- s->code = 0xFFFF;
- s->context_index = context_index;
+ if (!SafeReadSymbol(h->context_map_table, br, &code)) {
+ h->code = 0xFFFF;
+ h->context_index = context_index;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
BROTLI_LOG_UINT(code);
@@ -1068,8 +1078,8 @@ static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
{
uint32_t reps;
if (!BrotliSafeReadBits(br, code, &reps)) {
- s->code = code;
- s->context_index = context_index;
+ h->code = code;
+ h->context_index = context_index;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
reps += 1U << code;
@@ -1089,13 +1099,13 @@ static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
case BROTLI_STATE_CONTEXT_MAP_TRANSFORM: {
uint32_t bits;
if (!BrotliSafeReadBits(br, 1, &bits)) {
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_TRANSFORM;
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_TRANSFORM;
return BROTLI_DECODER_NEEDS_MORE_INPUT;
}
if (bits != 0) {
InverseMoveToFrontTransform(*context_map_arg, context_map_size, s);
}
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
return BROTLI_DECODER_SUCCESS;
}
@@ -1457,32 +1467,28 @@ static BrotliDecoderErrorCode ReadContextModes(BrotliDecoderState* s) {
}
static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliDecoderState* s) {
- if (s->distance_code == 0) {
- --s->dist_rb_idx;
- s->distance_code = s->dist_rb[s->dist_rb_idx & 3];
+ int offset = s->distance_code - 3;
+ if (s->distance_code <= 3) {
/* Compensate double distance-ring-buffer roll for dictionary items. */
- s->distance_context = 1;
+ s->distance_context = 1 >> s->distance_code;
+ s->distance_code = s->dist_rb[(s->dist_rb_idx - offset) & 3];
+ s->dist_rb_idx -= s->distance_context;
} else {
- int distance_code = s->distance_code << 1;
- /* kDistanceShortCodeIndexOffset has 2-bit values from LSB:
- 3, 2, 1, 0, 3, 3, 3, 3, 3, 3, 2, 2, 2, 2, 2, 2 */
- const uint32_t kDistanceShortCodeIndexOffset = 0xAAAFFF1B;
- /* kDistanceShortCodeValueOffset has 2-bit values from LSB:
- -0, 0,-0, 0,-1, 1,-2, 2,-3, 3,-1, 1,-2, 2,-3, 3 */
- const uint32_t kDistanceShortCodeValueOffset = 0xFA5FA500;
- int v = (s->dist_rb_idx +
- (int)(kDistanceShortCodeIndexOffset >> distance_code)) & 0x3;
- s->distance_code = s->dist_rb[v];
- v = (int)(kDistanceShortCodeValueOffset >> distance_code) & 0x3;
- if ((distance_code & 0x3) != 0) {
- s->distance_code += v;
+ int index_delta = 3;
+ int delta;
+ int base = s->distance_code - 10;
+ if (s->distance_code < 10) {
+ base = s->distance_code - 4;
} else {
- s->distance_code -= v;
- if (s->distance_code <= 0) {
- /* A huge distance will cause a BROTLI_FAILURE() soon.
- This is a little faster than failing here. */
- s->distance_code = 0x7FFFFFFF;
- }
+ index_delta = 2;
+ }
+ /* Unpack one of six 4-bit values. */
+ delta = ((0x605142 >> (4 * base)) & 0xF) - 3;
+ s->distance_code = s->dist_rb[(s->dist_rb_idx + index_delta) & 0x3] + delta;
+ if (s->distance_code <= 0) {
+ /* A huge distance will cause a BROTLI_FAILURE() soon.
+ This is a little faster than failing here. */
+ s->distance_code = 0x7FFFFFFF;
}
}
}
@@ -1497,62 +1503,153 @@ static BROTLI_INLINE BROTLI_BOOL SafeReadBits(
}
}
+static BROTLI_INLINE BROTLI_BOOL SafeReadBits32(
+ BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
+ if (n_bits != 0) {
+ return BrotliSafeReadBits32(br, n_bits, val);
+ } else {
+ *val = 0;
+ return BROTLI_TRUE;
+ }
+}
+
+/*
+ RFC 7932 Section 4 with "..." shortenings and "[]" emendations.
+
+ Each distance ... is represented with a pair <distance code, extra bits>...
+ The distance code is encoded using a prefix code... The number of extra bits
+ can be 0..24... Two additional parameters: NPOSTFIX (0..3), and ...
+ NDIRECT (0..120) ... are encoded in the meta-block header...
+
+ The first 16 distance symbols ... reference past distances... ring buffer ...
+ Next NDIRECT distance symbols ... represent distances from 1 to NDIRECT...
+ [For] distance symbols 16 + NDIRECT and greater ... the number of extra bits
+ ... is given by the following formula:
+
+ [ xcode = dcode - NDIRECT - 16 ]
+ ndistbits = 1 + [ xcode ] >> (NPOSTFIX + 1)
+
+ ...
+*/
+
+/*
+ RFC 7932 Section 9.2 with "..." shortenings and "[]" emendations.
+
+ ... to get the actual value of the parameter NDIRECT, left-shift this
+ four-bit number by NPOSTFIX bits ...
+*/
+
+/* Remaining formulas from RFC 7932 Section 4 could be rewritten as following:
+
+ alphabet_size = 16 + NDIRECT + (max_distbits << (NPOSTFIX + 1))
+
+ half = ((xcode >> NPOSTFIX) & 1) << ndistbits
+ postfix = xcode & ((1 << NPOSTFIX) - 1)
+ range_start = 2 * (1 << ndistbits - 1 - 1)
+
+ distance = (range_start + half + extra) << NPOSTFIX + postfix + NDIRECT + 1
+
+ NB: ndistbits >= 1 -> range_start >= 0
+ NB: range_start has factor 2, as the range is covered by 2 "halves"
+ NB: extra -1 offset in range_start formula covers the absence of
+ ndistbits = 0 case
+ NB: when NPOSTFIX = 0, NDIRECT is not greater than 15
+
+ In other words, xcode has the following binary structure - XXXHPPP:
+ - XXX represent the number of extra distance bits
+ - H selects upper / lower range of distances
+ - PPP represent "postfix"
+
+ "Regular" distance encoding has NPOSTFIX = 0; omitting the postfix part
+ simplifies distance calculation.
+
+ Using NPOSTFIX > 0 allows cheaper encoding of regular structures, e.g. where
+ most of distances have the same reminder of division by 2/4/8. For example,
+ the table of int32_t values that come from different sources; if it is likely
+ that 3 highest bytes of values from the same source are the same, then
+ copy distance often looks like 4x + y.
+
+ Distance calculation could be rewritten to:
+
+ ndistbits = NDISTBITS(NDIRECT, NPOSTFIX)[dcode]
+ distance = OFFSET(NDIRECT, NPOSTFIX)[dcode] + extra << NPOSTFIX
+
+ NDISTBITS and OFFSET could be pre-calculated, as NDIRECT and NPOSTFIX could
+ change only once per meta-block.
+*/
+
+/* Calculates distance lookup table.
+ NB: it is possible to have all 64 tables precalculated. */
+static void CalculateDistanceLut(BrotliDecoderState* s) {
+ BrotliMetablockBodyArena* b = &s->arena.body;
+ uint32_t npostfix = s->distance_postfix_bits;
+ uint32_t ndirect = s->num_direct_distance_codes;
+ uint32_t alphabet_size_limit = s->distance_hgroup.alphabet_size_limit;
+ uint32_t postfix = 1u << npostfix;
+ uint32_t j;
+ uint32_t bits = 1;
+ uint32_t half = 0;
+
+ /* Skip short codes. */
+ uint32_t i = BROTLI_NUM_DISTANCE_SHORT_CODES;
+
+ /* Fill direct codes. */
+ for (j = 0; j < ndirect; ++j) {
+ b->dist_extra_bits[i] = 0;
+ b->dist_offset[i] = j + 1;
+ ++i;
+ }
+
+ /* Fill regular distance codes. */
+ while (i < alphabet_size_limit) {
+ uint32_t base = ndirect + ((((2 + half) << bits) - 4) << npostfix) + 1;
+ /* Always fill the complete group. */
+ for (j = 0; j < postfix; ++j) {
+ b->dist_extra_bits[i] = (uint8_t)bits;
+ b->dist_offset[i] = base + j;
+ ++i;
+ }
+ bits = bits + half;
+ half = half ^ 1;
+ }
+}
+
/* Precondition: s->distance_code < 0. */
static BROTLI_INLINE BROTLI_BOOL ReadDistanceInternal(
int safe, BrotliDecoderState* s, BrotliBitReader* br) {
- int distval;
+ BrotliMetablockBodyArena* b = &s->arena.body;
+ uint32_t code;
+ uint32_t bits;
BrotliBitReaderState memento;
HuffmanCode* distance_tree = s->distance_hgroup.htrees[s->dist_htree_index];
if (!safe) {
- s->distance_code = (int)ReadSymbol(distance_tree, br);
+ code = ReadSymbol(distance_tree, br);
} else {
- uint32_t code;
BrotliBitReaderSaveState(br, &memento);
if (!SafeReadSymbol(distance_tree, br, &code)) {
return BROTLI_FALSE;
}
- s->distance_code = (int)code;
}
+ --s->block_length[2];
/* Convert the distance code to the actual distance by possibly
- looking up past distances from the s->ringbuffer. */
+ looking up past distances from the s->dist_rb. */
s->distance_context = 0;
- if ((s->distance_code & ~0xF) == 0) {
+ if ((code & ~0xFu) == 0) {
+ s->distance_code = (int)code;
TakeDistanceFromRingBuffer(s);
- --s->block_length[2];
return BROTLI_TRUE;
}
- distval = s->distance_code - (int)s->num_direct_distance_codes;
- if (distval >= 0) {
- uint32_t nbits;
- int postfix;
- int offset;
- if (!safe && (s->distance_postfix_bits == 0)) {
- nbits = ((uint32_t)distval >> 1) + 1;
- offset = ((2 + (distval & 1)) << nbits) - 4;
- s->distance_code = (int)s->num_direct_distance_codes + offset +
- (int)BrotliReadBits(br, nbits);
- } else {
- /* This branch also works well when s->distance_postfix_bits == 0. */
- uint32_t bits;
- postfix = distval & s->distance_postfix_mask;
- distval >>= s->distance_postfix_bits;
- nbits = ((uint32_t)distval >> 1) + 1;
- if (safe) {
- if (!SafeReadBits(br, nbits, &bits)) {
- s->distance_code = -1; /* Restore precondition. */
- BrotliBitReaderRestoreState(br, &memento);
- return BROTLI_FALSE;
- }
- } else {
- bits = BrotliReadBits(br, nbits);
- }
- offset = ((2 + (distval & 1)) << nbits) - 4;
- s->distance_code = (int)s->num_direct_distance_codes +
- ((offset + (int)bits) << s->distance_postfix_bits) + postfix;
+ if (!safe) {
+ bits = BrotliReadBits32(br, b->dist_extra_bits[code]);
+ } else {
+ if (!SafeReadBits32(br, b->dist_extra_bits[code], &bits)) {
+ ++s->block_length[2];
+ BrotliBitReaderRestoreState(br, &memento);
+ return BROTLI_FALSE;
}
}
- s->distance_code = s->distance_code - BROTLI_NUM_DISTANCE_SHORT_CODES + 1;
- --s->block_length[2];
+ s->distance_code =
+ (int)(b->dist_offset[code] + (bits << s->distance_postfix_bits));
return BROTLI_TRUE;
}
@@ -1588,9 +1685,9 @@ static BROTLI_INLINE BROTLI_BOOL ReadCommandInternal(
*insert_length = v.insert_len_offset;
if (!safe) {
if (BROTLI_PREDICT_FALSE(v.insert_len_extra_bits != 0)) {
- insert_len_extra = BrotliReadBits(br, v.insert_len_extra_bits);
+ insert_len_extra = BrotliReadBits24(br, v.insert_len_extra_bits);
}
- copy_length = BrotliReadBits(br, v.copy_len_extra_bits);
+ copy_length = BrotliReadBits24(br, v.copy_len_extra_bits);
} else {
if (!SafeReadBits(br, v.insert_len_extra_bits, &insert_len_extra) ||
!SafeReadBits(br, v.copy_len_extra_bits, &copy_length)) {
@@ -1935,21 +2032,6 @@ static BROTLI_NOINLINE BrotliDecoderErrorCode SafeProcessCommands(
return ProcessCommandsInternal(1, s);
}
-/* Returns the maximum number of distance symbols which can only represent
- distances not exceeding BROTLI_MAX_ALLOWED_DISTANCE. */
-static uint32_t BrotliMaxDistanceSymbol(uint32_t ndirect, uint32_t npostfix) {
- static const uint32_t bound[BROTLI_MAX_NPOSTFIX + 1] = {0, 4, 12, 28};
- static const uint32_t diff[BROTLI_MAX_NPOSTFIX + 1] = {73, 126, 228, 424};
- uint32_t postfix = 1U << npostfix;
- if (ndirect < bound[npostfix]) {
- return ndirect + diff[npostfix] + postfix;
- } else if (ndirect > bound[npostfix] + postfix) {
- return ndirect + diff[npostfix];
- } else {
- return bound[npostfix] + diff[npostfix] + postfix;
- }
-}
-
BrotliDecoderResult BrotliDecoderDecompress(
size_t encoded_size, const uint8_t* encoded_buffer, size_t* decoded_size,
uint8_t* decoded_buffer) {
@@ -2167,33 +2249,23 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
s->state = BROTLI_STATE_UNCOMPRESSED;
break;
}
+ s->state = BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_HEADER;
+ /* Fall through. */
+
+ case BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_HEADER: {
+ BrotliMetablockHeaderArena* h = &s->arena.header;
s->loop_counter = 0;
+ /* Initialize compressed metablock header arena. */
+ h->sub_loop_counter = 0;
+ /* Make small negative indexes addressable. */
+ h->symbol_lists =
+ &h->symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1];
+ h->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+ h->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
+ h->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
s->state = BROTLI_STATE_HUFFMAN_CODE_0;
- break;
-
- case BROTLI_STATE_UNCOMPRESSED: {
- result = CopyUncompressedBlockToOutput(
- available_out, next_out, total_out, s);
- if (result != BROTLI_DECODER_SUCCESS) {
- break;
- }
- s->state = BROTLI_STATE_METABLOCK_DONE;
- break;
}
-
- case BROTLI_STATE_METADATA:
- for (; s->meta_block_remaining_len > 0; --s->meta_block_remaining_len) {
- uint32_t bits;
- /* Read one byte and ignore it. */
- if (!BrotliSafeReadBits(br, 8, &bits)) {
- result = BROTLI_DECODER_NEEDS_MORE_INPUT;
- break;
- }
- }
- if (result == BROTLI_DECODER_SUCCESS) {
- s->state = BROTLI_STATE_METABLOCK_DONE;
- }
- break;
+ /* Fall through. */
case BROTLI_STATE_HUFFMAN_CODE_0:
if (s->loop_counter >= 3) {
@@ -2247,6 +2319,30 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
break;
}
+ case BROTLI_STATE_UNCOMPRESSED: {
+ result = CopyUncompressedBlockToOutput(
+ available_out, next_out, total_out, s);
+ if (result != BROTLI_DECODER_SUCCESS) {
+ break;
+ }
+ s->state = BROTLI_STATE_METABLOCK_DONE;
+ break;
+ }
+
+ case BROTLI_STATE_METADATA:
+ for (; s->meta_block_remaining_len > 0; --s->meta_block_remaining_len) {
+ uint32_t bits;
+ /* Read one byte and ignore it. */
+ if (!BrotliSafeReadBits(br, 8, &bits)) {
+ result = BROTLI_DECODER_NEEDS_MORE_INPUT;
+ break;
+ }
+ }
+ if (result == BROTLI_DECODER_SUCCESS) {
+ s->state = BROTLI_STATE_METABLOCK_DONE;
+ }
+ break;
+
case BROTLI_STATE_METABLOCK_HEADER_2: {
uint32_t bits;
if (!BrotliSafeReadBits(br, 6, &bits)) {
@@ -2255,11 +2351,9 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
}
s->distance_postfix_bits = bits & BitMask(2);
bits >>= 2;
- s->num_direct_distance_codes = BROTLI_NUM_DISTANCE_SHORT_CODES +
- (bits << s->distance_postfix_bits);
+ s->num_direct_distance_codes = bits << s->distance_postfix_bits;
BROTLI_LOG_UINT(s->num_direct_distance_codes);
BROTLI_LOG_UINT(s->distance_postfix_bits);
- s->distance_postfix_mask = (int)BitMask(s->distance_postfix_bits);
s->context_modes =
(uint8_t*)BROTLI_DECODER_ALLOC(s, (size_t)s->num_block_types[0]);
if (s->context_modes == 0) {
@@ -2291,17 +2385,19 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
/* Fall through. */
case BROTLI_STATE_CONTEXT_MAP_2: {
- uint32_t num_direct_codes =
- s->num_direct_distance_codes - BROTLI_NUM_DISTANCE_SHORT_CODES;
- uint32_t num_distance_codes = BROTLI_DISTANCE_ALPHABET_SIZE(
- s->distance_postfix_bits, num_direct_codes,
- (s->large_window ? BROTLI_LARGE_MAX_DISTANCE_BITS :
- BROTLI_MAX_DISTANCE_BITS));
- uint32_t max_distance_symbol = (s->large_window ?
- BrotliMaxDistanceSymbol(
- num_direct_codes, s->distance_postfix_bits) :
- num_distance_codes);
+ uint32_t npostfix = s->distance_postfix_bits;
+ uint32_t ndirect = s->num_direct_distance_codes;
+ uint32_t distance_alphabet_size_max = BROTLI_DISTANCE_ALPHABET_SIZE(
+ npostfix, ndirect, BROTLI_MAX_DISTANCE_BITS);
+ uint32_t distance_alphabet_size_limit = distance_alphabet_size_max;
BROTLI_BOOL allocation_success = BROTLI_TRUE;
+ if (s->large_window) {
+ BrotliDistanceCodeLimit limit = BrotliCalculateDistanceCodeLimit(
+ BROTLI_MAX_ALLOWED_DISTANCE, npostfix, ndirect);
+ distance_alphabet_size_max = BROTLI_DISTANCE_ALPHABET_SIZE(
+ npostfix, ndirect, BROTLI_LARGE_MAX_DISTANCE_BITS);
+ distance_alphabet_size_limit = limit.max_alphabet_size;
+ }
result = DecodeContextMap(
s->num_block_types[2] << BROTLI_DISTANCE_CONTEXT_BITS,
&s->num_dist_htrees, &s->dist_context_map, s);
@@ -2315,8 +2411,8 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
s, &s->insert_copy_hgroup, BROTLI_NUM_COMMAND_SYMBOLS,
BROTLI_NUM_COMMAND_SYMBOLS, s->num_block_types[1]);
allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
- s, &s->distance_hgroup, num_distance_codes,
- max_distance_symbol, s->num_dist_htrees);
+ s, &s->distance_hgroup, distance_alphabet_size_max,
+ distance_alphabet_size_limit, s->num_dist_htrees);
if (!allocation_success) {
return SaveErrorCode(s,
BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_TREE_GROUPS));
@@ -2338,18 +2434,24 @@ BrotliDecoderResult BrotliDecoderDecompressStream(
result = HuffmanTreeGroupDecode(hgroup, s);
if (result != BROTLI_DECODER_SUCCESS) break;
s->loop_counter++;
- if (s->loop_counter >= 3) {
- PrepareLiteralDecoding(s);
- s->dist_context_map_slice = s->dist_context_map;
- s->htree_command = s->insert_copy_hgroup.htrees[0];
- if (!BrotliEnsureRingBuffer(s)) {
- result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_2);
- break;
- }
- s->state = BROTLI_STATE_COMMAND_BEGIN;
+ if (s->loop_counter < 3) {
+ break;
}
- break;
+ s->state = BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_BODY;
}
+ /* Fall through. */
+
+ case BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_BODY:
+ PrepareLiteralDecoding(s);
+ s->dist_context_map_slice = s->dist_context_map;
+ s->htree_command = s->insert_copy_hgroup.htrees[0];
+ if (!BrotliEnsureRingBuffer(s)) {
+ result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_2);
+ break;
+ }
+ CalculateDistanceLut(s);
+ s->state = BROTLI_STATE_COMMAND_BEGIN;
+ /* Fall through. */
case BROTLI_STATE_COMMAND_BEGIN:
/* Fall through. */
diff --git a/c/dec/huffman.h b/c/dec/huffman.h
index b9f0716..a8fbc45 100644
--- a/c/dec/huffman.h
+++ b/c/dec/huffman.h
@@ -18,12 +18,6 @@ extern "C" {
#define BROTLI_HUFFMAN_MAX_CODE_LENGTH 15
-/* Maximum possible Huffman table size for an alphabet size of (index * 32),
- max code length 15 and root table bits 8. */
-static const uint16_t kMaxHuffmanTableSize[] = {
- 256, 402, 436, 468, 500, 534, 566, 598, 630, 662, 694, 726, 758, 790, 822,
- 854, 886, 920, 952, 984, 1016, 1048, 1080, 1112, 1144, 1176, 1208, 1240, 1272,
- 1304, 1336, 1368, 1400, 1432, 1464, 1496, 1528};
/* BROTLI_NUM_BLOCK_LEN_SYMBOLS == 26 */
#define BROTLI_HUFFMAN_MAX_SIZE_26 396
/* BROTLI_MAX_BLOCK_TYPE_SYMBOLS == 258 */
@@ -82,7 +76,7 @@ typedef BROTLI_ALIGNED(4) uint32_t HuffmanCode;
static BROTLI_INLINE HuffmanCode ConstructHuffmanCode(const uint8_t bits,
const uint16_t value) {
- return ((value & 0xFFFF) << 16) | (bits & 0xFF);
+ return (HuffmanCode) ((value & 0xFFFF) << 16) | (bits & 0xFF);
}
#define BROTLI_HC_MARK_TABLE_FOR_FAST_LOAD(H) uint32_t __fastload_##H = (*H)
@@ -100,7 +94,7 @@ BROTLI_INTERNAL void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* root_table,
/* Builds Huffman lookup table assuming code lengths are in symbol order.
Returns size of resulting table. */
BROTLI_INTERNAL uint32_t BrotliBuildHuffmanTable(HuffmanCode* root_table,
- int root_bits, const uint16_t* const symbol_lists, uint16_t* count_arg);
+ int root_bits, const uint16_t* const symbol_lists, uint16_t* count);
/* Builds a simple Huffman table. The |num_symbols| parameter is to be
interpreted as follows: 0 means 1 symbol, 1 means 2 symbols,
@@ -110,13 +104,13 @@ BROTLI_INTERNAL uint32_t BrotliBuildSimpleHuffmanTable(HuffmanCode* table,
int root_bits, uint16_t* symbols, uint32_t num_symbols);
/* Contains a collection of Huffman trees with the same alphabet size. */
-/* max_symbol is needed due to simple codes since log2(alphabet_size) could be
- greater than log2(max_symbol). */
+/* alphabet_size_limit is needed due to simple codes, since
+ log2(alphabet_size_max) could be greater than log2(alphabet_size_limit). */
typedef struct {
HuffmanCode** htrees;
HuffmanCode* codes;
- uint16_t alphabet_size;
- uint16_t max_symbol;
+ uint16_t alphabet_size_max;
+ uint16_t alphabet_size_limit;
uint16_t num_htrees;
} HuffmanTreeGroup;
diff --git a/c/dec/prefix.h b/c/dec/prefix.h
index 3ea062d..481a2c7 100644
--- a/c/dec/prefix.h
+++ b/c/dec/prefix.h
@@ -13,24 +13,6 @@
#include "../common/constants.h"
#include <brotli/types.h>
-/* Represents the range of values belonging to a prefix code:
- [offset, offset + 2^nbits) */
-struct PrefixCodeRange {
- uint16_t offset;
- uint8_t nbits;
-};
-
-static const struct PrefixCodeRange
- kBlockLengthPrefixCode[BROTLI_NUM_BLOCK_LEN_SYMBOLS] = {
- { 1, 2}, { 5, 2}, { 9, 2}, { 13, 2},
- { 17, 3}, { 25, 3}, { 33, 3}, { 41, 3},
- { 49, 4}, { 65, 4}, { 81, 4}, { 97, 4},
- { 113, 5}, { 145, 5}, { 177, 5}, { 209, 5},
- { 241, 6}, { 305, 6}, { 369, 7}, { 497, 8},
- { 753, 9}, { 1265, 10}, {2289, 11}, {4337, 12},
- {8433, 13}, {16625, 24}
-};
-
typedef struct CmdLutElement {
uint8_t insert_len_extra_bits;
uint8_t copy_len_extra_bits;
diff --git a/c/dec/state.c b/c/dec/state.c
index e0b37c2..f847836 100644
--- a/c/dec/state.c
+++ b/c/dec/state.c
@@ -33,10 +33,7 @@ BROTLI_BOOL BrotliDecoderStateInit(BrotliDecoderState* s,
s->state = BROTLI_STATE_UNINITED;
s->large_window = 0;
s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
- s->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
- s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
s->substate_uncompressed = BROTLI_STATE_UNCOMPRESSED_NONE;
- s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
@@ -59,8 +56,6 @@ BROTLI_BOOL BrotliDecoderStateInit(BrotliDecoderState* s,
s->context_map_slice = NULL;
s->dist_context_map_slice = NULL;
- s->sub_loop_counter = 0;
-
s->literal_hgroup.codes = NULL;
s->literal_hgroup.htrees = NULL;
s->insert_copy_hgroup.codes = NULL;
@@ -84,9 +79,6 @@ BROTLI_BOOL BrotliDecoderStateInit(BrotliDecoderState* s,
s->block_type_trees = NULL;
s->block_len_trees = NULL;
- /* Make small negative indexes addressable. */
- s->symbol_lists = &s->symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1];
-
s->mtf_upper_bound = 63;
s->dictionary = BrotliGetDictionary();
@@ -142,17 +134,20 @@ void BrotliDecoderStateCleanup(BrotliDecoderState* s) {
}
BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(BrotliDecoderState* s,
- HuffmanTreeGroup* group, uint32_t alphabet_size, uint32_t max_symbol,
- uint32_t ntrees) {
- /* Pack two allocations into one */
- const size_t max_table_size = kMaxHuffmanTableSize[(alphabet_size + 31) >> 5];
+ HuffmanTreeGroup* group, uint32_t alphabet_size_max,
+ uint32_t alphabet_size_limit, uint32_t ntrees) {
+ /* 376 = 256 (1-st level table) + 4 + 7 + 15 + 31 + 63 (2-nd level mix-tables)
+ This number is discovered "unlimited" "enough" calculator; it is actually
+ a wee bigger than required in several cases (especially for alphabets with
+ less than 16 symbols). */
+ const size_t max_table_size = alphabet_size_limit + 376;
const size_t code_size = sizeof(HuffmanCode) * ntrees * max_table_size;
const size_t htree_size = sizeof(HuffmanCode*) * ntrees;
/* Pointer alignment is, hopefully, wider than sizeof(HuffmanCode). */
HuffmanCode** p = (HuffmanCode**)BROTLI_DECODER_ALLOC(s,
code_size + htree_size);
- group->alphabet_size = (uint16_t)alphabet_size;
- group->max_symbol = (uint16_t)max_symbol;
+ group->alphabet_size_max = (uint16_t)alphabet_size_max;
+ group->alphabet_size_limit = (uint16_t)alphabet_size_limit;
group->num_htrees = (uint16_t)ntrees;
group->htrees = p;
group->codes = (HuffmanCode*)(&p[ntrees]);
diff --git a/c/dec/state.h b/c/dec/state.h
index d28b639..54dab69 100644
--- a/c/dec/state.h
+++ b/c/dec/state.h
@@ -21,6 +21,95 @@
extern "C" {
#endif
+/* Graphviz diagram that describes state transitions:
+
+digraph States {
+ graph [compound=true]
+ concentrate=true
+ node [shape="box"]
+
+ UNINITED -> {LARGE_WINDOW_BITS -> INITIALIZE}
+ subgraph cluster_metablock_workflow {
+ style="rounded"
+ label=< <B>METABLOCK CYCLE</B> >
+ METABLOCK_BEGIN -> METABLOCK_HEADER
+ METABLOCK_HEADER:sw -> METADATA
+ METABLOCK_HEADER:s -> UNCOMPRESSED
+ METABLOCK_HEADER:se -> METABLOCK_DONE:ne
+ METADATA:s -> METABLOCK_DONE:w
+ UNCOMPRESSED:s -> METABLOCK_DONE:n
+ METABLOCK_DONE:e -> METABLOCK_BEGIN:e [constraint="false"]
+ }
+ INITIALIZE -> METABLOCK_BEGIN
+ METABLOCK_DONE -> DONE
+
+ subgraph cluster_compressed_metablock {
+ style="rounded"
+ label=< <B>COMPRESSED METABLOCK</B> >
+
+ subgraph cluster_command {
+ style="rounded"
+ label=< <B>HOT LOOP</B> >
+
+ _METABLOCK_DONE_PORT_ [shape=point style=invis]
+
+ {
+ // Set different shape for nodes returning from "compressed metablock".
+ node [shape=invhouse]; CMD_INNER CMD_POST_DECODE_LITERALS;
+ CMD_POST_WRAP_COPY; CMD_INNER_WRITE; CMD_POST_WRITE_1;
+ }
+
+ CMD_BEGIN -> CMD_INNER -> CMD_POST_DECODE_LITERALS -> CMD_POST_WRAP_COPY
+
+ // IO ("write") nodes are not in the hot loop!
+ CMD_INNER_WRITE [style=dashed]
+ CMD_INNER -> CMD_INNER_WRITE
+ CMD_POST_WRITE_1 [style=dashed]
+ CMD_POST_DECODE_LITERALS -> CMD_POST_WRITE_1
+ CMD_POST_WRITE_2 [style=dashed]
+ CMD_POST_WRAP_COPY -> CMD_POST_WRITE_2
+
+ CMD_POST_WRITE_1 -> CMD_BEGIN:s [constraint="false"]
+ CMD_INNER_WRITE -> {CMD_INNER CMD_POST_DECODE_LITERALS}
+ [constraint="false"]
+ CMD_BEGIN:ne -> CMD_POST_DECODE_LITERALS [constraint="false"]
+ CMD_POST_WRAP_COPY -> CMD_BEGIN [constraint="false"]
+ CMD_POST_DECODE_LITERALS -> CMD_BEGIN:ne [constraint="false"]
+ CMD_POST_WRITE_2 -> CMD_POST_WRAP_COPY [constraint="false"]
+ {rank=same; CMD_BEGIN; CMD_INNER; CMD_POST_DECODE_LITERALS;
+ CMD_POST_WRAP_COPY}
+ {rank=same; CMD_INNER_WRITE; CMD_POST_WRITE_1; CMD_POST_WRITE_2}
+
+ {CMD_INNER CMD_POST_DECODE_LITERALS CMD_POST_WRAP_COPY} ->
+ _METABLOCK_DONE_PORT_ [style=invis]
+ {CMD_INNER_WRITE CMD_POST_WRITE_1} -> _METABLOCK_DONE_PORT_
+ [constraint="false" style=invis]
+ }
+
+ BEFORE_COMPRESSED_METABLOCK_HEADER:s -> HUFFMAN_CODE_0:n
+ HUFFMAN_CODE_0 -> HUFFMAN_CODE_1 -> HUFFMAN_CODE_2 -> HUFFMAN_CODE_3
+ HUFFMAN_CODE_0 -> METABLOCK_HEADER_2 -> CONTEXT_MODES -> CONTEXT_MAP_1
+ CONTEXT_MAP_1 -> CONTEXT_MAP_2 -> TREE_GROUP
+ TREE_GROUP -> BEFORE_COMPRESSED_METABLOCK_BODY:e
+ BEFORE_COMPRESSED_METABLOCK_BODY:s -> CMD_BEGIN:n
+
+ HUFFMAN_CODE_3:e -> HUFFMAN_CODE_0:ne [constraint="false"]
+ {rank=same; HUFFMAN_CODE_0; HUFFMAN_CODE_1; HUFFMAN_CODE_2; HUFFMAN_CODE_3}
+ {rank=same; METABLOCK_HEADER_2; CONTEXT_MODES; CONTEXT_MAP_1; CONTEXT_MAP_2;
+ TREE_GROUP}
+ }
+ METABLOCK_HEADER:e -> BEFORE_COMPRESSED_METABLOCK_HEADER:n
+
+ _METABLOCK_DONE_PORT_ -> METABLOCK_DONE:se
+ [constraint="false" ltail=cluster_command]
+
+ UNINITED [shape=Mdiamond];
+ DONE [shape=Msquare];
+}
+
+
+ */
+
typedef enum {
BROTLI_STATE_UNINITED,
BROTLI_STATE_LARGE_WINDOW_BITS,
@@ -39,6 +128,7 @@ typedef enum {
BROTLI_STATE_METABLOCK_DONE,
BROTLI_STATE_COMMAND_POST_WRITE_1,
BROTLI_STATE_COMMAND_POST_WRITE_2,
+ BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_HEADER,
BROTLI_STATE_HUFFMAN_CODE_0,
BROTLI_STATE_HUFFMAN_CODE_1,
BROTLI_STATE_HUFFMAN_CODE_2,
@@ -46,6 +136,7 @@ typedef enum {
BROTLI_STATE_CONTEXT_MAP_1,
BROTLI_STATE_CONTEXT_MAP_2,
BROTLI_STATE_TREE_GROUP,
+ BROTLI_STATE_BEFORE_COMPRESSED_METABLOCK_BODY,
BROTLI_STATE_DONE
} BrotliRunningState;
@@ -98,6 +189,50 @@ typedef enum {
BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX
} BrotliRunningReadBlockLengthState;
+typedef struct BrotliMetablockHeaderArena {
+ BrotliRunningTreeGroupState substate_tree_group;
+ BrotliRunningContextMapState substate_context_map;
+ BrotliRunningHuffmanState substate_huffman;
+
+ uint32_t sub_loop_counter;
+
+ uint32_t repeat_code_len;
+ uint32_t prev_code_len;
+
+ /* For ReadHuffmanCode. */
+ uint32_t symbol;
+ uint32_t repeat;
+ uint32_t space;
+
+ /* Huffman table for "histograms". */
+ HuffmanCode table[32];
+ /* List of heads of symbol chains. */
+ uint16_t* symbol_lists;
+ /* Storage from symbol_lists. */
+ uint16_t symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1 +
+ BROTLI_NUM_COMMAND_SYMBOLS];
+ /* Tails of symbol chains. */
+ int next_symbol[32];
+ uint8_t code_length_code_lengths[BROTLI_CODE_LENGTH_CODES];
+ /* Population counts for the code lengths. */
+ uint16_t code_length_histo[16];
+
+ /* For HuffmanTreeGroupDecode. */
+ int htree_index;
+ HuffmanCode* next;
+
+ /* For DecodeContextMap. */
+ uint32_t context_index;
+ uint32_t max_run_length_prefix;
+ uint32_t code;
+ HuffmanCode context_map_table[BROTLI_HUFFMAN_MAX_SIZE_272];
+} BrotliMetablockHeaderArena;
+
+typedef struct BrotliMetablockBodyArena {
+ uint8_t dist_extra_bits[544];
+ uint32_t dist_offset[544];
+} BrotliMetablockBodyArena;
+
struct BrotliDecoderStateStruct {
BrotliRunningState state;
@@ -110,7 +245,8 @@ struct BrotliDecoderStateStruct {
brotli_free_func free_func;
void* memory_manager_opaque;
- /* Temporary storage for remaining input. */
+ /* Temporary storage for remaining input. Brotli stream format is designed in
+ a way, that 64 bits are enough to make progress in decoding. */
union {
uint64_t u64;
uint8_t u8[8];
@@ -125,7 +261,6 @@ struct BrotliDecoderStateStruct {
int dist_rb_idx;
int dist_rb[4];
int error_code;
- uint32_t sub_loop_counter;
uint8_t* ringbuffer;
uint8_t* ringbuffer_end;
HuffmanCode* htree_command;
@@ -153,13 +288,10 @@ struct BrotliDecoderStateStruct {
uint32_t block_type_rb[6];
uint32_t distance_postfix_bits;
uint32_t num_direct_distance_codes;
- int distance_postfix_mask;
uint32_t num_dist_htrees;
uint8_t* dist_context_map;
HuffmanCode* literal_htree;
uint8_t dist_htree_index;
- uint32_t repeat_code_len;
- uint32_t prev_code_len;
int copy_length;
int distance_code;
@@ -168,33 +300,6 @@ struct BrotliDecoderStateStruct {
size_t rb_roundtrips; /* how many times we went around the ring-buffer */
size_t partial_pos_out; /* how much output to the user in total */
- /* For ReadHuffmanCode. */
- uint32_t symbol;
- uint32_t repeat;
- uint32_t space;
-
- HuffmanCode table[32];
- /* List of heads of symbol chains. */
- uint16_t* symbol_lists;
- /* Storage from symbol_lists. */
- uint16_t symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1 +
- BROTLI_NUM_COMMAND_SYMBOLS];
- /* Tails of symbol chains. */
- int next_symbol[32];
- uint8_t code_length_code_lengths[BROTLI_CODE_LENGTH_CODES];
- /* Population counts for the code lengths. */
- uint16_t code_length_histo[16];
-
- /* For HuffmanTreeGroupDecode. */
- int htree_index;
- HuffmanCode* next;
-
- /* For DecodeContextMap. */
- uint32_t context_index;
- uint32_t max_run_length_prefix;
- uint32_t code;
- HuffmanCode context_map_table[BROTLI_HUFFMAN_MAX_SIZE_272];
-
/* For InverseMoveToFrontTransform. */
uint32_t mtf_upper_bound;
uint32_t mtf[64 + 1];
@@ -203,10 +308,7 @@ struct BrotliDecoderStateStruct {
/* States inside function calls. */
BrotliRunningMetablockHeaderState substate_metablock_header;
- BrotliRunningTreeGroupState substate_tree_group;
- BrotliRunningContextMapState substate_context_map;
BrotliRunningUncompressedState substate_uncompressed;
- BrotliRunningHuffmanState substate_huffman;
BrotliRunningDecodeUint8State substate_decode_uint8;
BrotliRunningReadBlockLengthState substate_read_block_length;
@@ -229,6 +331,11 @@ struct BrotliDecoderStateStruct {
const BrotliTransforms* transforms;
uint32_t trivial_literal_contexts[8]; /* 256 bits */
+
+ union {
+ BrotliMetablockHeaderArena header;
+ BrotliMetablockBodyArena body;
+ } arena;
};
typedef struct BrotliDecoderStateStruct BrotliDecoderStateInternal;
@@ -241,8 +348,8 @@ BROTLI_INTERNAL void BrotliDecoderStateMetablockBegin(BrotliDecoderState* s);
BROTLI_INTERNAL void BrotliDecoderStateCleanupAfterMetablock(
BrotliDecoderState* s);
BROTLI_INTERNAL BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(
- BrotliDecoderState* s, HuffmanTreeGroup* group, uint32_t alphabet_size,
- uint32_t max_symbol, uint32_t ntrees);
+ BrotliDecoderState* s, HuffmanTreeGroup* group, uint32_t alphabet_size_max,
+ uint32_t alphabet_size_limit, uint32_t ntrees);
#define BROTLI_DECODER_ALLOC(S, L) S->alloc_func(S->memory_manager_opaque, L)
diff --git a/c/enc/backward_references.c b/c/enc/backward_references.c
index cd023d9..a07a617 100644
--- a/c/enc/backward_references.c
+++ b/c/enc/backward_references.c
@@ -9,6 +9,7 @@
#include "./backward_references.h"
#include "../common/constants.h"
+#include "../common/context.h"
#include "../common/dictionary.h"
#include "../common/platform.h"
#include <brotli/types.h>
@@ -119,17 +120,17 @@ static BROTLI_INLINE size_t ComputeDistanceCode(size_t distance,
#undef CAT
#undef EXPAND_CAT
-void BrotliCreateBackwardReferences(
- size_t num_bytes, size_t position, const uint8_t* ringbuffer,
- size_t ringbuffer_mask, const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+void BrotliCreateBackwardReferences(size_t num_bytes,
+ size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals) {
switch (params->hasher.type) {
#define CASE_(N) \
case N: \
- CreateBackwardReferencesNH ## N( \
- num_bytes, position, ringbuffer, \
- ringbuffer_mask, params, hasher, dist_cache, \
+ CreateBackwardReferencesNH ## N(num_bytes, \
+ position, ringbuffer, ringbuffer_mask, \
+ literal_context_lut, params, hasher, dist_cache, \
last_insert_len, commands, num_commands, num_literals); \
return;
FOR_GENERIC_HASHERS(CASE_)
diff --git a/c/enc/backward_references.h b/c/enc/backward_references.h
index 3a41466..9589cc1 100644
--- a/c/enc/backward_references.h
+++ b/c/enc/backward_references.h
@@ -10,6 +10,7 @@
#define BROTLI_ENC_BACKWARD_REFERENCES_H_
#include "../common/constants.h"
+#include "../common/context.h"
#include "../common/dictionary.h"
#include "../common/platform.h"
#include <brotli/types.h>
@@ -25,10 +26,10 @@ extern "C" {
initially the total amount of commands output by previous
CreateBackwardReferences calls, and must be incremented by the amount written
by this call. */
-BROTLI_INTERNAL void BrotliCreateBackwardReferences(
- size_t num_bytes, size_t position, const uint8_t* ringbuffer,
- size_t ringbuffer_mask, const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+BROTLI_INTERNAL void BrotliCreateBackwardReferences(size_t num_bytes,
+ size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals);
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/c/enc/backward_references_hq.c b/c/enc/backward_references_hq.c
index 96b0e70..5651cae 100644
--- a/c/enc/backward_references_hq.c
+++ b/c/enc/backward_references_hq.c
@@ -11,6 +11,7 @@
#include <string.h> /* memcpy, memset */
#include "../common/constants.h"
+#include "../common/context.h"
#include "../common/platform.h"
#include <brotli/types.h>
#include "./command.h"
@@ -26,6 +27,7 @@
extern "C" {
#endif
+/* BrotliCalculateDistanceCodeLimit(BROTLI_MAX_ALLOWED_DISTANCE, 3, 120). */
#define BROTLI_MAX_EFFECTIVE_DISTANCE_ALPHABET_SIZE 544
static const float kInfinity = 1.7e38f; /* ~= 2 ^ 127 */
@@ -86,14 +88,10 @@ typedef struct ZopfliCostModel {
static void InitZopfliCostModel(
MemoryManager* m, ZopfliCostModel* self, const BrotliDistanceParams* dist,
size_t num_bytes) {
- uint32_t distance_histogram_size = dist->alphabet_size;
- if (distance_histogram_size > BROTLI_MAX_EFFECTIVE_DISTANCE_ALPHABET_SIZE) {
- distance_histogram_size = BROTLI_MAX_EFFECTIVE_DISTANCE_ALPHABET_SIZE;
- }
self->num_bytes_ = num_bytes;
self->literal_costs_ = BROTLI_ALLOC(m, float, num_bytes + 2);
- self->cost_dist_ = BROTLI_ALLOC(m, float, dist->alphabet_size);
- self->distance_histogram_size = distance_histogram_size;
+ self->cost_dist_ = BROTLI_ALLOC(m, float, dist->alphabet_size_limit);
+ self->distance_histogram_size = dist->alphabet_size_limit;
if (BROTLI_IS_OOM(m)) return;
}
@@ -408,9 +406,12 @@ static size_t UpdateNodes(
const int* starting_dist_cache, const size_t num_matches,
const BackwardMatch* matches, const ZopfliCostModel* model,
StartPosQueue* queue, ZopfliNode* nodes) {
+ const size_t stream_offset = params->stream_offset;
const size_t cur_ix = block_start + pos;
const size_t cur_ix_masked = cur_ix & ringbuffer_mask;
const size_t max_distance = BROTLI_MIN(size_t, cur_ix, max_backward_limit);
+ const size_t dictionary_start = BROTLI_MIN(size_t,
+ cur_ix + stream_offset, max_backward_limit);
const size_t max_len = num_bytes - pos;
const size_t max_zopfli_len = MaxZopfliLen(params);
const size_t max_iters = MaxZopfliCandidates(params);
@@ -419,8 +420,8 @@ static size_t UpdateNodes(
size_t k;
size_t gap = 0;
- EvaluateNode(block_start, pos, max_backward_limit, gap, starting_dist_cache,
- model, queue, nodes);
+ EvaluateNode(block_start + stream_offset, pos, max_backward_limit, gap,
+ starting_dist_cache, model, queue, nodes);
{
const PosData* posdata = StartPosQueueAt(queue, 0);
@@ -453,7 +454,7 @@ static size_t UpdateNodes(
if (cur_ix_masked + best_len > ringbuffer_mask) {
break;
}
- if (BROTLI_PREDICT_FALSE(backward > max_distance + gap)) {
+ if (BROTLI_PREDICT_FALSE(backward > dictionary_start + gap)) {
/* Word dictionary -> ignore. */
continue;
}
@@ -472,6 +473,8 @@ static size_t UpdateNodes(
&ringbuffer[cur_ix_masked],
max_len);
} else {
+ /* "Gray" area. It is addressable by decoder, but this encoder
+ instance does not have that data -> should not touch it. */
continue;
}
{
@@ -506,7 +509,7 @@ static size_t UpdateNodes(
BackwardMatch match = matches[j];
size_t dist = match.distance;
BROTLI_BOOL is_dictionary_match =
- TO_BROTLI_BOOL(dist > max_distance + gap);
+ TO_BROTLI_BOOL(dist > dictionary_start + gap);
/* We already tried all possible last distance matches, so we can use
normal distance code here. */
size_t dist_code = dist + BROTLI_NUM_DISTANCE_SHORT_CODES - 1;
@@ -569,6 +572,7 @@ void BrotliZopfliCreateCommands(const size_t num_bytes,
const size_t block_start, const ZopfliNode* nodes, int* dist_cache,
size_t* last_insert_len, const BrotliEncoderParams* params,
Command* commands, size_t* num_literals) {
+ const size_t stream_offset = params->stream_offset;
const size_t max_backward_limit = BROTLI_MAX_BACKWARD_LIMIT(params->lgwin);
size_t pos = 0;
uint32_t offset = nodes[0].u.next;
@@ -587,9 +591,10 @@ void BrotliZopfliCreateCommands(const size_t num_bytes,
{
size_t distance = ZopfliNodeCopyDistance(next);
size_t len_code = ZopfliNodeLengthCode(next);
- size_t max_distance =
- BROTLI_MIN(size_t, block_start + pos, max_backward_limit);
- BROTLI_BOOL is_dictionary = TO_BROTLI_BOOL(distance > max_distance + gap);
+ size_t dictionary_start = BROTLI_MIN(size_t,
+ block_start + pos + stream_offset, max_backward_limit);
+ BROTLI_BOOL is_dictionary =
+ TO_BROTLI_BOOL(distance > dictionary_start + gap);
size_t dist_code = ZopfliNodeDistanceCode(next);
InitCommand(&commands[i], &params->dist, insert_length,
copy_length, (int)len_code - (int)copy_length, dist_code);
@@ -613,6 +618,7 @@ static size_t ZopfliIterate(size_t num_bytes, size_t position,
const BrotliEncoderParams* params, const size_t gap, const int* dist_cache,
const ZopfliCostModel* model, const uint32_t* num_matches,
const BackwardMatch* matches, ZopfliNode* nodes) {
+ const size_t stream_offset = params->stream_offset;
const size_t max_backward_limit = BROTLI_MAX_BACKWARD_LIMIT(params->lgwin);
const size_t max_zopfli_len = MaxZopfliLen(params);
StartPosQueue queue;
@@ -637,7 +643,7 @@ static size_t ZopfliIterate(size_t num_bytes, size_t position,
while (skip) {
i++;
if (i + 3 >= num_bytes) break;
- EvaluateNode(position, i, max_backward_limit, gap,
+ EvaluateNode(position + stream_offset, i, max_backward_limit, gap,
dist_cache, model, &queue, nodes);
cur_match_pos += num_matches[i];
skip--;
@@ -650,8 +656,9 @@ static size_t ZopfliIterate(size_t num_bytes, size_t position,
/* REQUIRES: nodes != NULL and len(nodes) >= num_bytes + 1 */
size_t BrotliZopfliComputeShortestPath(MemoryManager* m, size_t num_bytes,
size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
- const BrotliEncoderParams* params,
- const int* dist_cache, HasherHandle hasher, ZopfliNode* nodes) {
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ const int* dist_cache, Hasher* hasher, ZopfliNode* nodes) {
+ const size_t stream_offset = params->stream_offset;
const size_t max_backward_limit = BROTLI_MAX_BACKWARD_LIMIT(params->lgwin);
const size_t max_zopfli_len = MaxZopfliLen(params);
ZopfliCostModel model;
@@ -662,6 +669,7 @@ size_t BrotliZopfliComputeShortestPath(MemoryManager* m, size_t num_bytes,
size_t i;
size_t gap = 0;
size_t lz_matches_offset = 0;
+ BROTLI_UNUSED(literal_context_lut);
nodes[0].length = 0;
nodes[0].u.cost = 0;
InitZopfliCostModel(m, &model, &params->dist, num_bytes);
@@ -672,12 +680,14 @@ size_t BrotliZopfliComputeShortestPath(MemoryManager* m, size_t num_bytes,
for (i = 0; i + HashTypeLengthH10() - 1 < num_bytes; i++) {
const size_t pos = position + i;
const size_t max_distance = BROTLI_MIN(size_t, pos, max_backward_limit);
+ const size_t dictionary_start = BROTLI_MIN(size_t,
+ pos + stream_offset, max_backward_limit);
size_t skip;
size_t num_matches;
- num_matches = FindAllMatchesH10(hasher,
+ num_matches = FindAllMatchesH10(&hasher->privat._H10,
&params->dictionary,
ringbuffer, ringbuffer_mask, pos, num_bytes - i, max_distance,
- gap, params, &matches[lz_matches_offset]);
+ dictionary_start + gap, params, &matches[lz_matches_offset]);
if (num_matches > 0 &&
BackwardMatchLength(&matches[num_matches - 1]) > max_zopfli_len) {
matches[0] = matches[num_matches - 1];
@@ -692,13 +702,14 @@ size_t BrotliZopfliComputeShortestPath(MemoryManager* m, size_t num_bytes,
}
if (skip > 1) {
/* Add the tail of the copy to the hasher. */
- StoreRangeH10(hasher, ringbuffer, ringbuffer_mask, pos + 1, BROTLI_MIN(
+ StoreRangeH10(&hasher->privat._H10,
+ ringbuffer, ringbuffer_mask, pos + 1, BROTLI_MIN(
size_t, pos + skip, store_end));
skip--;
while (skip) {
i++;
if (i + HashTypeLengthH10() - 1 >= num_bytes) break;
- EvaluateNode(position, i, max_backward_limit, gap,
+ EvaluateNode(position + stream_offset, i, max_backward_limit, gap,
dist_cache, &model, &queue, nodes);
skip--;
}
@@ -710,15 +721,14 @@ size_t BrotliZopfliComputeShortestPath(MemoryManager* m, size_t num_bytes,
void BrotliCreateZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
- const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals) {
- ZopfliNode* nodes;
- nodes = BROTLI_ALLOC(m, ZopfliNode, num_bytes + 1);
- if (BROTLI_IS_OOM(m)) return;
+ ZopfliNode* nodes = BROTLI_ALLOC(m, ZopfliNode, num_bytes + 1);
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(nodes)) return;
BrotliInitZopfliNodes(nodes, num_bytes + 1);
*num_commands += BrotliZopfliComputeShortestPath(m, num_bytes,
- position, ringbuffer, ringbuffer_mask, params,
+ position, ringbuffer, ringbuffer_mask, literal_context_lut, params,
dist_cache, hasher, nodes);
if (BROTLI_IS_OOM(m)) return;
BrotliZopfliCreateCommands(num_bytes, position, nodes, dist_cache,
@@ -728,9 +738,10 @@ void BrotliCreateZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
- const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals) {
+ const size_t stream_offset = params->stream_offset;
const size_t max_backward_limit = BROTLI_MAX_BACKWARD_LIMIT(params->lgwin);
uint32_t* num_matches = BROTLI_ALLOC(m, uint32_t, num_bytes);
size_t matches_size = 4 * num_bytes;
@@ -747,10 +758,16 @@ void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
BackwardMatch* matches = BROTLI_ALLOC(m, BackwardMatch, matches_size);
size_t gap = 0;
size_t shadow_matches = 0;
- if (BROTLI_IS_OOM(m)) return;
+ BROTLI_UNUSED(literal_context_lut);
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(num_matches) ||
+ BROTLI_IS_NULL(matches)) {
+ return;
+ }
for (i = 0; i + HashTypeLengthH10() - 1 < num_bytes; ++i) {
const size_t pos = position + i;
size_t max_distance = BROTLI_MIN(size_t, pos, max_backward_limit);
+ size_t dictionary_start = BROTLI_MIN(size_t,
+ pos + stream_offset, max_backward_limit);
size_t max_length = num_bytes - i;
size_t num_found_matches;
size_t cur_match_end;
@@ -759,10 +776,10 @@ void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
BROTLI_ENSURE_CAPACITY(m, BackwardMatch, matches, matches_size,
cur_match_pos + MAX_NUM_MATCHES_H10 + shadow_matches);
if (BROTLI_IS_OOM(m)) return;
- num_found_matches = FindAllMatchesH10(hasher,
+ num_found_matches = FindAllMatchesH10(&hasher->privat._H10,
&params->dictionary,
ringbuffer, ringbuffer_mask, pos, max_length,
- max_distance, gap, params,
+ max_distance, dictionary_start + gap, params,
&matches[cur_match_pos + shadow_matches]);
cur_match_end = cur_match_pos + num_found_matches;
for (j = cur_match_pos; j + 1 < cur_match_end; ++j) {
@@ -777,7 +794,8 @@ void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
matches[cur_match_pos++] = matches[cur_match_end - 1];
num_matches[i] = 1;
/* Add the tail of the copy to the hasher. */
- StoreRangeH10(hasher, ringbuffer, ringbuffer_mask, pos + 1,
+ StoreRangeH10(&hasher->privat._H10,
+ ringbuffer, ringbuffer_mask, pos + 1,
BROTLI_MIN(size_t, pos + match_len, store_end));
memset(&num_matches[i + 1], 0, skip * sizeof(num_matches[0]));
i += skip;
@@ -791,7 +809,7 @@ void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m, size_t num_bytes,
memcpy(orig_dist_cache, dist_cache, 4 * sizeof(dist_cache[0]));
orig_num_commands = *num_commands;
nodes = BROTLI_ALLOC(m, ZopfliNode, num_bytes + 1);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(nodes)) return;
InitZopfliCostModel(m, &model, &params->dist, num_bytes);
if (BROTLI_IS_OOM(m)) return;
for (i = 0; i < 2; i++) {
diff --git a/c/enc/backward_references_hq.h b/c/enc/backward_references_hq.h
index 1e4275d..36b75f2 100644
--- a/c/enc/backward_references_hq.h
+++ b/c/enc/backward_references_hq.h
@@ -10,6 +10,7 @@
#define BROTLI_ENC_BACKWARD_REFERENCES_HQ_H_
#include "../common/constants.h"
+#include "../common/context.h"
#include "../common/dictionary.h"
#include "../common/platform.h"
#include <brotli/types.h>
@@ -23,15 +24,17 @@ extern "C" {
#endif
BROTLI_INTERNAL void BrotliCreateZopfliBackwardReferences(MemoryManager* m,
- size_t num_bytes, size_t position, const uint8_t* ringbuffer,
- size_t ringbuffer_mask, const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+ size_t num_bytes,
+ size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals);
BROTLI_INTERNAL void BrotliCreateHqZopfliBackwardReferences(MemoryManager* m,
- size_t num_bytes, size_t position, const uint8_t* ringbuffer,
- size_t ringbuffer_mask, const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+ size_t num_bytes,
+ size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals);
typedef struct ZopfliNode {
@@ -77,8 +80,8 @@ BROTLI_INTERNAL void BrotliInitZopfliNodes(ZopfliNode* array, size_t length);
BROTLI_INTERNAL size_t BrotliZopfliComputeShortestPath(
MemoryManager* m, size_t num_bytes,
size_t position, const uint8_t* ringbuffer, size_t ringbuffer_mask,
- const BrotliEncoderParams* params,
- const int* dist_cache, HasherHandle hasher, ZopfliNode* nodes);
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ const int* dist_cache, Hasher* hasher, ZopfliNode* nodes);
BROTLI_INTERNAL void BrotliZopfliCreateCommands(
const size_t num_bytes, const size_t block_start, const ZopfliNode* nodes,
diff --git a/c/enc/backward_references_inc.h b/c/enc/backward_references_inc.h
index c18cdb0..766bf91 100644
--- a/c/enc/backward_references_inc.h
+++ b/c/enc/backward_references_inc.h
@@ -10,11 +10,13 @@
static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
size_t num_bytes, size_t position,
const uint8_t* ringbuffer, size_t ringbuffer_mask,
- const BrotliEncoderParams* params,
- HasherHandle hasher, int* dist_cache, size_t* last_insert_len,
+ ContextLut literal_context_lut, const BrotliEncoderParams* params,
+ Hasher* hasher, int* dist_cache, size_t* last_insert_len,
Command* commands, size_t* num_commands, size_t* num_literals) {
+ HASHER()* privat = &hasher->privat.FN(_);
/* Set maximum distance, see section 9.1. of the spec. */
const size_t max_backward_limit = BROTLI_MAX_BACKWARD_LIMIT(params->lgwin);
+ const size_t position_offset = params->stream_offset;
const Command* const orig_commands = commands;
size_t insert_length = *last_insert_len;
@@ -31,19 +33,23 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
/* Minimum score to accept a backward reference. */
const score_t kMinScore = BROTLI_SCORE_BASE + 100;
- FN(PrepareDistanceCache)(hasher, dist_cache);
+ BROTLI_UNUSED(literal_context_lut);
+
+ FN(PrepareDistanceCache)(privat, dist_cache);
while (position + FN(HashTypeLength)() < pos_end) {
size_t max_length = pos_end - position;
size_t max_distance = BROTLI_MIN(size_t, position, max_backward_limit);
+ size_t dictionary_start = BROTLI_MIN(size_t,
+ position + position_offset, max_backward_limit);
HasherSearchResult sr;
sr.len = 0;
sr.len_code_delta = 0;
sr.distance = 0;
sr.score = kMinScore;
- FN(FindLongestMatch)(hasher, &params->dictionary,
+ FN(FindLongestMatch)(privat, &params->dictionary,
ringbuffer, ringbuffer_mask, dist_cache, position, max_length,
- max_distance, gap, params->dist.max_distance, &sr);
+ max_distance, dictionary_start + gap, params->dist.max_distance, &sr);
if (sr.score > kMinScore) {
/* Found a match. Let's look for something even better ahead. */
int delayed_backward_references_in_row = 0;
@@ -57,10 +63,13 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
sr2.distance = 0;
sr2.score = kMinScore;
max_distance = BROTLI_MIN(size_t, position + 1, max_backward_limit);
- FN(FindLongestMatch)(hasher,
+ dictionary_start = BROTLI_MIN(size_t,
+ position + 1 + position_offset, max_backward_limit);
+ FN(FindLongestMatch)(privat,
&params->dictionary,
ringbuffer, ringbuffer_mask, dist_cache, position + 1, max_length,
- max_distance, gap, params->dist.max_distance, &sr2);
+ max_distance, dictionary_start + gap, params->dist.max_distance,
+ &sr2);
if (sr2.score >= sr.score + cost_diff_lazy) {
/* Ok, let's just write one byte for now and start a match from the
next byte. */
@@ -76,18 +85,19 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
}
apply_random_heuristics =
position + 2 * sr.len + random_heuristics_window_size;
- max_distance = BROTLI_MIN(size_t, position, max_backward_limit);
+ dictionary_start = BROTLI_MIN(size_t,
+ position + position_offset, max_backward_limit);
{
/* The first 16 codes are special short-codes,
and the minimum offset is 1. */
size_t distance_code = ComputeDistanceCode(
- sr.distance, max_distance + gap, dist_cache);
- if ((sr.distance <= (max_distance + gap)) && distance_code > 0) {
+ sr.distance, dictionary_start + gap, dist_cache);
+ if ((sr.distance <= (dictionary_start + gap)) && distance_code > 0) {
dist_cache[3] = dist_cache[2];
dist_cache[2] = dist_cache[1];
dist_cache[1] = dist_cache[0];
dist_cache[0] = (int)sr.distance;
- FN(PrepareDistanceCache)(hasher, dist_cache);
+ FN(PrepareDistanceCache)(privat, dist_cache);
}
InitCommand(commands++, &params->dist, insert_length,
sr.len, sr.len_code_delta, distance_code);
@@ -105,7 +115,7 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
range_start = BROTLI_MIN(size_t, range_end, BROTLI_MAX(size_t,
range_start, position + sr.len - (sr.distance << 2)));
}
- FN(StoreRange)(hasher, ringbuffer, ringbuffer_mask, range_start,
+ FN(StoreRange)(privat, ringbuffer, ringbuffer_mask, range_start,
range_end);
}
position += sr.len;
@@ -131,7 +141,7 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
size_t pos_jump =
BROTLI_MIN(size_t, position + 16, pos_end - kMargin);
for (; position < pos_jump; position += 4) {
- FN(Store)(hasher, ringbuffer, ringbuffer_mask, position);
+ FN(Store)(privat, ringbuffer, ringbuffer_mask, position);
insert_length += 4;
}
} else {
@@ -140,7 +150,7 @@ static BROTLI_NOINLINE void EXPORT_FN(CreateBackwardReferences)(
size_t pos_jump =
BROTLI_MIN(size_t, position + 8, pos_end - kMargin);
for (; position < pos_jump; position += 2) {
- FN(Store)(hasher, ringbuffer, ringbuffer_mask, position);
+ FN(Store)(privat, ringbuffer, ringbuffer_mask, position);
insert_length += 2;
}
}
diff --git a/c/enc/block_splitter.c b/c/enc/block_splitter.c
index d308eca..deb7c2e 100644
--- a/c/enc/block_splitter.c
+++ b/c/enc/block_splitter.c
@@ -132,7 +132,7 @@ void BrotliSplitBlock(MemoryManager* m,
{
size_t literals_count = CountLiterals(cmds, num_commands);
uint8_t* literals = BROTLI_ALLOC(m, uint8_t, literals_count);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(literals)) return;
/* Create a continuous array of literals. */
CopyLiteralsToByteArray(cmds, num_commands, data, pos, mask, literals);
/* Create the block split on the array of literals.
@@ -150,7 +150,7 @@ void BrotliSplitBlock(MemoryManager* m,
/* Compute prefix codes for commands. */
uint16_t* insert_and_copy_codes = BROTLI_ALLOC(m, uint16_t, num_commands);
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(insert_and_copy_codes)) return;
for (i = 0; i < num_commands; ++i) {
insert_and_copy_codes[i] = cmds[i].cmd_prefix_;
}
@@ -170,7 +170,7 @@ void BrotliSplitBlock(MemoryManager* m,
uint16_t* distance_prefixes = BROTLI_ALLOC(m, uint16_t, num_commands);
size_t j = 0;
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(distance_prefixes)) return;
for (i = 0; i < num_commands; ++i) {
const Command* cmd = &cmds[i];
if (CommandCopyLen(cmd) && cmd->cmd_prefix_ >= 128) {
diff --git a/c/enc/block_splitter_inc.h b/c/enc/block_splitter_inc.h
index 023712b..e612d6a 100644
--- a/c/enc/block_splitter_inc.h
+++ b/c/enc/block_splitter_inc.h
@@ -219,7 +219,12 @@ static void FN(ClusterBlocks)(MemoryManager* m,
uint32_t symbols[HISTOGRAMS_PER_BATCH] = { 0 };
uint32_t remap[HISTOGRAMS_PER_BATCH] = { 0 };
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(histogram_symbols) ||
+ BROTLI_IS_NULL(block_lengths) || BROTLI_IS_NULL(all_histograms) ||
+ BROTLI_IS_NULL(cluster_size) || BROTLI_IS_NULL(histograms) ||
+ BROTLI_IS_NULL(pairs)) {
+ return;
+ }
memset(block_lengths, 0, num_blocks * sizeof(uint32_t));
@@ -278,11 +283,11 @@ static void FN(ClusterBlocks)(MemoryManager* m,
if (pairs_capacity < max_num_pairs + 1) {
BROTLI_FREE(m, pairs);
pairs = BROTLI_ALLOC(m, HistogramPair, max_num_pairs + 1);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(pairs)) return;
}
clusters = BROTLI_ALLOC(m, uint32_t, num_clusters);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(clusters)) return;
for (i = 0; i < num_clusters; ++i) {
clusters[i] = (uint32_t)i;
}
@@ -294,7 +299,7 @@ static void FN(ClusterBlocks)(MemoryManager* m,
BROTLI_FREE(m, cluster_size);
new_index = BROTLI_ALLOC(m, uint32_t, num_clusters);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(new_index)) return;
for (i = 0; i < num_clusters; ++i) new_index[i] = kInvalidIndex;
pos = 0;
{
@@ -386,7 +391,7 @@ static void FN(SplitByteVector)(MemoryManager* m,
return;
}
histograms = BROTLI_ALLOC(m, HistogramType, num_histograms);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(histograms)) return;
/* Find good entropy codes. */
FN(InitialEntropyCodes)(data, length,
sampling_stride_length,
@@ -405,7 +410,11 @@ static void FN(SplitByteVector)(MemoryManager* m,
uint16_t* new_id = BROTLI_ALLOC(m, uint16_t, num_histograms);
const size_t iters = params->quality < HQ_ZOPFLIFICATION_QUALITY ? 3 : 10;
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(block_ids) ||
+ BROTLI_IS_NULL(insert_cost) || BROTLI_IS_NULL(cost) ||
+ BROTLI_IS_NULL(switch_signal) || BROTLI_IS_NULL(new_id)) {
+ return;
+ }
for (i = 0; i < iters; ++i) {
num_blocks = FN(FindBlocks)(data, length,
block_switch_cost,
diff --git a/c/enc/brotli_bit_stream.c b/c/enc/brotli_bit_stream.c
index aaf2dad..9348a97 100644
--- a/c/enc/brotli_bit_stream.c
+++ b/c/enc/brotli_bit_stream.c
@@ -34,33 +34,18 @@ extern "C" {
BROTLI_DISTANCE_ALPHABET_SIZE(0, 0, BROTLI_LARGE_MAX_DISTANCE_BITS)
/* MAX_SIMPLE_DISTANCE_ALPHABET_SIZE == 140 */
-/* Represents the range of values belonging to a prefix code:
- [offset, offset + 2^nbits) */
-typedef struct PrefixCodeRange {
- uint32_t offset;
- uint32_t nbits;
-} PrefixCodeRange;
-
-static const PrefixCodeRange
- kBlockLengthPrefixCode[BROTLI_NUM_BLOCK_LEN_SYMBOLS] = {
- { 1, 2}, { 5, 2}, { 9, 2}, {13, 2}, {17, 3}, { 25, 3}, { 33, 3},
- {41, 3}, {49, 4}, {65, 4}, {81, 4}, {97, 4}, {113, 5}, {145, 5},
- {177, 5}, { 209, 5}, { 241, 6}, { 305, 6}, { 369, 7}, { 497, 8},
- {753, 9}, {1265, 10}, {2289, 11}, {4337, 12}, {8433, 13}, {16625, 24}
-};
-
static BROTLI_INLINE uint32_t BlockLengthPrefixCode(uint32_t len) {
uint32_t code = (len >= 177) ? (len >= 753 ? 20 : 14) : (len >= 41 ? 7 : 0);
while (code < (BROTLI_NUM_BLOCK_LEN_SYMBOLS - 1) &&
- len >= kBlockLengthPrefixCode[code + 1].offset) ++code;
+ len >= _kBrotliPrefixCodeRanges[code + 1].offset) ++code;
return code;
}
static BROTLI_INLINE void GetBlockLengthPrefixCode(uint32_t len, size_t* code,
uint32_t* n_extra, uint32_t* extra) {
*code = BlockLengthPrefixCode(len);
- *n_extra = kBlockLengthPrefixCode[*code].nbits;
- *extra = len - kBlockLengthPrefixCode[*code].offset;
+ *n_extra = _kBrotliPrefixCodeRanges[*code].nbits;
+ *extra = len - _kBrotliPrefixCodeRanges[*code].offset;
}
typedef struct BlockTypeCodeCalculator {
@@ -450,7 +435,7 @@ void BrotliBuildAndStoreHuffmanTreeFast(MemoryManager* m,
const size_t max_tree_size = 2 * length + 1;
HuffmanTree* tree = BROTLI_ALLOC(m, HuffmanTree, max_tree_size);
uint32_t count_limit;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(tree)) return;
for (count_limit = 1; ; count_limit *= 2) {
HuffmanTree* node = tree;
size_t l;
@@ -714,7 +699,7 @@ static void EncodeContextMap(MemoryManager* m,
}
rle_symbols = BROTLI_ALLOC(m, uint32_t, context_map_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(rle_symbols)) return;
MoveToFrontTransform(context_map, context_map_size, rle_symbols);
RunLengthCodeZeros(context_map_size, rle_symbols,
&num_rle_symbols, &max_run_length_prefix);
@@ -956,23 +941,21 @@ void BrotliStoreMetaBlock(MemoryManager* m,
size_t pos = start_pos;
size_t i;
- uint32_t num_distance_symbols = params->dist.alphabet_size;
- uint32_t num_effective_distance_symbols = num_distance_symbols;
+ uint32_t num_distance_symbols = params->dist.alphabet_size_max;
+ uint32_t num_effective_distance_symbols = params->dist.alphabet_size_limit;
HuffmanTree* tree;
ContextLut literal_context_lut = BROTLI_CONTEXT_LUT(literal_context_mode);
BlockEncoder literal_enc;
BlockEncoder command_enc;
BlockEncoder distance_enc;
const BrotliDistanceParams* dist = &params->dist;
- if (params->large_window &&
- num_effective_distance_symbols > BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS) {
- num_effective_distance_symbols = BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS;
- }
+ BROTLI_DCHECK(
+ num_effective_distance_symbols <= BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS);
StoreCompressedMetaBlockHeader(is_last, length, storage_ix, storage);
tree = BROTLI_ALLOC(m, HuffmanTree, MAX_HUFFMAN_TREE_SIZE);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(tree)) return;
InitBlockEncoder(&literal_enc, BROTLI_NUM_LITERAL_SYMBOLS,
mb->literal_split.num_types, mb->literal_split.types,
mb->literal_split.lengths, mb->literal_split.num_blocks);
@@ -1163,7 +1146,7 @@ void BrotliStoreMetaBlockTrivial(MemoryManager* m,
uint8_t dist_depth[MAX_SIMPLE_DISTANCE_ALPHABET_SIZE];
uint16_t dist_bits[MAX_SIMPLE_DISTANCE_ALPHABET_SIZE];
HuffmanTree* tree;
- uint32_t num_distance_symbols = params->dist.alphabet_size;
+ uint32_t num_distance_symbols = params->dist.alphabet_size_max;
StoreCompressedMetaBlockHeader(is_last, length, storage_ix, storage);
@@ -1177,7 +1160,7 @@ void BrotliStoreMetaBlockTrivial(MemoryManager* m,
BrotliWriteBits(13, 0, storage_ix, storage);
tree = BROTLI_ALLOC(m, HuffmanTree, MAX_HUFFMAN_TREE_SIZE);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(tree)) return;
BuildAndStoreHuffmanTree(lit_histo.data_, BROTLI_NUM_LITERAL_SYMBOLS,
BROTLI_NUM_LITERAL_SYMBOLS, tree,
lit_depth, lit_bits,
@@ -1206,7 +1189,7 @@ void BrotliStoreMetaBlockFast(MemoryManager* m,
BROTLI_BOOL is_last, const BrotliEncoderParams* params,
const Command* commands, size_t n_commands,
size_t* storage_ix, uint8_t* storage) {
- uint32_t num_distance_symbols = params->dist.alphabet_size;
+ uint32_t num_distance_symbols = params->dist.alphabet_size_max;
uint32_t distance_alphabet_bits =
Log2FloorNonZero(num_distance_symbols - 1) + 1;
diff --git a/c/enc/cluster_inc.h b/c/enc/cluster_inc.h
index 22ecb3c..3d4f40e 100644
--- a/c/enc/cluster_inc.h
+++ b/c/enc/cluster_inc.h
@@ -215,7 +215,7 @@ BROTLI_INTERNAL size_t FN(BrotliHistogramReindex)(MemoryManager* m,
uint32_t next_index;
HistogramType* tmp;
size_t i;
- if (BROTLI_IS_OOM(m)) return 0;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(new_index)) return 0;
for (i = 0; i < length; ++i) {
new_index[i] = kInvalidIndex;
}
@@ -229,7 +229,7 @@ BROTLI_INTERNAL size_t FN(BrotliHistogramReindex)(MemoryManager* m,
/* TODO: by using idea of "cycle-sort" we can avoid allocation of
tmp and reduce the number of copying by the factor of 2. */
tmp = BROTLI_ALLOC(m, HistogramType, next_index);
- if (BROTLI_IS_OOM(m)) return 0;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(tmp)) return 0;
next_index = 0;
for (i = 0; i < length; ++i) {
if (new_index[symbols[i]] == next_index) {
@@ -259,7 +259,10 @@ BROTLI_INTERNAL void FN(BrotliClusterHistograms)(
HistogramPair* pairs = BROTLI_ALLOC(m, HistogramPair, pairs_capacity + 1);
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(cluster_size) ||
+ BROTLI_IS_NULL(clusters) || BROTLI_IS_NULL(pairs)) {
+ return;
+ }
for (i = 0; i < in_size; ++i) {
cluster_size[i] = 1;
diff --git a/c/enc/command.c b/c/enc/command.c
new file mode 100644
index 0000000..5e6c249
--- /dev/null
+++ b/c/enc/command.c
@@ -0,0 +1,28 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include "./command.h"
+
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+const uint32_t kBrotliInsBase[BROTLI_NUM_INS_COPY_CODES] = {
+ 0, 1, 2, 3, 4, 5, 6, 8, 10, 14, 18, 26,
+ 34, 50, 66, 98, 130, 194, 322, 578, 1090, 2114, 6210, 22594};
+const uint32_t kBrotliInsExtra[BROTLI_NUM_INS_COPY_CODES] = {
+ 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 12, 14, 24};
+const uint32_t kBrotliCopyBase[BROTLI_NUM_INS_COPY_CODES] = {
+ 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 18,
+ 22, 30, 38, 54, 70, 102, 134, 198, 326, 582, 1094, 2118};
+const uint32_t kBrotliCopyExtra[BROTLI_NUM_INS_COPY_CODES] = {
+ 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 24};
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
diff --git a/c/enc/command.h b/c/enc/command.h
index 1aac856..d84e373 100644
--- a/c/enc/command.h
+++ b/c/enc/command.h
@@ -20,14 +20,14 @@
extern "C" {
#endif
-static uint32_t kInsBase[] = { 0, 1, 2, 3, 4, 5, 6, 8, 10, 14, 18, 26, 34, 50,
- 66, 98, 130, 194, 322, 578, 1090, 2114, 6210, 22594 };
-static uint32_t kInsExtra[] = { 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4,
- 5, 5, 6, 7, 8, 9, 10, 12, 14, 24 };
-static uint32_t kCopyBase[] = { 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 18, 22, 30,
- 38, 54, 70, 102, 134, 198, 326, 582, 1094, 2118 };
-static uint32_t kCopyExtra[] = { 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3,
- 4, 4, 5, 5, 6, 7, 8, 9, 10, 24 };
+BROTLI_INTERNAL extern const uint32_t
+ kBrotliInsBase[BROTLI_NUM_INS_COPY_CODES];
+BROTLI_INTERNAL extern const uint32_t
+ kBrotliInsExtra[BROTLI_NUM_INS_COPY_CODES];
+BROTLI_INTERNAL extern const uint32_t
+ kBrotliCopyBase[BROTLI_NUM_INS_COPY_CODES];
+BROTLI_INTERNAL extern const uint32_t
+ kBrotliCopyExtra[BROTLI_NUM_INS_COPY_CODES];
static BROTLI_INLINE uint16_t GetInsertLengthCode(size_t insertlen) {
if (insertlen < 6) {
@@ -89,19 +89,19 @@ static BROTLI_INLINE void GetLengthCode(size_t insertlen, size_t copylen,
}
static BROTLI_INLINE uint32_t GetInsertBase(uint16_t inscode) {
- return kInsBase[inscode];
+ return kBrotliInsBase[inscode];
}
static BROTLI_INLINE uint32_t GetInsertExtra(uint16_t inscode) {
- return kInsExtra[inscode];
+ return kBrotliInsExtra[inscode];
}
static BROTLI_INLINE uint32_t GetCopyBase(uint16_t copycode) {
- return kCopyBase[copycode];
+ return kBrotliCopyBase[copycode];
}
static BROTLI_INLINE uint32_t GetCopyExtra(uint16_t copycode) {
- return kCopyExtra[copycode];
+ return kBrotliCopyExtra[copycode];
}
typedef struct Command {
diff --git a/c/enc/compress_fragment_two_pass.c b/c/enc/compress_fragment_two_pass.c
index f8a5606..ca68b38 100644
--- a/c/enc/compress_fragment_two_pass.c
+++ b/c/enc/compress_fragment_two_pass.c
@@ -524,7 +524,7 @@ static void StoreCommands(MemoryManager* m,
static BROTLI_BOOL ShouldCompress(
const uint8_t* input, size_t input_size, size_t num_literals) {
double corpus_size = (double)input_size;
- if (num_literals < MIN_RATIO * corpus_size) {
+ if ((double)num_literals < MIN_RATIO * corpus_size) {
return BROTLI_TRUE;
} else {
uint32_t literal_histo[256] = { 0 };
diff --git a/c/enc/dictionary_hash.c b/c/enc/dictionary_hash.c
index 3677d7d..16d853f 100644
--- a/c/enc/dictionary_hash.c
+++ b/c/enc/dictionary_hash.c
@@ -13,1107 +13,1833 @@
extern "C" {
#endif
-BROTLI_INTERNAL const uint16_t kStaticDictionaryHash[32768] = {
-32072,0,0,0,0,0,0,0,0,21860,0,0,0,0,0,0,0,40486,0,0,0,0,0,45798,0,0,0,0,0,0,1292
-,0,0,0,0,4964,278,23717,0,19972,0,0,0,0,0,0,0,0,0,0,0,0,2126,16102,0,0,0,14437,0
-,0,0,0,0,0,0,26727,2253,0,0,17252,0,0,0,0,0,0,0,0,0,3622,0,0,0,0,22984,0,0,0,0,0
-,0,16647,0,34247,0,0,0,0,0,48486,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2511,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19532,0,0,24004,0,0,0,9828,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,30853,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,31974,0,0,0,0,0,0,0,0,20650,2404,0,20773,1677,9031,0,6404,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,51879,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6761,7206
-,0,0,21992,22983,0,0,3529,0,1864,0,0,0,0,0,0,11046,0,0,9641,0,0,0,6507,0,0,36934
-,21576,62375,0,0,0,0,0,0,0,0,0,8294,0,0,0,0,0,0,0,40807,0,0,0,39398,8136,0,0,0,0
-,0,0,0,8875,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7941,0,0,25609,0,0,0,936,
-3716,3213,15687,0,0,0,0,0,52519,0,17381,0,0,0,0,1320,5797,0,21029,0,0,6472,807,0
-,0,0,0,0,0,0,0,0,0,13545,0,0,0,3624,0,0,0,29674,30820,0,31237,0,6596,0,0,0,0,0,0
-,0,0,0,64070,0,0,0,0,0,0,0,0,0,0,0,22278,0,37446,0,0,0,0,7240,423,0,24612,21705,
-17636,0,0,0,0,0,0,1833,0,0,0,328,6021,0,0,0,19974,0,0,0,0,0,0,0,0,0,62119,4178,0
-,0,0,0,12100,8617,0,0,16900,0,36678,0,0,0,35366,0,51718,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,20998,0,62086,0,0,0,0,0,5542,0,0,0,0,0,0,0,0,0,0,0,14629,10952,25927,0,0,0
-,0,19849,0,0,0,0,0,0,0,30952,3046,14314,12998,0,0,0,15268,0,40582,30216,62118,0,
-0,0,20132,0,0,0,0,0,12005,0,0,0,52358,0,0,0,0,24778,0,44,33095,0,0,0,0,0,26372,0
-,0,0,0,0,3781,0,0,17928,9479,0,0,0,0,0,0,0,0,32297,28613,0,0,0,0,0,0,0,0,0,0,0,0
-,0,47174,11723,0,0,0,0,0,0,0,0,0,2536,55143,0,0,6410,0,0,0,0,0,0,0,0,56294,11914
-,0,529,0,30184,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8261,0,0,28808,58854,22633,
-965,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,64135,0,0,331,3684,0,1605,0,0,0,0,0,0,
-0,0,0,0,16650,37,0,23622,3144,15429,0,0,0,0,0,0,0,0,0,0,22443,69,0,0,0,0,0,0,0,0
-,17832,0,0,0,0,0,0,0,0,0,11113,0,0,0,0,18309,0,0,0,0,0,0,0,0,0,26630,0,0,25512,
-25895,0,0,0,0,0,0,0,0,0,0,0,16901,0,0,0,27558,0,0,9418,0,0,0,3508,0,0,0,0,0,0,0,
-0,37990,9289,8517,0,0,0,0,1578,1604,23944,0,0,14916,12781,0,0,0,0,0,0,0,12105,0,
-16617,0,0,0,0,0,0,0,0,0,0,0,0,21348,11240,28870,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,5772,0,0,27812,0,0,0,0,0,0,0,8324,0,0,0,0,0,0,0,0,0,0,16748,1157,0,0,18794,
-16324,25898,935,8333,0,0,0,0,0,0,0,0,18246,0,18086,0,46854,0,0,0,0,0,0,339,0,0,
-25188,12780,12166,6409,0,0,0,0,16516,0,27012,28395,0,0,0,0,0,0,0,1420,0,0,0,9768
-,52967,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25163,324,0,0,0,0,0,0,0,0,0,64998,0,0,0,0,0,
-21893,0,0,0,0,0,47366,0,0,0,870,0,0,0,12646,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,26020,16360,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1809,0,0,0,6601,15878,0,0,0,0,0,
-29092,0,28516,0,0,0,0,0,0,0,0,0,21988,0,0,0,42950,0,0,0,0,0,0,0,0,0,0,5133,1318,
-0,0,0,0,0,0,0,0,0,0,0,54982,24904,0,0,0,0,0,0,0,0,0,0,51526,0,0,0,0,0,3685,0,0,0
-,0,10062,9412,0,0,0,31460,5708,6181,0,0,0,0,0,0,0,0,0,5575,0,0,0,0,0,0,0,0,0,0,
-27144,57478,0,0,0,0,0,0,7084,0,21993,53126,0,0,0,0,8397,0,0,5733,0,0,0,0,0,2116,
-0,24742,0,11271,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1133,0,4873,0,0,38310,0,0,0,0,0,
-0,0,0,0,0,0,0,17932,0,0,18053,0,0,0,25510,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17798,0,
-26214,0,0,0,0,0,0,0,0,23016,17415,20392,164,0,0,0,0,0,0,0,0,0,0,0,3239,0,46119,0
-,0,0,28580,0,0,0,0,0,0,0,0,0,7621,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,41478,0,0,31016,
-55334,10056,1924,0,0,0,0,0,36614,0,36711,0,0,0,0,0,0,0,0,0,0,13994,59303,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,26501,0,5639,0,0,0,0,0,0,13897,1253,0,0,0,0,0,5095,0,0,0,
-28869,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8646,0,0,0,0,25641,17796,0,0,0,0,0,0,0,
-13316,620,6309,11819,0,0,0,0,0,0,0,0,0,904,1095,0,24229,0,0,28744,49703,0,23077,
-0,0,0,0,32392,0,0,0,0,35271,0,28740,5866,0,0,0,0,0,0,0,4361,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7917,8869,0,0,0,13924,0,0,0,0,
-0,41958,0,0,0,0,0,0,6766,13989,0,0,0,903,0,0,24010,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,64390,0,22468,0,25861,0,0,0,0,23656,5317,0,0,0,0,0,0,23017,5445,16009
-,0,0,0,0,0,0,0,0,48006,10473,0,0,14404,0,0,0,42183,0,0,0,51270,0,0,10602,24132,0
-,0,0,0,0,43782,0,0,17834,0,0,0,25576,27205,0,0,0,0,0,0,0,0,29066,0,0,0,0,0,626,
-1988,14700,0,0,0,0,0,0,0,0,0,0,0,0,57670,0,0,0,0,0,0,0,0,0,44710,0,0,0,0,3848,
-7623,0,0,0,0,0,0,0,0,0,0,0,42374,0,0,0,0,0,0,0,0,19272,6436,0,0,5256,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,19685,0,0,0,0,0,0,0,0,0,0,0,0,0,39783,0,0,0,0,30984,0,0,0,0,0,0
-,28230,0,0,0,29028,10538,3205,0,0,0,0,0,0,0,0,0,0,0,5636,840,295,0,0,8488,8198,0
-,0,0,0,0,0,0,0,0,20580,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4074,19526,0,0,0,0,
-31144,64038,0,0,0,0,0,0,16716,0,0,0,0,0,0,0,0,0,0,0,17706,0,0,0,0,0,0,50630,0,
-50503,0,0,0,0,0,0,0,0,0,0,0,25446,0,0,0,13831,0,0,0,0,0,0,2696,4039,0,0,0,0,
-25288,0,12076,2054,0,48934,0,0,0,0,16969,59431,17259,35335,0,0,0,0,0,0,0,0,0,0,0
-,0,31275,0,0,0,1097,0,0,0,0,0,0,0,0,0,0,0,776,839,0,0,29386,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,5864,12134,0,0,0,0,0,0,0,25349,0,0,0,0,0,0,0,0,0,61447
-,0,0,0,0,0,0,0,0,0,24678,0,0,0,63335,0,28836,8142,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4494,0,0,0,0,0,14088,1188,0,16260,0,0,0,
-16421,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,276,0,0,17060,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24076,29445,0,33543,0,4901,0
-,0,12522,0,0,62471,0,0,0,0,0,0,0,0,0,0,4046,0,0,0,0,20486,0,15460,2217,51719,0,0
-,0,0,0,23495,0,0,0,0,0,0,15370,0,15849,0,15113,0,0,0,0,0,0,0,0,27972,7337,0,0,0,
-0,30342,0,0,0,0,0,0,0,0,32299,23940,0,17766,0,0,0,0,0,0,6184,0,20904,0,0,0,0,0,0
-,0,0,0,0,31492,0,0,0,5509,0,0,0,0,0,0,0,0,2669,50182,0,0,12299,0,0,0,0,0,0,0,
-5257,28167,0,0,0,0,0,0,0,0,0,0,0,11750,3890,0,0,26500,0,0,0,0,0,0,0,49318,0,0,0,
-0,0,0,0,10981,0,0,0,0,0,0,0,0,17961,1831,0,0,0,0,0,0,0,29638,0,0,0,0,26473,0,
-6216,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,711,0,0,0,0,0,0,0,0,0,0,28683,39975
-,0,0,0,0,0,51654,0,0,0,27527,0,0,0,0,0,0,0,0,30859,3268,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28772,0,18212,0,0,0,0,25448,65446,0,0,0,0,
-0,0,3337,1670,0,0,0,0,0,19332,0,0,0,0,24936,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1043,0
-,0,0,0,15814,0,21670,0,0,0,0,0,0,0,16263,0,0,0,0,0,0,0,0,0,32454,0,30630,0,0,
-20170,9926,0,0,0,18247,0,0,14376,0,2056,17191,0,0,0,0,0,0,0,7812,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,22474,52806,1588,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10825,0,
-0,0,0,40934,0,0,0,0,0,0,0,28677,0,0,5714,0,0,0,0,0,0,0,0,0,0,0,0,0,25865,22246,0
-,0,0,0,17256,35751,0,0,0,0,0,0,0,0,8236,0,32108,0,0,0,43,14342,0,16517,0,0,30732
-,0,4012,133,0,40583,971,23942,0,0,27275,0,0,0,204,0,0,27140,7564,44327,27592,
-57958,0,0,0,0,22344,25701,0,0,0,0,0,0,0,19524,31755,0,0,28102,0,59111,0,0,0,0,0,
-0,0,12261,0,44934,0,0,0,0,31560,0,11114,0,0,0,0,0,0,0,0,0,0,0,18953,18311,0,
-45159,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2059,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-19399,0,0,0,0,0,0,0,0,0,0,0,0,0,58534,0,0,0,0,0,0,0,0,0,0,0,0,22411,23943,0,0,0,
-0,0,0,11690,0,0,4069,0,0,2668,6342,0,0,0,0,0,0,27658,1766,0,0,0,0,23240,56070,0,
-0,0,0,0,0,0,0,0,0,0,0,0,34119,0,24453,0,0,0,0,21867,0,17610,9894,0,0,27976,38790
-,0,0,0,43654,0,31559,12202,23142,0,0,0,50343,0,0,0,0,0,32806,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,49895,0,0,0,0,15786,4263,0,0,0,0,4746,3814,0,0,0,0,0,0,17192,
-453,17323,0,20328,4036,0,0,0,15844,0,0,0,0,27561,31940,32296,0,0,0,0,0,0,0,11499
-,11782,0,0,0,0,9738,50471,0,0,0,0,0,35430,0,0,0,0,0,29734,0,0,0,36551,0,0,0,0,
-9257,5606,0,13829,0,7015,0,0,0,0,0,25127,0,0,19051,0,0,0,0,0,0,0,0,0,0,0,0,0,
-2572,0,0,0,0,0,0,29797,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,42342,0,0,0,0,9293,
-0,17896,56038,4077,0,0,0,29899,37351,0,30823,0,8326,0,0,0,18342,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18569,54054,0,0,0,0,0,0,0,0,0,37254,0,0,31433,
-61510,0,2022,0,0,0,0,0,25381,0,0,0,0,0,0,0,0,0,0,0,0,0,2149,25289,0,0,0,0,0,0,0,
-0,0,0,12516,14185,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8676,0,0,0,0,0
-,0,0,0,0,0,0,36486,0,0,0,0,10889,9607,0,28711,0,0,0,0,0,0,0,0,0,0,28490,0,0,0,0,
-26181,10283,1701,0,0,0,0,0,0,0,0,0,14980,0,7783,0,27846,0,0,0,56486,3892,0,0,0,
-5770,16583,0,26309,13422,20292,0,0,0,0,0,0,0,0,0,28742,0,0,0,0,14536,1158,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25801,0,0,0,0,0,0,0,0,0,0,0,0,42438,0,3332,0,0
-,0,0,0,0,0,0,0,8327,0,0,0,0,0,0,0,0,0,0,0,0,17353,1447,0,0,8427,48518,1359,0,0,0
-,0,0,14986,0,32168,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9230,2791,0,0,0,0,0,0,0,0,
-16073,31623,4269,0,0,0,0,0,0,4519,0,0,27912,58950,0,0,0,0,0,0,0,0,8361,19812,0,0
-,0,0,6056,7877,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21701,0,0,0,0,0,0,0,0,0,0,0
-,0,9128,1125,0,16548,0,0,0,0,0,0,0,0,0,0,17292,6854,21352,0,2380,0,0,4007,0,0,0,
-0,0,24357,4202,0,0,0,0,0,0,0,0,0,0,0,0,0,10664,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,42823,3022,0,0,0,0,0,0,0,0,0,0,0,0,14373,0,20677,3304,2759,20522,64903,0,
-0,0,38,0,0,0,0,0,0,0,0,0,0,0,27814,2802,8870,3758,1255,0,0,0,0,0,0,0,0,30027,
-9510,0,0,0,0,17864,14855,0,0,0,0,0,0,0,0,0,0,23404,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-51462,0,0,0,0,0,0,0,45734,0,0,23467,32327,0,0,10826,52999,0,0,0,33222,31336,
-64326,0,0,0,0,0,0,0,32166,0,0,3891,0,0,0,7017,645,0,0,0,0,0,0,27915,46087,0,0,0,
-21863,0,34246,0,0,16715,0,0,0,0,14052,21416,0,0,0,0,0,0,0,0,39846,0,0,0,0,0,
-38982,0,0,17512,7460,0,0,0,0,0,0,0,0,0,15428,0,0,0,0,0,0,0,28356,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,25445,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11879,0,0,0,0,0,0
-,0,0,0,0,0,0,0,19911,0,20007,0,0,0,10855,943,0,0,10821,0,0,0,0,4170,0,0,0,0,0,0,
-0,0,0,9836,0,0,0,0,0,0,0,0,0,0,65415,0,0,0,0,0,0,0,0,9865,24646,0,0,0,0,0,40519,
-0,0,0,0,0,0,0,0,0,12804,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22091,23655,0,0,0,0,0,0,
-0,31686,0,0,0,58599,0,0,0,0,0,0,0,0,0,0,0,0,0,19620,0,0,0,0,0,0,0,0,0,0,0,0,0,
-24421,0,28100,0,0,0,31268,0,3204,0,0,0,0,0,0,0,0,0,14822,0,0,0,0,19947,10182,0,0
-,9480,14821,4398,0,0,14532,0,0,0,48871,1873,0,0,0,0,0,0,0,589,1541,0,0,0,0,0,
-23333,0,0,0,14149,0,0,0,0,1296,14374,0,27300,0,0,0,0,0,0,7276,0,0,0,0,0,0,47718,
-0,0,0,0,0,0,0,0,0,0,5164,1765,0,14405,0,37574,1994,0,6636,0,0,0,0,0,0,0,0,27815,
-0,0,0,0,2568,6820,0,0,0,0,0,0,0,0,0,0,11336,26247,0,0,23912,0,0,0,30536,0,0,
-34342,0,17799,0,0,0,22149,0,6118,0,25732,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,26600,5190,0,0,1142,0,0,0,0,0,0,0,0,39527,0,0,0,0,0,39494,0,0,0,0,0,0,0
-,0,0,0,3085,0,0,0,0,0,0,0,4786,0,0,0,28873,6532,0,0,26664,0,9193,11719,0,0,0,0,0
-,0,31752,64646,0,0,0,0,0,0,0,0,0,0,0,11397,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25094,0
-,0,18153,20167,0,0,0,17254,0,0,878,0,0,0,0,0,0,0,0,0,0,24166,0,0,0,0,0,0,0,0,0,0
-,0,0,26059,0,0,0,0,0,0,0,0,0,0,0,0,0,31592,0,0,8167,24362,6212,0,34758,0,0,0,0,0
-,0,32520,0,0,44679,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17989,8681,29222,0,0,0,
-0,0,0,0,0,10251,4902,1452,15207,0,0,0,0,0,0,0,22822,0,10469,0,0,0,0,0,0,19337,
-17670,107,11494,0,0,0,0,27305,2565,0,0,0,0,0,0,0,64518,200,28389,0,0,0,0,31208,0
-,30762,0,0,0,0,0,29321,60518,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3209,3237,
-12490,22663,0,0,0,18789,31464,16391,0,0,0,0,0,0,0,0,0,0,0,20646,0,0,0,27238,0,0,
-0,0,0,15940,4488,6951,0,0,0,46342,0,0,0,0,0,0,0,0,0,28965,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,20584,3367,0,25350,0,0,0,0,0,0,0,0,0,0,0,0,1814,0,0,0,0,0,0,0,0,0,0,17125,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,55943,0,0,0,0,0,24133,0,0,0,0,0,0,0,0,0,0,0,0,2929
-,0,0,50086,0,2918,25356,30052,115,11846,0,0,0,0,3056,0,0,0,0,17639,239,19815,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,36806,0,0,0,0,0,0,0,0,0,0,0,0,0,21479,0,0,0,0,0,
-28420,11786,4772,0,0,3368,36295,0,31463,0,0,14665,996,0,20582,0,0,0,9988,0,23685
-,0,0,0,52551,0,0,0,0,0,0,0,7556,0,0,0,0,0,0,0,1895,2186,0,0,0,0,0,27755,25447,0,
-0,0,0,31052,63270,0,0,0,0,0,0,0,36742,0,24804,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,31048,0,0,0,0,0,0,0,0,0,21290,2276,0,0,0,0,26475,0,0,0,0,0,0,0,0,0
-,0,15332,0,0,0,0,0,0,0,0,3176,19431,0,0,0,0,0,0,0,62726,0,0,0,25380,0,0,27883,
-1316,0,0,7724,3015,0,0,0,0,6697,0,0,47910,0,0,0,0,0,0,0,0,0,3141,0,0,0,14820,0,0
-,0,0,9326,0,0,0,0,0,0,0,0,0,0,31493,0,0,0,0,0,6566,0,0,0,0,0,0,6569,1348,0,25638
-,0,0,0,0,0,20324,0,0,17067,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11876,0,41030,0,0,0,26405
-,0,0,0,0,0,0,0,0,0,11431,28137,14950,0,10151,0,0,0,0,0,0,0,29574,0,0,0,0,27176,
-57446,0,0,0,0,28650,57574,1387,0,0,0,0,0,0,0,0,0,0,58247,0,0,0,0,0,0,0,16805,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3526,0,15781,0,5572,13352,0,0,0,0,0,18665
-,23463,0,0,0,0,0,0,15405,6885,0,0,0,0,15272,0,0,0,0,0,0,0,0,9861,0,0,0,0,0,0,0,0
-,9512,4037,0,0,11563,49639,0,0,0,0,0,0,27880,57830,0,0,0,0,0,41831,0,21924,0,0,0
-,0,0,0,0,25509,0,27462,0,18085,0,0,0,0,0,0,0,0,0,0,0,0,13898,8068,26441,0,0,0,0,
-0,0,25316,0,0,0,0,16298,7397,5706,19239,0,0,0,0,0,0,0,0,1392,50919,0,0,0,0,0,
-53863,0,0,0,0,1451,0,0,0,0,0,0,0,0,0,0,35847,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,17801,15813,0,12740,0,0,0,32967,0,0,0,0,0,0,5389,0,0,0,0,0,0,0,0,0,0,31143,0,
-20548,0,0,0,0,0,0,0,0,0,51686,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-12109,19015,0,34983,0,21732,3600,0,0,0,0,47750,17288,43975,22857,47559,0,0,0,0,
-26408,48358,0,0,0,0,0,0,0,0,0,0,0,0,0,30470,0,0,23560,4581,0,22404,0,49286,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,49831,0,0,0,27525,31691,7,0,0,25835,0,0,0,0,0,
-4201,16485,0,20676,0,0,0,0,3753,23303,16264,3878,0,0,0,0,0,0,11434,0,0,0,0,0,0,
-7589,0,0,0,0,0,0,0,0,0,57095,0,0,0,0,0,0,0,0,0,0,0,22820,11146,49158,0,23623,0,0
-,0,0,0,0,0,13893,0,0,0,0,0,0,11722,60071,1258,0,0,0,0,0,0,18564,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,27945,0,0,0,0,5479,0,20006,17608,3431,10988,30180,0,0,0,0,0,0,0,
-24581,14,0,0,0,0,0,0,25572,0,0,0,28612,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,53543,0
-,0,0,0,0,0,0,0,0,0,0,33670,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8710,0,14116,0,0,116,
-292,0,0,0,37831,0,43078,0,0,0,0,0,0,0,0,21832,0,0,32134,783,0,0,30982,0,0,0,68,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5932,0,0,0,18505,
-15175,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3630,16965,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,17797,0,0,0,0,0,0,520,42150,0,0,3122,0,0,0,22506,0,0,0,0,0,0,0,0,28550,0,
-0,0,50278,0,0,13641,5958,0,35238,0,0,0,0,0,0,0,0,29993,18724,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,20619,9319,0,0,0,0,23977,0,5193,0,0,12196,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,24390,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20105,677,0,0,0,0
-,0,0,0,0,29419,0,0,0,0,0,0,0,0,0,20266,0,0,0,0,10631,0,0,0,0,0,0,0,0,0,47655,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26628,12744,0,20648,0,0,0,432,0,0
-,0,0,0,0,0,0,0,0,646,0,25604,0,0,0,0,0,0,0,0,0,0,0,0,0,63782,0,0,0,0,24616,0,0,0
-,21291,0,0,0,0,0,0,0,0,0,0,45638,0,0,0,0,1931,0,0,0,20521,59975,0,20614,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,56231,0,0,0,0,0,29991,0,52871,0,20934,0,0,0,0,0,0,0,16871,
-0,0,0,0,0,0,0,0,0,0,0,0,0,7237,0,0,0,0,0,47558,0,0,0,0,0,0,0,0,0,0,0,10406,0,0,0
-,0,0,0,0,43046,0,0,2930,0,12936,0,0,0,0,0,0,0,0,0,0,0,0,31141,0,0,0,0,0,0,0,
-37639,0,17572,0,0,0,0,0,0,0,0,0,0,31240,0,0,0,0,0,688,0,0,0,0,0,1648,0,0,0,0,
-10055,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,146,0,0,0,0,0,0,0,0,0,6345,199,0,34982,0,0
-,0,0,0,0,0,0,0,0,0,0,0,56839,0,0,0,0,0,48902,0,13412,0,0,0,0,0,0,0,0,2441,4420,0
-,0,0,0,20428,933,0,0,0,0,0,0,0,45383,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,54726,0,0,0,0,0,0,0,0,0,0,0,0,17036,741,0,0,0,0,0,0,0,27589,0,0,30282
-,18950,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2248,0,0,0,0,0,0,0,0,0,25993,0,0,0,
-2443,0,0,31622,0,14150,0,0,0,28679,0,0,0,0,0,0,15464,0,0,0,0,54694,0,0,0,0,0,0,
-3827,0,0,0,3756,0,9897,0,0,0,0,0,19082,31239,0,0,0,0,0,0,0,0,0,0,0,24580,0,0,0,0
-,0,0,0,0,0,16580,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27625,0,0,0,784,4647,32652,0,0,
-63494,0,0,0,0,0,0,0,21062,0,0,0,0,0,0,0,0,0,0,3404,58470,0,32325,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,18634,2789,0,0,0,0,0,0,0,8548,0,0,0,22501,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,15881,0,0,0,0,35879,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7978,17956,0,0,0,
-0,0,0,0,24324,0,0,4937,0,0,0,8168,0,13420,10340,0,0,0,0,0,11780,0,0,0,0,0,0,0,0,
-0,0,16712,0,0,0,0,0,0,0,17640,17991,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,2953,0,0,0,0,0,0,0,9100,16806,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,30667,0,0,
-19013,0,0,0,0,0,0,205,15334,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1969,0,0,0,0,0,0,0,26248
-,52518,0,49798,0,0,0,0,0,0,0,9668,0,0,0,0,0,4742,0,0,21641,0,0,0,0,0,0,53574,0,0
-,0,0,0,0,5707,0,0,0,0,0,0,0,3018,12454,0,0,0,0,2920,262,0,0,0,0,0,0,0,0,0,0,3593
-,0,0,0,0,0,0,0,0,0,0,23910,0,0,0,0,0,0,0,55879,0,0,0,0,0,775,0,43270,5066,48967,
-0,0,22986,4165,8971,44838,0,0,0,0,0,62279,272,0,0,0,0,51430,0,0,0,0,0,0,28234,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13349,0,0,0,51111,20265,13861,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,585,7494,0,0,0,0,0,0,0,0,21768,62407,0,0,0,0,7979,166,0,
-0,0,0,0,0,0,0,0,38918,0,56742,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16296,5767,0,0,0,0,0,0
-,0,32068,0,0,0,0,0,0,0,0,0,0,0,0,0,29796,0,0,0,0,0,0,0,0,23916,30183,0,58791,0,0
-,0,0,0,0,0,20518,0,0,0,0,8969,0,0,0,183,0,0,0,0,0,2314,17445,0,0,0,0,0,0,0,0,0,
-23748,0,0,8139,4839,27914,0,0,0,0,0,0,0,0,0,0,0,0,29478,0,0,16552,26663,0,53767,
-0,0,13960,8039,18696,0,0,0,0,0,0,0,0,0,0,0,782,16005,0,0,0,0,0,0,0,0,6258,56806,
-16456,12455,0,0,0,0,0,0,0,23780,0,0,0,0,0,0,9355,0,0,0,7273,41063,24780,57766,0,
-0,0,0,0,0,0,0,0,0,3820,2597,0,0,0,0,0,0,0,0,0,0,0,0,0,0,29225,61126,0,0,0,58439,
-15691,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,37190,22408,967,0,0,0,
-23078,26858,0,0,0,19753,0,0,0,0,0,0,0,0,0,5416,13702,0,0,0,0,0,52742,20394,38567
-,0,0,0,51079,0,0,136,8516,0,0,0,0,0,0,0,0,0,0,0,27588,0,0,0,0,0,0,0,0,0,0,531,0,
-0,0,0,0,0,0,0,0,8936,5031,12520,19334,0,0,22827,30247,28074,31140,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,27497,18148,20104,59079,0,0,0,0,0,0,0,0,0,24389,0,0,6125,0,0,0,0,
-9541,0,0,24553,29095,0,0,0,0,0,0,0,25444,0,0,9643,0,0,63047,0,0,0,0,0,0,0,0,0,
-39558,0,0,0,0,0,0,20620,11815,499,0,5128,2278,0,0,0,0,0,46310,0,0,0,0,0,0,0,0,
-23530,40166,2440,0,0,0,0,0,0,0,0,0,0,15174,0,0,0,0,0,0,0,0,0,0,26922,0,0,0,0,0,0
-,0,0,0,0,26758,0,0,0,0,0,51911,0,0,23532,0,0,0,0,51238,25737,44486,12622,0,0,0,0
-,0,0,3078,0,9253,0,0,1128,22023,0,0,0,21350,0,16420,0,0,0,0,0,0,0,65094,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22532,0,48774,0,34503,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,9797,0,0,0,0,0,0,0,13797,0,38279,0,0,1738,0,489,46343,0,45382,0,0,0,0,0,0,
-0,0,0,29030,0,0,0,0,0,0,6220,56550,0,0,0,0,0,26885,0,28806,0,0,0,0,0,0,0,0,0,0,0
-,45958,0,0,0,0,20553,49927,0,0,0,0,0,0,3019,12358,0,0,0,0,0,0,0,0,0,0,26571,
-13319,0,0,653,23399,0,0,0,0,0,0,0,0,22316,0,0,21188,0,0,0,0,0,0,0,0,0,27556,0,0,
-0,0,0,0,0,27878,21483,27653,0,29701,237,0,10632,0,0,0,0,33766,0,0,0,0,0,0,31563,
-0,0,0,0,0,1416,2439,0,0,0,0,0,0,0,0,0,0,9611,0,0,0,0,0,0,0,5611,16581,26601,
-35462,0,0,0,26756,0,59271,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26984,57734,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,7882,0,0,0,19528,6469,0,0,1161,0,0,0,7688,20935,425,0,
-0,0,0,0,0,0,0,12519,0,12902,0,0,0,0,0,0,0,0,0,0,2411,0,11725,26086,0,0,20201,0,0
-,0,0,0,0,0,0,11045,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,30471,0,0,0,0,0,0,0,0,0,0,0,
-21541,1141,21190,0,9188,0,0,0,0,0,0,0,0,0,0,0,0,0,0,184,1093,0,0,0,0,0,0,0,0,
-4842,0,13672,0,0,12230,0,0,0,10532,0,0,8937,0,0,0,0,0,0,0,0,0,0,28996,0,0,11720,
-26982,0,46182,0,43911,31754,0,1160,3940,0,20772,0,0,0,0,0,24549,0,32582,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,31845,0,0,0,0,0,0,0,2310,11788,0,0,43047,0,0,0,18853,0
-,0,0,0,0,0,0,0,0,63622,0,0,7048,17318,0,0,0,21957,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,1039,6279,0,0,0,0,0,0,0,0,0,0,0,0,0,12197,0,0,0,0,0,0,0,0,0,
-46470,0,0,24,19719,0,0,0,0,0,0,0,0,0,39335,0,0,0,0,0,0,0,0,0,0,21353,3846,0,0,0,
-0,0,0,0,36679,0,0,0,0,0,0,0,0,0,0,0,11268,0,0,0,0,0,9382,0,0,0,0,0,0,0,0,0,0,0,0
-,0,29926,0,33606,0,4708,2828,0,0,29543,0,0,0,0,0,29893,0,0,0,0,0,0,0,0,3663,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10920,7111,0,0,0,0,0,0,0,0,0,0
-,9384,0,0,0,0,0,0,0,0,0,0,0,0,20388,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,37094,0,0,0,
-27110,0,0,0,0,0,0,21865,0,27753,30214,0,0,0,0,0,57895,0,0,0,0,0,0,0,0,0,0,12648,
-5446,0,0,0,0,0,0,0,0,0,0,19784,17124,0,52007,0,0,0,0,0,0,0,0,758,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,24900,0,0,0,0,0,1476,0,65031,0,0,1205,46663,0,30023,11625,
-1094,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10058,0,0,0,0,0,0,28455,0,0,0,0,0,0,0,0,0,0,0,
-14788,0,0,0,0,16808,0,0,742,0,0,0,0,0,0,0,0,0,0,0,21636,0,0,0,0,0,0,0,0,0,0,0,0,
-15944,23207,0,0,0,0,247,0,0,0,0,24743,0,0,0,5252,0,0,0,0,0,0,0,0,29961,18660,
-21099,46791,0,7045,0,0,0,0,25707,0,0,17412,3828,0,0,0,0,0,0,0,0,0,0,0,5803,5637,
-0,38151,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,60103,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,853,0,0,0,0,0,0,30215,0,0,0,0,0,0,0,8741,0,0,0,0,0,27366,0,0,0,0,171,
-4070,0,0,0,0,0,0,0,0,24073,7366,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2184,5189,0,
-20932,1545,4996,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7684,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6313,0,0,0,0,0,0,0,30826,0,0,0,0,0,0,
-0,0,0,0,27463,0,0,0,0,0,0,0,0,0,0,21640,63303,0,0,3275,31111,0,0,0,0,0,0,0,11556
-,0,14756,0,0,0,15108,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23914,28966,0,0,0,4965,0,0,0,0,
-0,0,0,0,0,0,10216,5223,0,0,0,0,0,0,0,0,0,27142,0,0,1173,20198,0,0,0,0,0,56614,0,
-0,0,0,0,4612,0,0,0,0,0,0,0,0,0,0,11822,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17769,7910,
-0,0,31880,0,0,6055,0,0,0,0,0,0,0,0,0,0,8970,0,0,0,0,0,0,0,0,0,0,0,16840,23879,0,
-0,11051,0,0,0,32552,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20842,13701,0,0,0,37191,7373,
-10471,17482,25348,0,0,0,38502,0,0,0,0,0,0,0,0,0,21509,6058,0,0,0,0,0,0,3173,0,0,
-0,9543,0,0,0,0,0,0,17768,12708,0,0,0,0,0,37030,0,0,0,0,0,0,0,0,0,0,12748,48743,0
-,11718,0,0,25194,0,0,0,9033,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5028,0,30118,0,0,0,0,0,
-42759,0,0,3720,0,0,0,0,0,0,25190,0,0,0,0,0,0,0,0,0,0,5450,5125,0,58086,0,0,0,0,0
-,27716,0,0,0,0,0,0,0,0,0,22052,0,0,0,0,26249,0,15947,3460,0,0,0,35814,0,0,0,7813
-,19500,32167,0,18597,0,0,0,0,0,28644,0,0,0,60743,0,0,0,0,0,29636,0,0,0,0,0,0,0,0
-,0,0,0,0,0,17220,15885,9414,9642,0,0,0,593,0,0,24228,0,0,0,0,0,40422,0,26244,0,
-23109,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,64902,0,0,0,0,3979,60007,0,0,0,28199
-,0,0,0,43142,0,0,0,0,0,0,0,29158,0,30532,0,0,0,0,13256,0,0,0,0,16549,0,0,0,0,0,
-26116,0,0,0,0,0,0,0,0,22825,0,0,0,0,0,0,0,1065,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,18985,4805,0,0,0,0,0,17702,0,0,0,0,0,0,0,0,0,0,3468,0,0,0,0,13447,0,0,0
-,0,0,0,0,0,0,0,0,56871,0,0,1776,15780,0,0,2603,0,10280,31366,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,11592,3591,0,2372,0,0,0,0,0,0,0,20004,0,0,0,0,0,0,12072,518,0,0,1960,
-8999,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7178,32999,0,0,0,0,0,0,1641,0,0,0,0,0,0,0,6764,
-9893,490,4005,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25258,5541,0,14053,306,20743,0,0,
-9422,0,0,0,0,0,0,0,11977,260,0,35175,0,0,0,0,0,0,0,18405,0,0,0,16582,0,0,0,22470
-,0,0,0,0,0,0,2792,0,0,0,14026,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14858,3909,0,0,0
-,57671,0,0,0,0,0,0,15979,0,0,0,2794,15239,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26884,
-9070,0,0,0,0,51846,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19499,37127,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,19205,10350,11910,0,0,0,0,15083,23108,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,169,0,0,0,0,0,0,0,0,0,0,0,15274,41735,0,56774,0,0,2825,0,14025,
-389,0,0,0,0,0,0,0,0,21482,31910,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20456,710,0,0,25032,
-21797,0,0,0,0,0,0,0,0,0,0,32427,21252,0,30150,0,43174,0,0,0,0,0,0,0,0,0,0,0,0,
-11403,0,0,1029,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6892,9252,0,63206,
-3496,14406,0,0,0,0,0,0,0,0,0,0,22568,0,0,21253,0,0,0,0,0,0,0,39623,0,0,10189,0,0
-,0,0,0,0,0,0,0,0,0,0,0,30729,59910,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3305,0,0,0,0,0,0,
-0,0,0,7660,24871,0,838,0,0,0,0,0,0,0,0,0,0,0,0,12013,13252,0,551,0,0,0,43207,0,
-30567,0,0,0,0,0,0,0,0,28394,30724,0,0,0,0,0,0,0,0,0,0,22665,22725,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,29414,0,0,0,0,16074,8966,245,1445,0,0,0,0,24872,0,0,0,0,
-13124,0,35527,0,0,0,0,0,0,13259,10917,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-25191,0,0,0,13956,0,0,0,0,0,0,0,54631,19625,12070,3083,0,0,0,0,14436,0,0,0,0,0,0
-,0,0,0,0,0,0,0,21766,0,15463,29322,0,0,0,0,0,0,29990,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,23653,0,0,0,0,0,0,0,0,2643,0,0,21223,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,4114,0,0,0,0,0,0,0,0,34790,0,0,0,0,0,0,0,16103,0,0,0,0,0,0,297,3620,3338,
-10372,0,14727,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,29924,22473,13895,
-15529,32455,30378,13540,0,28807,0,0,0,0,0,0,0,64582,18380,0,0,0,0,0,0,0,0,0,0,0,
-0,38598,0,0,0,0,0,0,0,0,1236,0,0,0,0,0,0,0,0,0,0,0,0,0,0,32710,0,0,0,0,4590,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,64935,0,0,0,0,0,0,0,0,0,0,0,0,16744,0,0,
-0,0,0,0,20005,0,0,13608,1191,0,0,0,62183,0,0,0,0,0,24484,0,0,0,0,0,0,0,0,0,0,
-17643,0,0,0,0,0,0,0,0,0,0,0,0,5380,0,0,32328,0,0,63814,0,0,0,2919,0,0,0,0,17034,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,60295,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,7690,486,0,0,0,39270,0,49094,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12555,0,0,0,0,0,0,0,0
-,0,0,0,0,20967,17993,12647,0,0,0,16036,32616,0,0,0,0,16294,8555,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35174,0,0,0,0,0,0,30346,0,0,0,0,0,0,0,
-14797,3652,0,0,8268,12934,0,54950,0,0,0,0,2632,33959,0,23175,0,0,0,0,0,36262,0,0
-,0,0,0,0,32684,26918,0,32676,0,0,0,0,0,0,0,0,0,0,15625,11943,1206,0,0,0,0,18052,
-0,0,0,0,0,16422,0,0,0,26404,0,0,28777,0,0,24902,0,0,408,45351,0,35719,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,3658,17446,0,165,0,0,0,0,0,0,0,6151,0,0,24424,0,0,0,0,0,0,0,
-24170,24293,0,0,0,0,0,0,0,0,0,11847,0,39591,0,0,0,0,0,0,9549,2788,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1010,0,0,0,0,0,0,26055,31724,0,24233,
-1828,0,0,0,0,0,0,0,0,0,17284,0,0,0,0,19464,0,0,0,0,0,0,0,0,32452,0,0,0,28871,0,0
-,0,0,17704,53383,0,0,0,0,0,0,0,0,0,17892,1938,0,0,0,0,0,16362,0,0,21605,0,0,5003
-,0,0,0,0,0,0,22693,0,22342,0,0,0,55846,0,0,0,0,0,0,0,0,0,22853,0,0,0,0,0,0,0,0,
-6600,263,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24836,0,0,0,0,0,0,0,0,0,
-40711,0,0,0,0,0,33894,0,0,0,0,0,0,13000,0,0,0,0,0,0,0,0,0,0,30308,0,0,0,0,0,0,
-5386,0,0,0,0,0,0,27844,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17740,0,0,0,0
-,25093,29064,0,0,0,0,0,0,0,12680,11462,0,0,0,0,0,0,0,0,84,7303,0,0,0,0,0,0,0,0,0
-,0,0,27044,457,0,22924,58246,19016,0,2606,45703,0,5157,0,25028,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,2065,0,0,0,0,0,31946,0,0,0,0,0,0,0,0,0,0,0,0,33382,0,
-47878,0,0,0,0,0,0,0,0,25004,0,0,0,0,0,0,0,26153,35654,0,58055,30668,0,0,0,0,
-25988,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4456,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,7560,20583,0,0,0,0,0,0,0,0,0,37510,0,0,0,0,0,0,0,0,0,42822,0,0,0,0,0,0,0,0,
-0,0,0,1733,0,0,0,8196,0,0,11241,0,30572,60326,0,15013,0,0,0,40646,0,23812,0,
-10022,0,0,0,0,0,0,0,0,12874,31015,0,0,0,0,0,0,1608,0,0,0,0,18308,0,0,0,0,27114,0
-,0,0,0,0,0,0,7944,1382,0,11813,0,0,0,0,0,0,0,0,0,0,0,0,0,24517,0,11621,0,0,0,0,0
-,0,0,0,0,0,0,21702,0,0,13100,8262,2644,7973,0,0,0,0,0,0,0,0,0,0,0,0,1033,12581,0
-,25221,0,0,0,40998,16301,62983,0,0,0,0,1263,9318,0,0,0,18854,0,0,1741,33895,0,0,
-0,0,0,0,26377,0,0,0,0,0,0,0,0,0,0,32165,0,51143,0,0,0,0,0,29412,0,0,0,0,0,0,0,0,
-1674,4230,0,0,0,0,0,10502,0,0,0,0,5545,0,0,0,0,0,2099,45158,0,0,0,0,0,0,0,0,0,0,
-14157,0,26955,0,0,0,0,0,0,0,0,0,17096,0,0,0,0,0,0,0,0,0,0,0,0,0,27050,6726,0,0,0
-,0,0,0,0,0,28554,0,0,7142,0,0,0,0,16936,0,0,0,25833,0,4399,6980,0,46214,0,0,0,0,
-0,10630,21164,0,0,0,0,0,0,0,2446,48551,0,0,0,0,0,0,0,0,0,0,0,13381,0,0,0,0,0,0,0
-,0,15400,12135,0,0,0,0,0,4774,586,0,0,0,0,0,0,0,0,23751,9736,4548,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25577,29607,6250,1637,0,0,0,0,
-22024,0,0,0,0,22308,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,37414,24044,0,0,0,14474,29735,
-0,7077,0,45990,0,0,0,0,30568,40039,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-6150,0,4228,0,0,0,0,0,27687,0,0,0,0,0,0,0,24548,21513,1350,0,0,0,33607,0,0,0,0,0
-,0,0,0,11784,1414,0,0,0,0,0,0,0,18244,940,0,0,0,0,0,0,7270,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,16709,0,0,0,0,0,0,0,48935,0,0,0,0,0,0,23660,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,53350,0,0,0,0,0,0,4236,16358,0,4422,6665,32644,0,0,744,18084,0,11014,0,0,0,0,0,
-29508,0,0,0,0,0,0,0,7686,0,0,13289,5478,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,12872,0,0,24134,1005,22916,0,31429,23400,0,0,0,0,0,0,0,28424,0,0,0,
-25706,27109,0,0,26345,0,0,0,0,0,0,25126,0,0,88,0,0,0,0,0,0,0,17032,0,0,21799,0,0
-,10060,0,12296,21892,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20777,14311,0,58182,
-32232,0,10282,0,2121,11527,0,0,0,12325,0,0,0,0,0,0,0,28804,2344,8133,0,0,0,0,
-21864,62695,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2771,0,0,
-23204,0,0,0,0,0,6278,0,0,0,0,0,26597,0,0,0,0,23144,0,0,0,0,0,31816,20070,0,0,0,0
-,0,0,0,0,0,0,24456,2118,0,0,0,0,6570,1156,0,0,0,0,0,0,0,30406,0,0,0,28388,3572,0
-,0,26599,12426,5286,0,0,0,0,0,4967,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24970,24167,0,0,0
-,0,28745,4678,0,0,0,0,0,0,0,1444,236,0,0,0,0,0,0,0,0,19428,0,0,0,0,0,0,2092,0,0,
-0,0,0,0,0,0,0,2827,0,0,0,0,0,19881,19204,0,11749,0,0,0,0,0,0,0,17958,0,17894,0,
-18726,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9190,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,21510,5033,0,0,0,0,22855,0,0,0,0,0,14598,0,29605,0,0,0,0,0,0,0,0,
-617,0,0,0,0,47142,0,0,0,0,0,0,0,0,0,0,3627,0,0,0,0,0,0,0,0,0,0,0,0,0,2225,14823,
-0,0,2637,6182,78,15078,0,0,0,0,20264,0,0,0,0,0,0,36743,4140,44551,17352,25703,0,
-0,0,0,0,0,0,0,0,0,0,0,14024,0,0,0,0,0,0,28004,0,0,0,0,0,7588,0,0,0,0,0,0,0,2087,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18028,0,0,0,300,14212,0,0,1386,40327,0,0,0,0
-,0,0,31082,0,0,22374,0,0,0,0,0,35718,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-26532,7756,0,0,18982,0,0,0,0,0,0,0,0,6440,1159,7180,0,0,0,0,0,0,45766,0,57798,0,
-16740,0,0,6802,60454,0,0,0,26470,0,0,0,0,0,65382,4362,7750,0,0,0,0,0,0,9096,4743
-,334,0,0,0,0,0,0,39974,0,0,0,25828,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3027,0,0,
-0,15816,0,0,0,0,0,0,0,0,48327,0,0,0,0,0,0,0,0,0,0,16168,41799,0,0,24458,8581,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12292,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,54503,0,0,0,0,5097,30852,18664,0,0,0,0,0,0,16484,0,0,27337,0,0,0,
-0,0,0,0,0,0,0,0,0,35942,0,0,0,0,0,0,0,4356,0,0,0,0,0,57030,0,0,1417,41191,0,0,0,
-0,0,23429,0,0,0,0,10024,21735,0,0,10126,0,0,0,0,19046,0,0,0,0,0,0,24105,4710,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4394,0,0,0,0,13253,0,56391,0,0,0,0,0,0,0,0,0,0,
-0,19174,0,0,0,0,0,0,0,0,0,55974,0,0,0,52070,0,15620,0,0,0,0,0,2660,0,0,0,0,21644
-,0,0,52455,0,0,0,0,0,0,0,0,0,8902,0,0,0,0,0,0,3116,0,464,34726,0,0,0,0,0,0,25003
-,12423,0,27172,1896,7335,0,0,0,0,0,35686,0,0,0,0,3472,0,0,0,0,22406,0,0,0,0,0,0,
-0,0,0,45254,0,0,0,0,0,0,0,0,0,0,0,0,0,21124,23594,33127,0,0,0,0,0,0,16684,22087,
-0,0,0,0,0,0,0,0,0,0,0,0,8714,0,0,0,0,0,0,0,0,0,0,55814,0,0,0,0,0,0,4109,23460,0,
-0,8874,0,0,0,0,0,0,0,0,0,147,0,0,0,0,0,0,0,0,0,0,0,0,0,29960,63398,1302,0,0,0,0,
-0,0,0,0,24806,0,0,0,0,0,0,0,0,0,9799,0,0,0,0,0,0,0,31333,0,0,0,0,0,19557,0,0,0,0
-,0,5701,0,0,0,63014,0,0,0,0,0,0,0,21254,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12484,0,0,
-0,48326,0,0,0,0,0,0,0,0,0,0,0,15783,0,0,1202,0,0,0,0,23174,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,3086,49191,0,0,5387,15141,0,0,0,3365,0,0,0,0,20076,14021,
-0,0,0,0,0,0,0,0,0,0,376,40198,0,0,0,52039,0,24932,0,0,0,0,808,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,9860,0,0,0,0,0,23719,0,21476,0,0,0,0,20776,4807,0,0,3177,16678,0,0,110
-,10853,0,0,0,17382,0,0,0,0,0,0,0,0,0,43462,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,7500,4966,0,0,0,0,0,0,0,52102,0,24516,0,0,0,0,0,0,0,0,0,0,0,0,0,26535,0,0
-,0,46247,0,0,0,15557,0,0,0,0,76,52327,0,0,0,0,17866,0,0,0,0,0,0,0,0,0,0,46758,0,
-0,0,0,0,19173,0,0,0,0,0,0,0,0,0,44038,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2985,0
-,0,0,0,0,0,14310,0,0,2125,45831,0,0,0,0,0,0,9838,0,13227,19492,0,0,0,29764,0,0,0
-,0,686,30053,0,0,0,0,0,30789,139,20837,0,0,0,0,502,18533,0,0,0,0,0,19111,0,0,0,0
-,0,31396,0,0,0,17444,0,0,0,0,0,0,0,49862,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25610,550,0
-,0,561,0,29034,0,0,0,3528,0,0,0,1715,14661,18,63463,0,0,0,0,0,0,0,0,0,0,14186,0,
-0,0,0,0,0,0,0,0,0,0,29578,59014,0,39430,0,0,0,0,2250,16612,0,31780,0,0,0,0,0,0,
-462,16967,0,29029,0,0,0,0,0,23462,0,0,0,0,0,0,0,0,1768,0,6025,16998,1804,0,0,
-54182,0,0,0,0,0,0,0,0,14124,0,6154,29702,0,0,0,0,0,7716,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,48807,0,8292,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16389,5933,0,
-14857,51303,0,0,0,0,0,0,0,0,0,0,0,35623,9097,23047,0,0,23112,0,0,0,0,0,438,0,0,0
-,0,0,0,0,151,9254,1390,0,0,0,0,0,0,54215,0,0,0,0,6187,0,0,0,0,13095,0,0,0,0,0,0,
-0,0,0,0,0,0,9866,0,0,59622,0,0,0,0,0,0,0,0,0,25286,0,0,23848,32069,0,0,0,0,0,0,0
-,0,0,9255,2187,15270,437,0,0,0,0,0,0,0,0,0,0,19493,0,0,0,0,0,0,0,0,0,0,0,11748,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16902,0,0,0,0,0,0,0,0,0,22212,1865,17543,0,
-0,0,0,0,0,21996,0,0,0,0,55975,0,0,0,0,0,0,0,0,32138,21156,0,0,0,0,0,0,14249,0,0,
-0,2388,0,0,0,0,6823,0,0,0,0,0,0,0,0,0,0,0,0,0,26694,0,0,6059,53511,0,0,0,0,0,0,0
-,49542,6159,0,0,0,0,0,0,0,0,0,0,0,0,0,1036,24036,0,2501,0,0,0,0,0,0,17419,51271,
-3377,15142,0,0,0,0,0,0,5007,62374,0,56935,0,0,0,0,0,0,0,0,0,0,0,24422,0,0,0,0,0,
-0,0,0,942,0,0,0,0,0,0,0,0,0,0,28263,0,0,0,0,0,0,0,15622,0,19749,0,0,1611,0,22219
-,48583,25129,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17476,0,0,0,0,0,0,0,0,0,0,
-721,0,0,0,0,32518,0,0,0,18469,0,0,0,0,0,0,5896,29927,3657,23046,0,0,3214,0,0,0,0
-,0,0,0,0,0,112,0,0,0,0,0,3048,455,0,31012,0,0,0,0,0,0,0,23270,0,32677,0,0,0,0,0,
-38086,0,0,0,0,0,0,0,0,0,0,0,0,0,4900,0,0,0,0,0,0,0,0,0,25541,0,18788,0,0,22248,
-1351,0,61734,4524,30629,0,14887,242,29063,0,0,14408,4741,0,0,0,37318,0,0,0,0,0,0
-,0,0,0,0,0,0,8106,0,32107,0,0,0,0,0,0,0,0,0,0,0,1481,0,0,28132,0,25798,0,59783,0
-,0,0,0,0,59078,0,0,0,23366,0,0,0,0,0,0,0,30887,0,0,0,0,16200,0,0,0,335,0,0,0,714
-,0,0,0,0,0,0,0,0,0,0,0,0,0,30730,9478,0,0,0,0,0,0,0,0,0,0,0,18790,0,0,0,0,663,0,
-0,0,1034,31431,0,0,0,0,0,0,0,0,0,0,30120,0,0,0,0,13925,0,0,0,0,0,0,2280,13414,0,
-0,0,0,0,0,22028,23687,3017,11047,0,0,21738,18630,0,0,0,0,0,0,0,30246,0,0,0,0,0,0
-,0,0,0,0,0,0,17257,0,21896,63783,0,0,0,21094,0,18662,0,25700,0,22533,0,0,0,0,0,
-6341,5800,11111,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15399,
-12970,6501,0,0,3179,26438,0,0,0,0,0,0,0,15750,0,13062,0,0,0,0,0,0,0,0,0,0,142,0,
-0,0,0,21284,11177,4391,0,0,0,0,19595,40647,0,0,0,0,0,11877,0,0,0,26439,0,0,0,0,
-695,49126,27467,11972,0,0,0,0,0,0,9961,0,0,0,31722,62982,0,0,0,0,15817,52710,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24614,0,0,0,0,0,20550,0,0,5034,3942,0,0,0,
-45927,0,0,0,0,0,0,0,0,0,0,2548,0,0,0,0,0,0,45606,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,3405,12582,15563,54087,0,0,0,0,0,0,0,0,0,0,0,0,24202,5893,0,0,0,
-44230,0,0,0,5605,0,47782,0,32230,0,0,0,0,0,0,0,0,0,0,0,7014,0,0,0,0,16488,3175,0
-,27237,0,0,0,0,0,40902,0,0,0,0,0,0,0,32004,31434,0,24392,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,29130,58214,0,0,0,0,0,0,29002,0,0,0,0,0,0,0,0,0,0,55366,0,0,0,0,0,0,0
-,0,0,0,0,37926,0,0,0,0,0,0,0,0,1290,0,0,0,4713,0,0,0,0,0,0,0,0,0,0,0,0,0,20812,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1803,966,0,17700,0,0,654,19109,0,51655,0,0,0,0,0,
-10470,1584,0,0,0,0,0,0,0,2506,0,0,25159,4303,0,0,0,395,15879,0,0,0,0,0,0,0,0,0,0
-,1352,6535,0,19652,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4722,7909,0,0,0,0
-,30152,0,0,64742,0,0,0,0,0,0,2153,9125,0,0,279,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,41894,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,1328,17030,0,0,0,0,0,0,0,54151,0,0,0,0,1775,54535,0,0,0,0,31624,0,0,0,
-7150,0,0,0,0,0,0,0,1840,35943,0,0,0,0,0,56455,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-64486,0,0,0,51174,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4134
-,0,0,0,0,0,0,0,0,0,0,0,17092,0,0,0,0,0,0,0,0,0,0,0,0,12,16134,19883,39943,10281,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,44711,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-14125,2407,0,0,0,0,0,0,0,0,0,0,26921,0,0,0,0,0,22188,0,20810,10053,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,29220,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28170,0,15208,0,0
-,32517,5736,19271,3562,10534,0,0,0,59655,0,0,0,0,27084,60422,0,0,24969,0,0,0,
-2636,0,0,0,0,26277,0,0,0,0,0,0,0,0,0,0,0,30596,3594,0,0,0,8362,14565,0,0,0,0,0,0
-,10793,12326,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5906,59686,0,0,23081,517,0,15556,0,0,0,
-8486,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19877
-,0,0,0,0,0,0,0,0,7497,0,0,26085,0,0,23784,63591,6568,6310,0,0,0,0,0,0,0,0,0,
-10054,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7018,14470,18858,0,5641,10660,0,0,0,0,0,0,0,
-35526,1515,0,0,0,0,0,0,0,0,0,0,0,27656,0,0,9606,0,39590,0,0,0,0,0,0,0,0,0,0,0,
-53926,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,232,4327,12649,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,20199,0,0,0,0,0,0,26730,0,0,0,19400,14695,0,31334,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19589,0,0,0,0,0,0,0,0,5064,11908,0,27333,0,
-0,0,0,0,0,0,47751,0,0,0,26662,0,0,0,0,0,0,0,55655,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,6245,0,0,0,0,0,0,0,0,23368,63911,0,0,0,0,0,0,0,0,1974,0,0,0,0,0,0,0,
-8520,24037,0,0,0,0,0,0,0,26279,0,0,0,22886,0,0,0,27782,0,30694,0,0,0,0,0,0,0,0,0
-,0,0,33703,0,0,0,30405,0,34598,0,51047,0,0,0,0,1908,0,0,0,0,0,0,0,0,0,0,1511,
-21897,0,0,0,0,0,0,51398,0,24870,0,32647,0,0,0,35015,0,0,0,0,0,0,0,11204,0,0,0,0,
-0,0,7758,57991,0,0,0,30949,0,0,22,15140,9162,0,0,0,0,0,0,25540,20136,7108,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16427,10789,9805,0,0,0,0,0,0,0,0,0,4680,0,0,52679,
-0,0,0,0,0,14884,0,0,0,16804,0,0,0,0,0,0,9578,5287,0,0,0,0,0,0,0,34054,0,0,0,0,0,
-19076,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7627,55719,0,39463,14446,58374,0,0,0,0,23465,
-15845,0,0,0,0,0,38534,0,0,0,17893,10922,0,7176,678,0,0,0,0,0,0,0,0,3113,46279,0,
-0,0,0,0,0,0,23334,0,0,18088,23268,0,62342,0,0,0,16613,0,0,0,0,0,0,0,0,0,38182,0,
-0,0,0,0,0,25292,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10344,71,6446,0,0,1893,0,0,
-1106,0,28680,30756,0,41126,0,0,1492,0,15341,0,0,0,0,17575,0,21220,0,0,0,0,0,
-25060,2088,21828,0,0,0,0,0,358,0,0,0,0,0,16708,0,0,0,1668,0,0,0,0,0,12260,0,0,0,
-0,0,0,0,0,4078,0,0,0,0,0,12713,6215,0,0,20329,0,0,0,0,0,0,0,0,0,0,31204,0,0,0,0,
-0,0,0,0,0,0,3732,0,1646,0,0,27460,0,34406,17128,14341,0,0,0,0,0,19527,0,0,0,0,0,
-0,0,0,0,0,6120,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8551,21546,10212,3020,
-2951,0,17638,0,0,6985,44999,2218,8197,0,0,30472,63366,0,26660,0,0,0,0,0,0,0,0,0,
-0,0,0,1265,0,0,0,0,0,0,0,2610,0,0,0,11278,20295,0,0,0,0,0,19780,0,0,0,0,0,0,2353
-,10852,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5421,24292,0,0,0,0,0,0,0,0,0,0,0,0,0,34407,0,
-0,0,0,0,0,15432,20774,0,0,0,0,0,0,0,0,12360,10757,0,0,0,33126,0,0,0,0,0,0,0,0,0,
-0,0,29573,0,2343,0,0,0,0,0,63079,0,0,0,0,0,0,0,0,0,43015,0,16038,0,0,0,0,0,0,0,0
-,1480,25573,0,0,0,0,0,0,0,8839,0,0,0,0,0,0,0,24645,0,0,0,0,0,0,0,0,0,0,0,0,0,
-5063,0,0,0,0,0,45830,0,0,0,0,0,0,0,0,0,0,823,0,0,64039,0,0,0,0,0,0,0,0,0,0,0,0,0
-,15300,0,0,0,0,0,0,2924,46759,6760,19268,0,0,0,0,0,0,0,0,0,34182,0,0,3977,18149,
-0,0,0,32199,0,0,0,0,0,0,0,0,0,23524,25994,0,0,10343,0,0,0,9733,0,0,0,0,0,0,0,0,0
-,4740,0,0,0,0,0,0,0,0,0,16741,0,0,4626,23367,0,0,31400,0,0,3557,0,0,4234,0,0,0,0
-,0,0,28486,0,0,0,0,0,14213,0,57191,0,0,0,0,0,0,0,0,0,0,240,0,0,0,0,65318,29832,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,29989,0,31846,0,0,8170,0,0,4421,27626,30884,0
-,0,20204,0,0,0,0,44614,534,20868,0,0,0,0,0,0,0,0,0,0,0,0,0,28710,0,10277,0,0,0,0
-,0,29511,0,19813,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27020,0,0,0,0,0,0,53094
-,0,35207,0,0,0,37542,0,61766,8584,8037,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12488
-,22757,0,0,0,0,0,0,0,0,0,0,0,0,0,23814,0,0,0,0,0,0,0,0,0,19973,0,0,0,63943,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,36006,0,0,0,19012,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,8580,0,0,0,0,0,0,0,18021,0,0,0,0,0,0,0,0,80,1254,0,0,0,42630,0,0,0,0,0,
-0,0,16262,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2124,25479,0,0,0,0,16873,0,0,0,0,3142,
-0,0,18443,0,0,0,0,0,3917,0,8841,1190,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,20645,0,0,0,0,0,0,0,0,0,0,0,9284,0,0,24394,41351,0,0,0,42087,0,62566,0,0,0,0,
-0,0,0,0,0,0,6728,4199,0,0,0,0,25515,0,1231,0,374,15623,0,29956,0,14118,0,0,0,0,0
-,19047,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,31718,0,0,0,0,0,0,0,0,0,0,0,20900,0,16743,0
-,0,0,28902,0,0,0,0,0,0,0,0,0,0,0,0,2578,0,0,0,0,0,0,0,0,0,13838,0,0,10052,0,0,0,
-0,7432,43783,17097,0,0,0,0,0,873,0,0,0,398,0,0,0,0,0,0,0,0,0,8459,23559,0,53030,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35750,0,4071,0,0,0,38662,0,41414,0,0,0,0,11656,0,0
-,0,0,0,4011,42695,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25353,0,0,0,0,0,0,0,27177,22372,0,
-0,0,0,0,30980,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,46278,3976,12711
-,0,0,0,0,0,0,0,0,0,0,0,20517,0,0,0,0,0,0,0,0,0,0,0,0,4072,11078,0,0,16553,2405,0
-,0,0,0,0,0,0,0,2670,0,0,0,0,0,0,32998,0,0,0,0,0,0,0,47046,0,30533,0,0,11050,9734
-,13129,0,0,0,0,23494,0,0,0,0,0,58310,0,0,0,57543,0,0,0,0,0,0,0,0,0,0,0,0,0,454,0
-,0,0,0,0,0,5163,59687,2220,0,0,0,0,0,0,29510,0,0,0,0,0,0,0,0,0,0,0,17316,0,20069
-,0,0,0,0,0,0,0,0,0,5319,0,0,0,0,0,0,0,0,0,27174,0,0,0,0,0,0,0,22949,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,19208,0,0,0,0,0,0,20933,0,0,6026,8742,0,0,0,17380,0,13127,2797,0
-,0,30116,0,0,5963,8004,0,57126,0,0,0,0,0,42854,14792,30759,0,24964,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,16933,0,0,0,0,0,0,15176,40839,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-788,30341,0,0,0,0,21036,24102,0,0,0,0,30123,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-22597,31531,26789,0,59559,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9352,29863,0,0,0,0,0,0,0,0
-,0,24551,0,0,0,0,0,0,0,20516,0,0,0,39462,3665,0,28265,0,8778,64262,0,57414,9132,
-0,0,18276,0,0,0,0,0,0,0,0,0,0,26344,30725,524,19751,0,13796,0,0,0,0,0,0,0,0,0,0,
-18155,0,12841,0,74,24998,13579,1061,0,64199,0,0,8776,0,0,60231,0,25412,0,0,0,
-59143,0,0,0,0,0,0,14344,1510,0,0,0,38374,0,0,0,0,0,0,0,0,13353,0,0,0,0,0,0,0,0,0
-,0,9446,0,0,0,0,0,0,0,32613,0,0,0,0,0,0,0,0,0,0,0,0,0,19844,0,0,0,0,14859,0,0,0,
-0,6662,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14154,0,29770,0,0,0,0,0,
-16520,2182,0,0,0,0,0,36102,3340,0,0,0,0,0,0,0,0,25189,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,15720,0,0,0,0,0,0,22758,0,0,304,0,3243,14117,0,0,0,0,0,0,0,0,0,0,5130,
-12679,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21733,10441,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,36103,0,0,0,0,0,23590,0,57479,0,0,0,0,0,0,0,0,0,0,0,0,10824,
-18372,0,0,0,0,0,35078,15722,12967,0,0,0,0,0,34599,0,0,0,0,0,0,0,0,0,0,0,0,0,
-53639,0,38630,0,0,0,0,0,0,31017,11333,0,0,0,0,19144,0,9513,0,0,0,0,0,0,0,0,56711
-,24042,0,1197,0,0,58502,0,0,0,0,0,0,0,0,0,8230,6121,18628,0,0,0,0,0,0,25290,0,0,
-0,0,0,1514,0,0,0,0,0,0,0,14378,9798,32363,0,0,0,0,0,9577,0,0,0,0,0,0,26788,0,0,0
-,0,0,0,330,10533,0,0,0,0,0,42246,0,0,0,0,0,0,5074,21028,0,38119,0,0,0,0,0,0,248,
-0,31176,62054,0,53287,0,0,0,0,271,0,0,0,0,0,0,0,0,0,0,0,0,0,9224,2117,0,0,0,0,
-15818,5607,0,52582,0,0,0,0,0,0,0,0,18248,24005,23018,0,0,0,0,0,0,0,0,0,0,0,0,0,
-427,0,0,39910,0,0,7080,11399,0,0,0,0,0,0,0,0,0,0,22220,57894,0,0,0,0,0,0,0,13156
-,0,1413,1007,0,0,0,0,21415,0,21543,0,0,0,0,0,0,0,0,0,41702,22538,9573,0,0,0,8806
-,0,0,6920,56359,0,0,0,0,0,0,0,0,0,0,0,42215,0,0,13708,0,0,0,0,0,0,0,0,0,0,16453,
-0,0,0,0,0,0,1582,1764,3282,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11653,0,0,0,0,12139,0,
-29482,31076,1673,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,40262,0,0,0,33862,0
-,0,0,0,0,20996,0,0,0,0,0,4615,0,0,0,0,0,0,0,0,0,0,0,43943,333,19367,0,0,0,0,0,0,
-0,26821,0,32389,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4936,11687,0,0,0,0,0,0,0,0,0,10885,0
-,0,0,0,0,25926,0,0,0,0,0,0,15851,0,0,0,0,0,0,0,0,0,8360,0,17130,7942,0,11460,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,18150,14248,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-22310,0,0,0,42758,0,0,0,0,0,0,0,0,29354,5574,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,31109,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11236,0,0,0,0,0,0,0,0
-,0,0,0,0,0,9156,0,0,1801,14023,0,0,0,0,0,62406,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-23620,0,0,0,0,0,0,0,0,0,0,31018,65510,0,0,0,0,0,0,0,26182,0,0,0,0,0,0,0,27717,0,
-0,0,0,0,0,0,46950,0,0,0,0,0,0,0,0,0,0,0,0,0,31108,0,11366,0,0,0,3717,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8552,6054,3339,0,0,0,0,51622,0,
-0,0,0,0,0,0,3718,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28358,0,2756,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,1462,0,0,27622,0,0,0,0,0,0,0,62502,14410,56743,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,12206,0,0,0,0,0,0,0,0,0,0,0,0,36550,0,38054,0,0,0,
-21221,0,0,0,0,0,0,0,27077,0,0,16906,0,12587,12101,0,0,0,0,0,0,10414,28775,21769,
-60167,0,56646,0,0,0,0,0,20740,0,0,0,0,0,0,5931,5351,0,65478,0,0,0,0,0,0,7977,
-52647,0,4868,0,0,0,55463,0,0,0,0,0,32197,0,0,0,0,0,13445,0,0,0,26631,0,0,0,0,0,
-11237,0,0,0,0,209,1285,0,0,1928,0,0,0,0,43334,23849,23172,0,0,0,0,0,0,0,0,24712,
-62439,8811,3463,20457,0,0,0,0,0,0,0,0,0,16008,56263,0,0,0,0,0,0,0,0,0,0,0,60358,
-22761,6565,0,0,30888,27686,0,0,0,17093,0,0,0,0,22121,0,0,0,7593,14182,0,28103,0,
-0,0,0,0,45126,0,0,0,0,0,0,0,0,0,0,0,0,0,31844,0,0,0,0,0,0,0,0,0,0,0,0,0,18500,0,
-0,0,0,28202,0,0,0,0,0,0,0,0,26308,0,29541,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-29572,0,0,0,21285,0,0,0,0,0,60839,0,0,0,0,0,30407,15949,2981,0,0,0,46439,0,0,0,0
-,0,23911,26505,25222,12811,5895,0,6343,0,0,0,0,0,0,0,0,0,0,0,31815,0,0,0,0,0,0,0
-,0,19688,10245,0,0,0,31301,26985,28964,0,0,0,0,0,0,0,0,27208,31172,0,0,0,0,216,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16292,0,0,0,0,0,8743,0,0,0,0,0,0,0,0,
-0,0,0,0,0,6438,0,0,0,33319,0,0,0,33286,0,0,0,0,0,0,0,0,0,22181,7499,24774,0,
-10756,0,44775,724,0,25768,25669,24873,5349,25257,0,0,54566,0,0,0,0,0,0,0,0,0,0,0
-,327,439,357,0,0,6536,8452,0,0,1802,0,0,61350,0,15045,0,0,0,0,0,0,0,0,0,0,0,
-38343,0,0,0,0,0,0,0,0,0,0,32491,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-22885,0,0,32073,0,0,0,9546,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27748,0,0,23176,0,0,0
-,0,0,0,0,0,0,0,0,0,24583,0,0,0,0,0,34118,0,0,0,0,2158,0,5586,30340,0,0,0,0,0,0,0
-,0,0,0,0,0,0,24452,0,0,0,0,2409,4390,0,24196,0,0,0,0,0,0,32264,26948,20587,0,0,0
-,2155,0,0,0,0,0,0,0,0,0,0,0,4328,26276,0,0,0,0,0,0,0,0,23564,0,12458,11367,0,0,
-25162,0,0,0,0,0,0,65414,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,32966,0,0,0,
-34662,0,0,0,0,0,39238,0,0,0,0,11400,10214,266,12452,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,15173,0,0,0,13668,0,13222,0,23364,0,0,0,0,0,11941,0,0,0,0,0,0,0,0,0,
-25575,0,0,0,57383,0,0,0,10308,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,2865,9287,75,0,0,0,0,0,0,0,0,0,0,21508,22380,59526,0,0,0,23589,0,0,0,51590
-,0,0,0,0,0,0,0,0,0,0,0,4645,3980,28295,0,0,0,0,0,12388,0,0,0,0,0,0,0,0,0,0,0,
-21734,0,17607,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,41767,0,0,0,0,0,0,0,18436,0,0,0,0,0,
-0,0,21958,0,19430,0,0,1204,0,0,0,0,0,0,0,0,0,3240,55239,0,0,0,0,0,30660,0,0,0,
-28901,0,0,0,0,4716,0,0,0,0,0,0,0,0,0,0,0,11754,0,0,0,0,22086,0,22564,8749,0,0,
-28391,0,0,0,0,0,0,0,0,0,0,0,2886,0,0,0,0,0,0,0,29062,0,0,0,0,0,0,0,40358,0,0,
-15916,39526,0,13735,0,0,0,0,28938,0,407,4006,0,0,0,26916,0,0,0,0,0,27526,30280,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24586,0,24649,5126,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8684,0,0,0,0,0,0,0,23019,0,22377,18599,0
-,0,0,0,0,0,0,0,0,0,27593,9735,0,20196,0,0,0,0,28168,48423,0,0,0,0,0,31399,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,13892,0,0,0,0,0,17606,0,0,15242,29767,26378,17701,0,0,
-14472,0,4840,0,0,0,0,0,0,24708,0,9349,4330,0,0,0,0,0,0,0,16137,0,0,34854,0,0,0,0
-,0,0,0,0,0,0,0,25063,0,0,0,0,0,0,6603,12583,0,0,0,0,0,0,0,0,7433,29188,0,0,0,0,0
-,31270,0,0,22920,3143,0,0,0,0,0,23461,0,0,0,0,0,0,0,0,618,0,0,0,0,21381,0,11524,
-0,0,0,0,0,0,21004,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,312,23239,0,0,0,0,0,0,0,0,0,0,0,
-0,2313,0,0,40614,0,0,14825,0,0,0,0,0,0,46535,0,41190,7853,0,31656,0,0,0,0,0,0,0,
-0,0,3433,5255,0,0,0,0,0,0,0,33958,0,0,0,0,72,15493,0,0,0,0,0,0,0,36070,0,0,0,0,0
-,0,0,14724,0,0,0,0,0,29828,0,0,0,0,0,0,0,18822,20008,0,0,0,0,2438,2952,0,0,0,0,0
-,0,0,0,0,0,0,0,0,3342,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24420,0,19908,0,0,0,8101,0,
-17479,0,0,3530,0,8202,29319,0,0,1132,6789,0,0,23881,0,0,0,4810,0,0,46918,0,0,0,
-41574,0,0,0,0,0,0,0,0,0,48582,0,0,0,0,0,0,0,0,0,0,0,0,0,39334,0,0,0,26117,0,0,0,
-0,0,0,5100,0,0,0,0,0,23496,27813,4045,54918,0,0,0,0,0,0,6473,7428,0,0,0,0,6792,0
-,0,0,0,0,3560,32103,0,0,0,0,0,0,0,0,0,0,0,54790,0,0,6926,0,0,0,0,16518,0,0,0,0,0
-,20806,0,0,0,0,1841,3174,0,0,0,0,9612,18374,0,0,0,0,32744,0,0,9671,0,59879,0,
-23300,8073,0,0,14758,0,0,0,10342,0,0,0,0,0,0,24808,14759,0,0,0,0,0,0,5515,0,0,
-14852,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2354,23271,0,32740,0,0,0,0,0,0,0,0
-,0,0,18472,0,0,0,0,0,0,0,0,33190,0,0,0,0,0,0,0,0,8972,21669,0,0,0,0,0,0,0,0,0,0,
-0,25574,0,0,0,0,5096,0,14283,55367,0,0,0,0,0,0,0,0,0,12644,0,0,0,0,4651,0,0,0,0,
-0,0,0,661,0,0,13638,19466,0,0,0,0,0,31273,0,8010,0,0,0,0,0,3211,0,0,0,0,63430,0,
-0,0,0,0,15237,0,0,0,0,0,0,19018,2437,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14312,0
-,0,0,0,16836,0,0,471,35975,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,6023,0,0,0,0,0,0,0,0,11593,9639,0,0,0,55783,0,5700,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27908,0,26598,0,0,6667,6470,0,0,0,0,0,0,0,
-62534,0,0,0,0,16522,27911,0,0,10025,7172,0,0,779,0,360,17477,0,0,0,61991,7752,
-7717,1494,0,0,0,26569,40742,0,0,0,0,0,0,0,26406,10474,32196,0,0,0,0,0,50567,
-16521,11716,0,0,0,0,0,55558,0,0,0,0,0,0,0,0,0,0,0,61926,0,26436,0,0,0,0,4459,
-10598,0,0,0,0,0,0,0,0,0,0,0,9223,0,29318,0,0,0,0,0,60423,0,0,0,0,0,0,0,47078,0,
-50246,0,12612,0,0,0,0,0,0,0,61799,0,55015,0,21060,7309,0,0,0,0,0,11976,0,0,0,0,
-23527,0,0,0,0,0,0,10347,15942,0,34023,0,0,0,0,4969,0,0,0,0,0,0,0,0,28997,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,36454,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-3466,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19716,
-28872,0,0,0,0,0,22152,0,0,0,0,0,0,26342,0,0,0,9764,0,0,0,0,0,0,0,21798,0,0,0,0,
-13,6853,32136,0,0,0,0,0,0,0,750,0,0,54502,0,0,0,0,0,0,0,0,0,46183,0,0,625,22854,
-0,0,0,0,2061,23588,0,0,11049,56262,0,0,18538,1509,0,0,17258,4453,0,0,0,0,12429,0
-,0,0,0,8102,0,0,0,0,0,0,8074,0,23852,0,0,0,0,0,0,0,0,0,0,0,16136,3428,0,27876,0,
-0,0,7332,0,0,0,0,0,28900,0,0,2284,0,0,17573,201,1508,0,0,0,0,0,0,0,0,0,31365,
-27688,22565,0,0,0,5159,0,0,0,0,4584,42599,0,0,0,44422,1068,23173,0,0,0,613,0,0,0
-,12645,0,0,0,0,0,27076,6732,0,0,0,3913,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,22244,29992,15911,0,0,0,0,0,22982,0,0,0,0,0,0,0,50598,0,0
-,0,0,0,0,5161,1574,0,0,0,0,0,0,0,0,0,19108,0,0,0,35014,0,0,0,25956,29067,0,0,0,0
-,0,0,0,0,0,0,47079,0,0,0,0,0,0,0,0,0,0,1356,61927,0,0,0,64455,2122,64231,0,0,
-18763,0,0,0,0,0,0,0,0,0,907,34471,0,0,0,39078,0,0,1995,0,0,0,0,0,0,0,0,0,0,56518
-,0,0,0,0,0,0,0,0,0,0,0,0,822,0,15978,44423,0,0,3112,325,0,0,0,0,0,15397,0,0,0,0,
-0,0,0,0,0,0,1193,4294,4968,15559,0,46150,0,0,0,0,0,18917,0,0,0,0,0,0,9928,37543,
-0,0,0,0,13097,36999,0,0,0,15430,0,0,8424,29639,0,0,0,0,0,0,0,0,0,0,0,0,0,25734,0
-,0,0,0,0,0,0,0,0,0,0,0,0,40487,0,13284,0,11141,0,0,0,32388,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5298,57702,0,0,0,0,0,0,0,13060,0,0,0,0,0,0,
-8233,42278,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,36422,0,0,0,7972,0,0,0,
-18437,0,0,0,0,7406,0,0,0,9225,0,0,0,0,0,0,0,0,0,13865,47591,18220,53703,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2796,0,0,0,0,0,24940,17223,0,0,0
-,13221,0,0,0,0,0,0,0,0,0,0,15848,0,0,0,0,0,6122,1735,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,16968,18151,0,0,0,0,0,47494,0,0,0,0,0,0,26089,19494,0,0,0,0,0,15494,0,0
-,0,0,0,0,0,0,0,0,28809,0,0,0,0,42727,0,55174,0,0,0,0,0,0,0,0,0,0,0,20485,0,0,0,0
-,0,0,0,0,0,0,0,58598,0,0,0,0,0,0,0,0,0,0,0,0,0,15172,0,0,0,0,0,0,0,0,0,35302,0,
-48135,20972,33094,0,0,0,0,0,9765,0,0,0,0,0,0,0,0,0,39559,0,0,13736,6950,0,0,0,0,
-23658,8903,0,0,0,0,0,0,0,22662,0,0,0,0,0,58886,7468,0,0,0,0,0,0,0,0,64550,0,0,0,
-0,0,47622,0,0,0,50886,0,0,0,0,0,57606,912,0,0,0,0,0,0,0,0,0,1449,0,1169,0,718,
-46151,12104,0,0,0,0,0,0,48230,0,0,0,0,0,0,0,0,0,0,1259,0,0,33734,23208,62567,0,
-65158,0,0,0,0,0,0,0,0,0,0,28684,59878,0,0,0,0,0,0,0,0,0,0,25769,0,0,0,0,65479,0,
-0,0,0,555,22789,0,19748,1769,10246,8680,0,0,0,0,0,0,0,0,0,14250,0,5899,3303,0,0,
-0,0,0,0,0,0,21097,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21638,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,10795,0,0,0,16204,0,0,0,0,0,26986,2469,0,14660,0,0,0,0,0,45447,
-12234,3494,4555,10566,0,0,0,0,0,0,0,0,0,0,0,0,2801,0,0,0,15755,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,39654,0,0,0,0,0,0,6763,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-33574,0,10279,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,63527,0,0,3912,0,0,7492,0,0,0,35142,
-0,0,0,0,0,0,17576,8103,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16713,4198,0,0,4782,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,16228,0,0,0,0,25961,20166,0,0,0,10980,0,0,0,0,0,14340,
-18922,14567,0,44199,0,0,0,0,0,0,0,18406,0,0,0,0,0,37606,0,0,0,0,0,0,0,0,0,20902,
-0,0,0,56358,0,38342,0,0,0,0,9514,36071,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21700,0,0,
-5266,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1134,0,1453,0,0,0,0,0,3882,0,0,0,
-0,0,0,0,0,4004,0,0,0,51910,0,0,0,0,0,23076,4648,0,0,0,31051,25351,0,0,0,22884,0,
-0,0,0,0,63975,0,0,2376,16997,0,0,2096,0,0,0,3373,7046,0,0,0,0,0,0,0,30726,0,0,0,
-0,20,0,13707,614,0,0,12840,3079,0,0,0,0,0,51046,3729,0,32680,0,0,0,0,0,24008,
-62759,0,0,4745,0,0,0,0,0,0,0,0,0,0,0,0,0,2414,0,0,44262,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,24937,0,0,0,0,0,0,0,0,19140,0,13575,0,0,0,0,0,0,0,39110,0,0,0,28036,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,4261,0,0,0,0,5992,0,264,0,0,0,0,0,0,0,13739,0,21928,0,
-0,0,0,0,0,0,0,0,0,0,4232,15110,0,0,0,0,0,0,0,0,0,30022,0,0,27977,0,0,0,0,0,24776
-,0,0,0,0,0,2962,0,0,0,0,0,0,26564,22441,0,0,0,0,0,13640,11205,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,19305,1894,0,0,0,0,0,0,0,0,0,0,9389,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14119,
-5224,135,0,0,0,0,0,0,0,0,0,25796,0,0,0,0,0,0,7470,0,0,0,0,63815,0,55654,0,0,
-12584,0,1524,33223,0,0,0,9895,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11624,
-0,0,0,5614,0,0,0,0,0,0,0,21320,0,0,53607,0,51206,0,0,0,25863,0,0,0,0,0,0,0,0,0,0
-,0,8964,1740,0,0,0,0,0,0,0,0,13476,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7975,0,
-0,3306,8134,0,8389,48,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25766,0,0,0,0,0,0,0,0,0,
-52166,0,0,0,0,0,0,0,0,0,0,0,0,0,21477,31112,31652,0,0,0,0,0,0,0,28452,0,0,0,
-44231,0,0,0,0,0,0,0,24805,0,0,0,0,0,0,0,0,0,0,12428,6471,0,0,0,0,525,17926,0,0,0
-,26919,0,0,18120,0,0,0,30024,0,0,0,0,0,0,0,0,0,0,29189,0,0,0,43559,0,0,0,0,0,0,
-19787,7557,0,59334,0,0,10184,6085,0,44039,0,0,0,0,0,0,0,11175,0,0,0,0,30440,
-63110,0,0,0,0,0,0,11017,0,0,0,0,0,0,0,0,27204,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,29126,0,0,0,0,0,0,0,0,0,0,0,0,0,0,622,0,5226,2727,0,15588,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4650,0,2675,0,0,32420,0,0,0,61511,0,0,
-5419,17829,2123,0,0,0,0,0,0,0,0,0,0,0,0,0,0,38183,2640,0,11274,14533,1842,0,0,
-42663,12681,3430,0,11845,0,0,0,0,0,0,0,0,0,6533,0,0,0,0,0,54598,0,0,0,0,0,0,0,0,
-0,0,0,0,12616,38535,0,0,0,0,0,32229,0,0,0,54279,0,48614,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,31401,0,0,0,0,34310,0,0,0,22788,0,52134,0,0,0,0,0,0,0,23302,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,40678,0,0,0,51463,535,0,0,0,0,15525,0,0,0,0,0,0,4904,869,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,63718,0,0,0,0,0,0,0,0,1678,0,692,0,0,0,
-0,0,0,0,0,0,26216,0,0,0,0,0,29355,0,0,0,0,25095,0,0,0,0,4335,0,0,0,0,0,14538,0,0
-,0,0,0,0,0,0,0,27273,55014,0,0,0,0,0,27271,0,0,0,0,0,30468,0,0,0,0,18186,0,0,0,0
-,0,14345,0,0,0,2152,0,0,0,0,0,0,0,0,0,0,0,0,0,0,58438,21034,0,23339,21318,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,21412,0,0,0,0,0,0,0,12869,0,0,4875,0,0,0,0,29191,0,0,0,0
-,0,0,1640,10247,0,14244,0,0,0,0,9867,0,0,0,0,0,12363,0,0,7653,0,0,4168,2663,0,
-4580,0,11143,0,0,0,0,0,0,0,30662,0,0,0,0,0,6724,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,13764,0,0,0,0,0,0,0,0,0,0,0,0,234,6821,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,25639,0,0,0,0,0,0,0,0,0,29958,0,3461,0,0,0,0,0,0,0,0,0,28324,
-18795,7013,12746,11655,0,37287,0,0,10953,7718,9705,0,0,0,0,0,0,0,0,0,0,46534,0,0
-,0,0,0,0,0,0,0,0,8137,17988,0,25156,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,41415,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15784,6918,0,0,0,0,7019,10919,0,0,0,
-0,0,0,0,0,0,0,4171,55495,4940,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22440,19333,0,0,
-28136,0,6249,21317,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,53414,0,0,0,57318,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,39303,0,0,0,0,0,19940,0,0,0,0,0,0,0,25543,0,0,0
-,0,0,0,0,0,0,0,0,0,2698,3911,0,0,0,26790,0,0,0,0,0,0,32424,0,0,18470,0,0,0,14726
-,29834,0,0,0,0,0,0,0,0,0,0,0,1000,4197,0,0,0,19366,0,0,0,39878,0,0,0,0,2185,8901
-,5288,9829,25000,0,0,0,0,0,0,1062,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35622,0,
-0,23048,62503,6506,0,0,0,0,0,0,0,13609,10438,0,0,0,0,0,0,0,0,0,0,7723,42119,0,0,
-0,0,0,13317,0,0,0,41606,0,27111,0,0,21194,11461,0,0,0,0,26856,58342,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,20940,48710,0,0,0,0,0,0,5227,0,0,0,0,0,10061,31300,0,0,0,19236,0
-,0,0,0,0,30277,13896,0,0,0,12876,13159,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,428,
-46951,13134,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15462,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,21668,0,0,0,0,0,0,0,0,0,0,0,0,2249,0,0,0,0,44967,0,0,0,0
-,0,0,3465,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24868,0,0,0,0,0,23909,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,2190,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16164,0,
-10437,0,0,5263,20102,20938,0,0,0,1192,1030,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,21385,4870,0,0,0,0,0,0,0,0,0,0,0,18596,0,0,0,0,1422,4038,2858,0,0,0,0,0,0,0,0
-,48998,0,0,0,0,0,0,0,0,6508,37350,0,0,0,0,0,0,0,0,17001,39431,0,0,0,0,0,30182,0,
-21445,7403,28164,0,51750,0,0,0,62631,0,0,0,0,0,0,0,31206,0,0,0,0,0,0,0,0,0,0,0,
-7751,0,0,0,0,0,0,0,0,0,13477,0,0,456,26693,0,0,0,0,0,0,0,0,0,0,0,0,14890,0,0,0,0
-,0,26697,22022,13225,27364,0,0,0,18884,0,0,0,0,0,0,0,0,3659,0,0,0,0,0,0,0,0,0,0,
-0,1448,5413,0,0,0,0,0,0,0,0,0,0,0,6340,0,0,18091,18725,0,0,0,0,0,0,0,0,0,0,0,0,0
-,22118,0,0,0,18981,0,0,0,0,0,0,0,0,0,29223,3724,0,0,0,0,43526,0,0,0,25668,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21545,9862,0,22692,32201,60646,0,7300,0,0,
-0,58887,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19460,0,0,0,0,0,0,0,0,0,50342,0,
-65255,4360,17286,0,0,0,0,0,0,0,28708,0,0,30025,60102,0,0,0,0,0,0,0,0,0,47014,0,
-31973,0,9572,0,0,0,0,0,0,0,18501,0,0,0,0,0,14597,0,0,0,53735,5228,22183,0,0,0,0,
-0,0,1554,24164,0,0,0,0,0,0,0,0,0,0,0,0,10827,0,0,0,0,34918,0,0,0,0,22252,0,0,
-46855,0,0,0,0,0,31207,0,0,10733,0,0,63334,0,0,0,0,8616,50119,20169,12678,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,58087,20298,5,0,0,30920,0,0,0,0,0,0,0,296,13190,0
-,30663,0,0,18536,12228,0,6788,0,0,0,0,30890,21796,0,0,526,0,0,0,0,0,0,0,0,0,0,0,
-0,20965,0,0,0,0,2161,0,0,0,0,0,0,24038,0,0,0,0,13544,7398,0,0,32522,9605,0,0,0,0
-,3208,7590,0,0,0,43846,0,0,0,38663,0,0,0,0,0,39014,4142,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,6373,0,0,13676,0,0,0,0,30374,21288,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22791,0,0,0,0,0,37958,0,0,0,0,0,0,0,0,0,0,9452,
-9990,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4841,0,0,0,0,18820,152,0,0,0,0,0,13260,3334,0,0
-,24234,8422,0,17957,0,0,0,10244,0,0,0,0,0,0,0,0,0,0,0,7204,0,0,0,0,1201,26151,0,
-31173,0,0,0,0,0,0,0,0,0,0,0,0,0,64838,4203,7525,521,0,18888,37031,0,0,0,0,0,0,0,
-0,7082,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4490,12487,0,0,0,0,0,0,0,36615,0,0,
-0,14854,0,0,0,0,0,0,0,0,0,0,0,0,6539,13029,9704,38983,0,0,0,0,168,10405,0,0,0,0,
-394,25607,0,57063,0,0,0,0,0,0,0,0,0,0,16141,19878,0,0,0,0,0,0,0,0,0,29446,0,
-12036,0,0,0,0,0,6982,18572,0,24584,14535,0,0,0,0,0,0,0,0,0,0,16,0,21642,0,0,0,0,
-0,0,5254,0,0,0,0,0,0,0,0,1622,0,0,0,0,0,0,0,0,0,0,0,0,0,3853,9126,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,7241,10982,0,0,0,0,0,0,0,0,0,0,0,0,0,0,950,0,0,57990,0,0,277,0
-,0,0,694,36007,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,42470,0,0,0,0,18409,
-51142,0,0,0,0,0,0,0,0,0,28646,0,0,0,30693,0,0,0,0,0,56295,5544,0,0,0,0,8518,8366
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,45670,0,0,
-9608,33062,0,0,0,0,0,0,0,0,0,0,0,18694,0,0,0,0,1672,23493,0,0,6955,7655,0,36134,
-0,0,0,0,0,0,0,0,23432,647,0,0,0,0,0,0,0,0,0,0,0,13382,0,0,0,19621,0,0,0,0,0,0,0,
-0,0,20228,0,0,2728,31495,0,0,0,0,29096,22213,235,35495,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,5348,0,0,0,0,8968,1989,0,0,1066,0,0,11492,5965,31367,0,0,0,0,0,0,0,0,0,0,0,
-18727,0,0,0,6757,0,0,10765,4646,0,36166,0,27943,0,0,26888,8420,0,0,0,0,0,0,0,0,0
-,29316,0,0,0,0,0,0,0,0,0,0,4975,0,0,0,14762,3111,0,0,0,0,0,43399,0,0,0,0,0,0,0,
-18980,0,0,0,0,0,44550,0,0,0,0,4051,0,0,0,0,37734,0,0,0,0,0,5188,0,0,0,0,0,24486,
-0,5989,0,41159,0,0,0,0,0,0,0,0,0,20326,0,0,747,6884,0,0,0,41798,0,0,3117,22919,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21032,0,0,0,0,0,0,0,0,9574,0,0,0,0,0,0,
-4302,0,0,0,0,0,0,0,0,0,0,0,21068,34630,0,0,0,0,0,64071,0,0,0,0,0,0,26667,7943,0,
-0,0,0,0,52934,0,0,17002,0,0,0,0,0,0,20294,0,0,0,0,0,0,0,0,0,27301,18347,7974,0,0
-,0,0,0,0,0,0,16874,0,0,0,0,45414,0,0,0,0,0,0,648,1575,0,0,0,31749,0,0,0,23301,0,
-0,0,0,0,0,0,0,0,0,0,0,15912,50535,0,0,0,0,1993,8582,0,0,0,0,0,0,0,38438,0,0,0,0,
-0,0,0,0,0,0,0,0,15850,6183,0,0,0,0,3402,0,0,27494,0,0,749,0,0,0,0,0,0,0,26025,
-29606,0,0,7144,19622,30504,0,0,0,0,0,0,0,0,21316,0,0,0,0,0,0,0,0,0,21444,0,0,
-1289,6919,0,0,0,0,0,0,8299,0,0,0,14090,35655,0,0,0,0,0,0,0,0,2377,15206,0,0,6028
-,4452,0,25508,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,50310,0,0,0,0,1269,0,0,0,0,0,0,0,0,0
-,0,0,0,51014,0,0,0,0,0,0,0,9286,0,7429,0,0,28393,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,16680,452,0,0,0,0,0,23718,0,0,0,31750,0,0,0,0,0,0,0,0,3568,0,0,13604,0,0,
-0,0,0,25255,0,0,0,50982,0,56582,0,0,7467,0,0,0,0,30181,0,0,0,0,0,0,0,30564,7208,
-7845,0,0,0,0,0,0,7726,0,0,0,0,62182,0,0,0,41094,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,22695,0,0,0,0,0,0,17736,0,0,0,0,0,0,0,0,50054,0,0,0,14180,0,0,0,0,
-0,0,8974,0,0,0,0,0,0,0,0,23332,0,0,0,11140,0,0,0,0,0,0,0,24262,27145,9540,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,26537,45510,6062,3879,0,0,20233,25991,0,0,17803,0,0,0,0,0,
-13962,5508,16971,27013,7437,31494,0,0,0,0,0,0,0,0,0,0,4714,0,0,0,0,0,0,0,0,17189
-,0,0,0,0,0,27492,0,0,26953,0,0,0,0,0,0,0,0,0,0,41319,0,0,0,0,0,0,0,0,0,0,0,47430
-,19596,12549,0,0,0,8390,1006,0,0,0,0,0,0,0,0,0,0,24100,17577,4,0,0,0,0,0,22277,0
-,0,0,0,0,0,0,26692,0,0,0,0,0,24676,0,0,0,0,0,0,0,0,0,0,0,0,0,29477,0,0,0,21573,0
-,0,0,0,0,0,0,0,0,0,9864,14214,0,0,0,0,0,0,25771,5766,0,0,8909,8679,0,0,6861,
-16166,0,38887,0,0,0,0,0,0,12392,8678,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-52646,1354,2950,0,14692,0,0,10572,49830,0,0,0,0,0,0,0,0,3626,582,0,0,0,55750,0,0
-,0,30885,0,0,0,0,0,0,0,0,0,0,0,0,0,5830,0,0,2090,0,0,0,0,0,0,0,0,0,0,0,0,31142,0
-,0,0,0,0,10503,0,0,18825,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-57158,0,0,30792,63526,0,0,0,9863,16267,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,18824,0,0,0,0,0,0,19653,25388,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9292,0,0,0,0,0,0,0,0,0,0,36358,0,0,0,0,0,0,0,0,
-0,0,25480,23015,0,0,10440,6725,0,0,0,22436,24265,15109,0,0,0,62311,8906,34534,0,
-0,0,0,0,0,15913,1319,0,0,20296,1477,30760,0,25928,16772,0,0,1069,0,0,0,0,0,0,0,0
-,0,0,0,0,17029,0,31909,0,0,0,0,0,0,0,0,0,0,0,41638,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,41542,0,21478,0,0,0,9796,0,0,0,0,0,0,0,0,0,0,22187,58343,0,0,0,24295,0,
-0,0,0,0,61831,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2833,5829,0,0,0,62855,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,16676,0,0,0,0,0,0,13577,27431,0,0,0,0,21480,10501,0,16932,
-0,0,0,0,0,22918,0,48294,2574,2150,0,0,0,0,1897,4518,0,0,0,0,0,0,25064,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,47942,0,0,0,0,10990,13767,
-25705,37863,21672,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,43430,1712,0,0,0,0,
-18886,0,0,0,0,0,0,0,0,0,0,0,0,0,10535,0,0,0,0,0,0,0,15012,0,0,0,0,0,0,0,0,0,0,
-14734,0,0,55782,0,0,30824,10886,0,0,0,0,0,51302,0,0,8012,0,0,0,0,0,20680,6981,0,
-57415,11,0,0,18277,0,14564,0,0,0,32390,0,0,0,0,0,0,0,0,0,0,0,0,19113,5158,0,
-11172,0,16774,0,0,0,0,0,0,0,0,0,0,0,0,10315,13830,0,0,0,0,0,0,10410,7141,0,0,0,0
-,0,18116,0,0,0,44615,15403,13958,0,1540,14632,19525,24201,19781,0,0,0,24165,0,
-38951,0,0,0,0,0,6308,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17416,15749,3438,13255,0,0,0,0,
-0,0,0,0,0,0,0,32228,0,0,0,0,176,0,0,50566,0,0,0,0,0,0,0,0,0,0,0,0,0,21540,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,58982,0,0,0,0,0,0,0,0,0,5284,0,0,0,0,0,0,25897,28326,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15945,0,0,0,9804,293,0,0,0,0,0,0,0,13988,23082,4677
-,0,0,0,0,0,0,0,0,0,0,0,5670,0,0,0,0,0,0,0,44070,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,6405,0,30692,0,0,0,61702,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,45926,0,15398,0,0,0,0,0,0,4554,2692,0,0,0,0,0,32485,0,0,0,10084,0,0,0,0,0,0,
-24297,0,0,0,0,0,0,0,0,22790,0,0,0,55110,0,0,0,0,0,0,0,0,0,0,0,0,7112,0,31530,
-45255,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,40743,17226,22599,0,
-0,0,0,0,0,0,0,3695,0,0,0,0,0,0,0,0,0,0,56999,0,0,0,0,0,13799,3114,21287,1353,
-7591,0,0,0,8455,0,0,6824,0,0,0,0,0,0,0,14569,0,0,0,29000,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,19979,0,18376,0,0,0,0,0,0,0,0,0,0,0,0,11332,0,0,0,49863,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,2191,7527,23148,58022,0,0,0,30631,0,26565,0,0,0,0,0,0,0,0,0,0,0,0,754
-,0,0,15877,0,0,0,0,0,0,0,17510,7657,2821,0,0,0,0,0,0,0,0,0,41927,0,0,0,0,0,0,0,0
-,2569,34439,0,0,3790,0,0,0,15339,8775,0,0,0,0,0,0,0,0,0,0,0,15908,0,0,21419,8359
-,0,0,0,0,424,0,0,0,0,0,0,25318,8008,20551,0,0,0,45735,30058,30372,0,0,0,0,0,0,0,
-0,0,0,0,0,0,26180,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,31432,10567,0,0,0,0,
-17450,0,0,0,0,0,0,30310,0,38022,0,0,0,0,0,28932,0,0,0,0,0,43910,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,22180,12075,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22247,0,0,22826,
-12359,0,0,0,0,4105,50407,0,0,0,0,0,0,13581,28583,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,28936,0,0,0,0,0,17673,10310,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,905,57862,
-1580,0,0,0,0,58630,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13479,0,0,
-14153,13286,0,0,9259,0,0,0,0,0,6606,3524,0,0,0,0,0,6567,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,631,49255,0,0,0,0,0,42886,0,38215,0,0,0,0,0,0,0,0,17580,
-0,0,0,0,0,0,0,0,55046,0,0,0,0,0,0,0,0,0,10213,0,0,0,0,3604,37767,0,0,0,0,0,0,0,0
-,0,0,0,30950,0,0,0,0,0,0,0,0,0,62087,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23528,0
-,0,0,0,0,0,0,0,0,28715,4229,0,0,0,0,0,0,0,0,0,0,1226,26820,0,0,0,12133,6984,261,
-21130,32548,0,0,0,0,0,0,3565,12390,20713,28071,0,0,1706,25287,0,0,0,0,0,0,0,0,
-14670,0,0,0,0,0,0,30534,0,0,0,12615,0,43750,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28228,
-0,0,0,0,0,0,0,45095,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1224,3975,10954,6375,0,0,0,0
-,0,0,0,0,0,0,23180,20100,0,0,0,0,25736,8519,0,0,0,0,0,6663,0,2534,0,0,0,0,0,0,0,
-0,23720,0,0,0,0,0,0,0,0,0,0,19398,0,47814,26281,49702,0,0,4332,12965,0,0,5704,
-3206,0,0,0,0,0,0,0,0,0,0,0,0,0,15396,0,0,0,44102,0,0,0,0,0,0,0,0,0,0,0,0,0,25317
-,1064,39271,27433,0,14952,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14308,0,0,0,0,0,0,2763
-,4100,0,0,0,0,0,0,18792,0,0,0,22154,32583,0,6244,0,0,0,0,0,0,0,49478,0,0,0,0,0,0
-,0,0,0,0,0,21894,0,0,11048,0,0,0,0,0,0,11685,0,53862,0,0,15114,0,13870,0,0,0,0,0
-,0,0,919,0,0,0,31916,0,22570,101,0,0,0,0,0,0,0,0,0,7333,0,0,0,0,3272,0,0,0,0,
-27718,32712,0,0,0,0,0,0,0,0,0,1782,0,3688,0,0,0,0,29862,0,0,0,0,0,0,0,22469,0,0,
-0,0,0,0,0,55302,850,15492,0,0,0,5927,19786,13350,0,25702,0,0,0,0,0,0,0,0,0,0,0,
-40390,0,0,0,0,0,0,0,0,0,0,0,0,0,20260,0,0,0,0,0,0,0,0,0,0,0,0,0,15335,8394,0,0,0
-,0,0,0,26566,0,0,0,0,843,2245,0,0,0,0,0,0,0,0,6959,0,20488,1638,0,0,11533,50759,
-0,0,0,0,0,20871,0,0,0,0,0,24519,0,0,0,0,9544,23591,0,0,0,0,0,0,0,0,0,0,20969,
-7109,29001,0,0,32422,31720,64294,0,0,0,0,16106,0,0,0,6930,4933,0,0,0,22917,0,
-27015,0,0,0,0,19880,8070,0,0,0,0,23945,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-3310,0,87,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18439,0,0,0,20742,0,0,0,10597,0,0,0,0,0,0,
-0,0,0,0,0,0,20236,0,0,0,16584,3429,0,0,0,0,0,0,0,0,27241,0,0,0,0,16132,0,0,0,0,0
-,0,0,0,0,0,0,0,244,28261,0,0,0,0,0,0,0,29509,0,0,0,0,0,0,0,0,2921,31781,0,0,0,0,
-0,0,6408,4196,344,0,0,0,0,0,0,0,0,0,0,0,0,0,11689,45863,0,0,0,0,906,3301,0,0,
-25544,32421,0,0,0,0,0,0,0,0,1260,61607,0,27302,0,0,8682,16614,0,0,0,0,10830,0,0,
-9604,15049,13413,0,0,0,0,0,0,26761,0,0,0,0,0,0,61990,0,0,0,0,0,12580,0,0,11432,0
-,0,0,0,0,22507,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12389,0,0,0,0,0,0,
-2408,22661,14507,43239,0,9700,0,0,24714,0,0,0,0,0,0,0,0,23972,0,0,0,0,0,0,0,0,0,
-0,0,0,0,34086,0,0,22955,7238,0,0,0,0,0,28485,13806,20038,0,0,0,0,22602,0,0,0,
-1645,22340,0,0,0,0,0,0,0,0,0,0,0,26502,0,0,554,0,0,0,0,61735,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,2694,0,0,0,0,0,0,0,0,0,0,0,0,0,0,883,27879,15948,0,3242,57382,0,0
-,0,0,0,0,13930,0,0,0,0,0,30922,0,4137,52615,0,0,0,0,0,0,0,0,0,0,0,0,0,31911,
-16072,0,0,0,0,0,0,0,0,0,0,0,0,26340,0,61671,0,0,0,0,3145,56199,0,0,0,0,0,0,0,0,0
-,0,0,0,280,0,5131,33479,0,15751,0,0,0,0,0,0,4136,1446,0,0,0,0,0,0,11304,17863,0,
-0,0,0,0,25125,0,0,0,36646,6057,0,0,0,855,11301,0,0,0,0,0,64774,0,0,0,19397,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,1040,27367,0,0,0,0,0,0,0,0,0,0,0,0,0,64358,0,0,178,
-132,0,0,14763,24455,0,0,0,46374,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,46246,0,0,0,37382,
-0,0,0,7462,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8166,0,0,6921,0,0,0,9163,0,0,0,119,
-0,0,0,23146,17156,0,0,0,0,0,9127,0,0,0,17927,0,0,0,0,0,22084,0,0,0,0,0,39879,0,0
-,2035,0,1067,0,0,0,0,0,16652,59591,0,0,0,0,0,0,0,0,0,0,0,0,20171,0,0,0,0,17733,0
-,0,0,0,0,32037,0,0,0,0,0,14277,0,0,0,0,0,0,0,42022,0,0,26793,20358,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,8907,0,0,0,0,0,0,0,0,27780,0,0,0,0,32330,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,39399,0,9732,0,16199,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,854,0,2984,45063,25418,26980,22539,0,9133,3653,15528,28743,4649,0,616,
-65127,0,0,0,61863,0,0,0,0,0,0,0,55303,0,0,0,0,0,0,0,0,23880,0,0,0,0,0,0,0,31848,
-62854,0,0,0,0,0,0,0,0,0,0,0,49606,0,27974,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,32580,0,0,0,26052,4043,0,0,40454,0,0,26056,30565,0,0,0,0,0,0,0,31398,0,0,0,0
-,0,0,0,0,29288,1797,0,0,3220,0,0,0,0,0,0,0,0,0,20427,0,0,0,0,23621,0,0,0,0,0,0,0
-,0,0,24261,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35591,0,0,6862,0,0,0,4265,0,6285,
-5383,0,0,0,0,0,36870,0,39847,0,0,17224,5414,27882,58118,0,0,13224,4262,0,0,0,
-31302,0,0,1388,2982,11881,0,0,0,0,0,0,16837,809,0,24140,10724,0,0,0,0,5835,0,0,0
-,0,0,0,0,0,0,0,0,1256,19237,0,0,0,0,0,0,0,5796,11848,0,0,52870,11464,0,0,0,0,0,0
-,0,0,0,5645,9158,0,25223,0,0,0,0,0,39142,24968,8135,32104,28678,0,0,0,46311,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23820,0,0,0,0,0,4050,0,1323,25220,0,0,0,20133,0,
-0,0,0,0,0,0,0,0,0,0,9381,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,13444,1198,60806,0,0,0,0,17356,50247,30632,0,0,0,0,0,0,0,11944,
-999,0,0,0,0,4010,10404,0,0,0,0,0,0,10346,0,0,49510,0,0,0,0,0,0,0,0,0,0,0,0,0,
-38919,0,0,0,0,0,0,6351,60966,20137,487,0,0,0,0,0,0,655,2406,17387,43303,0,0,0,
-17063,0,0,213,0,0,0,0,0,0,17221,0,0,0,0,0,0,0,0,0,0,0,10820,0,0,0,0,369,6,0,0,
-9098,21093,0,31653,0,0,0,0,0,0,0,0,0,27143,0,0,16234,0,0,0,0,0,0,0,0,6020,31723,
-28293,0,0,0,0,1936,30695,0,0,0,0,0,52902,0,0,29512,10791,0,20420,0,0,16010,0,0,0
-,0,0,0,0,0,0,0,0,5324,0,0,0,0,0,0,0,0,0,0,0,0,13383,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,24328,0,0,0,0,0,0,40870,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,24648,0,0,0,0,0,0,0,7786,2852,0,0,0,0,0,0,0,0,0,44678,0,17925,0,0,105,53062,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18762,0,0,40679,0,0,0,16165,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,20390,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,62310,1322,
-14247,0,0,0,0,0,0,0,0,1832,6052,0,0,11882,0,0,0,0,17668,0,28262,0,29542,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28007,0,0,0,57223,
-1585,0,0,0,0,0,0,0,0,0,0,0,21162,0,0,62247,0,0,0,0,0,25414,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,36326,0,0,0,23845,0,0,0,0,0,0,0,2693,0,0,0,0,0,0,0,
-13125,0,31236,0,0,0,0,0,22502,0,0,0,0,0,0,5994,10309,0,0,0,7269,0,0,0,0,17929,0,
-1011,44647,0,0,0,0,0,14919,0,0,0,0,20586,5350,0,0,0,45702,0,13189,0,0,0,0,0,0,0,
-0,0,35782,17992,0,0,0,0,0,8203,0,0,0,0,0,0,56678,0,0,0,0,0,38087,4233,0,2127,0,0
-,0,0,0,0,0,0,0,0,10148,0,0,0,2021,0,0,0,0,0,0,0,47206,0,0,0,0,0,0,0,9220,0,0,0,0
-,19465,0,0,0,0,0,0,0,0,39206,0,38055,0,0,0,0,0,0,0,46982,0,0,0,0,0,22054,3850,0,
-0,0,0,0,0,0,55,0,10542,0,0,0,0,7239,0,0,0,0,0,59367,0,0,14761,0,0,0,0,43079,0,0,
-0,0,0,2726,0,0,9582,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,37478,0,
-0,0,31364,0,0,0,0,0,0,0,0,20393,8933,0,0,0,0,0,9380,0,0,0,0,16905,549,0,0,0,0,
-182,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1558,0,0,0,0,0,0,0,19242,0
-,0,0,0,0,0,24933,0,6276,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,42310,23595,
-24068,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13191,6158,2567,0,0,268,47047,0,0,0,0,0,0,0,
-0,0,27940,0,0,0,0,0,26726,0,0,0,0,8200,1222,31562,0,0,0,0,0,0,0,0,0,2922,8231,
-8904,29157,0,0,0,0,0,0,0,0,23976,4836,0,0,0,0,0,0,0,0,0,0,0,0,31658,0,0,31685,0,
-0,2889,6213,0,0,0,0,0,13605,0,0,0,0,0,24772,0,0,0,0,0,0,0,0,0,0,20684,26468,
-24075,0,0,0,21193,0,715,679,0,0,0,0,0,0,3050,7654,0,0,0,13798,0,0,0,0,15,27973,0
-,0,8491,2086,0,0,0,43206,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,60391,0,0,0,0,0,0
-,0,25892,0,22276,0,34374,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20165,0,0,25672,0
-,0,0,1811,24839,0,31044,0,0,25513,0,0,0,0,0,12810,0,0,62438,0,0,1325,0,364,3782,
-0,0,0,0,0,0,0,0,8042,19687,0,0,0,33415,0,0,0,0,0,0,0,0,0,0,0,7205,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,11844,0,0,0,0,3341,1543,6698,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,29766,0,0,0,0,0,0,0,0,0,0,0,41158,0,24294,0,3844,12329,
-0,0,0,13738,0,0,0,0,0,0,0,0,26245,0,0,0,0,0,0,6378,0,343,4838,0,0,0,24358,11688,
-0,0,0,0,0,0,0,0,0,1489,34759,0,0,0,0,363,51974,1878,11013,0,0,32265,59782,0,0,0,
-28421,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22756,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14089,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,29257,61222,0,30661,0,28327,0,0,0,0,0,0,0,0,0,0,0,0,0,
-27108,8843,0,9673,2084,0,0,0,16327,0,48455,0,0,0,0,0,0,4876,9316,0,0,0,0,0,0,0,0
-,0,0,0,0,9035,18852,0,0,0,0,0,0,0,0,0,0,0,0,0,4164,0,0,14827,1349,0,0,0,0,0,
-11909,0,0,0,0,0,0,0,0,0,21765,0,0,0,0,0,0,0,0,31272,63910,0,0,0,25924,0,0,0,0,0,
-0,0,0,0,44487,0,0,0,20612,0,0,27754,31428,0,0,0,0,0,0,0,17287,0,3943,0,0,0,63302
-,0,0,0,0,25256,19942,0,55142,0,39046,0,0,0,0,0,0,0,15367,0,0,0,0,0,0,0,0,0,0,0,
-28422,0,0,0,0,0,0,0,0,0,0,0,0,9576,63847,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,25226,5734,0,0,0,0,0,0,13801,4997,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,43942,1270,2566,6284,0,0,16230,0,0,0,20678,0,0,0,0,0,38855,0,0,0,0,
-29643,0,0,0,41,3655,0,0,0,0,0,14276,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,15686,0,0,0,15718,0,50694,0,0,16232,8007,0,0,0,5060,
-329,11591,51,0,0,0,0,0,0,0,0,0,13065,7302,27530,15366,0,24934,0,0,0,17828,0,0,
-4552,6311,0,0,0,0,0,0,0,0,0,0,0,47686,368,12103,10122,33830,0,0,599,18534,9579,
-49479,0,5668,0,0,0,0,0,0,0,0,0,13157,0,0,0,0,23274,14055,0,0,0,0,0,48903,0,0,0,0
-,0,0,1871,0,15434,0,0,0,16174,62470,0,0,0,0,0,0,0,0,0,0,0,7749,0,0,0,0,0,0,0,
-30501,0,0,0,0,25675,0,0,0,0,0,0,0,0,0,0,9285,0,0,25323,1669,0,0,0,0,0,0,0,0,0,0,
-0,3588,0,0,0,0,0,32902,0,0,4426,0,0,0,0,57959,0,0,0,0,0,0,29898,58278,0,0,0,0,
-11880,1220,0,0,0,41479,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23141,0,0,0,0,0,0,0,0,0,0,0
-,0,0,42566,0,0,0,0,0,0,0,40167,9484,3493,0,0,0,0,0,21126,0,0,0,0,8649,18918,0,0,
-0,0,0,0,0,34886,2601,0,0,0,0,12518,0,0,0,0,7976,10311,0,0,0,0,0,0,0,45190,0,0,0,
-0,0,0,0,0,0,0,16842,20229,0,0,0,0,0,0,7528,4614,0,0,0,0,0,30086,0,0,0,1671,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,9896,6277,0,0,0,0,0,61191,0,41287,0,21956,0,0,20010,0,0,0
-,0,0,0,0,0,0,0,0,13195,0,0,0,0,1381,0,0,0,0,365,30951,24268,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,7044,0,0,0,0,0,0,0,0,0,0,27944,359,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,28487,0,0,77,0,0,0,0,0,0,0,0,56775,12586,8421,0,0,0,0,0,0,26185,14599,0,0,
-8040,5702,12585,3109,0,0,0,0,0,21574,5388,0,0,0,0,0,0,0,5106,52454,0,0,0,0,0,0,0
-,0,1907,29895,0,6116,0,0,0,0,11081,5285,0,28069,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4104
-,0,0,0,0,0,0,41511,0,0,0,0,0,0,5262,0,0,0,503,4231,7720,34343,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7304,10374,1718,0,0,29127,0,0,0,0,0,0,0,0,23497,
-22567,6952,2340,0,0,0,0,0,0,0,0,20360,12453,0,45094,0,0,0,0,0,28582,0,0,0,0,680,
-0,0,0,0,0,0,0,0,0,0,0,0,0,23084,0,0,0,30696,0,0,0,0,45862,0,0,0,0,0,0,0,0,0,0,0,
-0,5580,6053,0,0,0,0,0,0,0,0,0,0,712,70,0,0,26091,11335,0,0,0,0,13612,0,13160,
-1926,435,51559,0,0,0,0,0,0,0,0,0,0,0,0,0,47302,19083,0,0,12742,0,1607,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,6155,37095,0,0,0,0,0,18948,7146,0,0,0,0,0,0,0,7848,
-2055,0,0,0,0,8910,0,19336,0,0,48070,8490,0,0,0,0,0,0,0,9932,56423,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,4133,0,0,0,0,0,0,0,0,0,43398,0,0,0,0,0,0,0,0,16173,0,0,0,0,0
-,0,0,32011,0,0,30918,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26854,0,0,0,0,0,0,0,0,0,0,0,0
-,0,20389,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18889,0,0,0,0,8965,0,0,0,44358,0,0,0,8997,0
-,34055,0,0,0,0,0,29350,0,0,501,17767,0,0,32457,60262,0,0,0,30886,0,0,3757,1063,0
-,0,0,25637,0,0,0,0,0,28068,0,26374,0,0,0,0,0,0,0,0,0,0,0,11684,0,0,0,0,0,0,24779
-,229,0,13766,0,0,7402,11525,0,0,0,0,0,0,0,0,26313,23686,0,0,29736,47527,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27268,0,0,0,0,553,0,0,0,0,0,0,32038,0,0,0,0,1135,
-26596,0,0,12300,14631,0,0,0,43238,0,871,0,0,31496,0,8457,17669,0,12836,0,0,0,
-22726,0,38758,0,0,375,6564,0,0,0,0,0,0,0,0,0,0,0,0,170,18535,0,22948,0,0,32360,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,25764,0,0,0,0,0,0,0,0,0,0,0,15652,0,0,0,32774,0,0,0,0
-,0,0,0,0,0,28551,0,0,0,0,0,0,0,0,0,0,0,0,15145,0,0,0,21100,27654,0,0,0,0,0,0,
-4874,26215,0,1639,0,0,0,0,0,0,0,0,0,0,4169,0,0,0,0,0,7336,0,0,0,0,21572,0,0,0,0,
-0,0,0,0,0,24644,1675,2533,0,0,0,53318,0,13094,0,0,0,0,0,0,0,6246,0,22020,0,0,0,0
-,0,0,0,0,0,0,0,28453,5576,5124,0,0,0,0,0,0,0,0,0,0,0,0,0,27910,0,29382,18216,
-8583,0,0,0,39174,0,43558,0,0,0,0,0,0,0,0,0,11973,0,0,0,0,0,23397,0,0,0,0,6091,0,
-0,0,0,0,0,0,6474,16197,14217,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,26728,0,567,48839,0,0,0,0,0,15271,0,0,31818,43974,2450,0,0,0,0,0,0,0,
-11368,9191,0,44454,0,0,0,0,0,0,14568,12293,0,0,0,8453,0,0,0,0,0,0,0,0,0,0,0,0,
-32040,0,0,0,0,0,0,0,0,0,0,0,0,902,0,0,0,27236,5612,11495,0,0,0,0,0,0,0,0,9194,
-23684,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27430,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-26217,44870,0,0,0,0,0,0,5581,7173,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-52775,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20968,18340,0,0,0,0,0,0,0,0,4107,11239
-,0,0,0,0,0,0,0,0,0,0,0,29381,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,21990,0,0,0,0
-,0,0,0,0,0,48806,0,0,0,32292,0,0,0,0,0,0,0,10884,0,0,0,0,0,0,0,0,0,0,27562,0,
-5643,0,0,0,0,0,0,0,0,0,3089,31525,0,19684,0,0,0,0,0,0,0,61415,0,0,0,0,0,36198,0,
-0,0,0,0,0,0,7908,0,0,0,0,872,743,0,0,0,0,0,0,0,0,1229,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,32484,0,0,0,0,0,34822,0,0,0,0,0,50726,0,0,0,0,7274,0,0,0,15304,
-11526,0,0,0,3047,0,0,0,0,0,0,22376,0,0,0,846,0,0,0,0,35815,0,0,0,23652,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,23721,2148,0,0,0,0,0,0,14856,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,1358,0,3082,0,0,0,848,10949,0,0,0,0,0,0,6504,0,0,14372,0,0,0,0,0,0
-,0,0,0,0,8201,9958,0,0,0,0,0,0,24266,0,0,0,0,0,0,0,0,26469,0,0,0,0,18604,2053,0,
-33511,0,0,0,0,0,9222,0,0,0,0,0,44006,0,0,0,0,0,0,0,0,0,0,0,41895,0,0,0,0,0,0,0,0
-,12044,390,0,0,0,0,0,4935,0,48646,0,56102,3052,16070,0,0,0,0,0,0,0,8612,9320,
-38311,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,500,0,0,0,0,42918,0,
-32550,0,0,0,0,0,0,0,0,27434,57926,17064,0,0,46502,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,26760,6756,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,624,0,5000,0,0,0,0,32293,0,
-0,0,0,0,0,0,0,0,0,0,0,0,26246,0,0,0,0,0,0,0,0,23,7301,0,0,0,36199,0,40838,0,0,0,
-0,0,0,0,0,0,0,0,0,27178,57350,0,0,12457,9317,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16810,0,0,0,14510,0,0,0,0,21319,0,0,0,13508,17,
-11365,0,0,0,0,5291,0,8329,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27685,0,0,0,0,0,0,0,
-52006,0,0,0,7493,0,44263,0,0,0,0,0,0,0,0,9800,0,0,0,25676,61478,0,0,0,0,0,0,5773
-,0,0,0,0,41991,26057,0,0,0,0,0,0,0,0,0,0,22629,0,0,0,47783,362,1959,23468,0,0,0,
-10921,0,0,0,3150,0,0,0,0,0,0,0,0,0,0,0,32456,0,0,0,0,0,0,0,4559,3270,0,0,983,0,0
-,26343,0,33446,0,0,0,61767,0,48390,0,0,0,0,0,0,0,2790,0,39782,7849,0,0,0,0,0,0,0
-,1544,2183,0,0,0,0,0,0,0,0,4040,2471,20009,30020,0,0,11242,0,0,0,5578,53382,0,
-22631,0,0,0,0,0,0,0,0,0,0,0,12901,0,0,0,0,0,0,0,0,0,0,0,0,215,0,0,9030,0,0,0,0,0
-,0,265,1412,0,0,11626,3687,0,0,0,0,0,0,0,0,0,0,0,0,17449,24359,0,0,26729,40134,0
-,0,0,0,29768,61958,0,0,0,0,0,0,0,0,20908,0,0,0,0,0,11016,0,0,47462,21547,5926,0,
-0,14728,2983,24104,15301,0,0,0,0,0,32645,0,0,0,0,0,0,0,3300,0,0,0,15972,0,0,0,0,
-0,0,6634,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3076,0,30983,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,106,0,0,0,0,12775,0,0,0,0,7177,18022,0,0,0,0,0,22534,0,0,0,0,0,0,0,0,0,0,0,
-49894,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27560,0,0,0,0,30278,10668,23877,0,
-0,0,0,0,0,0,29124,0,0,0,0,0,0,0,0,0,0,0,0,0,20870,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,44582,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,48454,0,0,0,0,6442,0,16330,22951,0,0
-,16904,0,0,0,0,644,0,0,0,40038,0,0,0,37222,0,0,0,9830,0,0,0,0,0,34919,0,0,0,0,0,
-0,0,0,0,0,0,13733,0,0,0,28196,0,0,0,0,0,19876,0,0,0,0,0,0,0,23558,0,11142,0,
-27781,0,0,0,0,13864,0,0,0,24682,47847,0,0,0,0,6890,0,0,0,0,0,3981,0,0,0,0,0,0,0,
-0,0,0,0,1772,0,0,0,0,0,0,0,3603,1991,0,27396,8652,0,18312,0,0,0,0,30054,0,0,0,0,
-0,0,0,11270,0,0,0,0,0,0,0,0,0,20708,0,0,0,0,338,0,0,0,0,0,0,0,7050,0,0,0,0,0,0,0
-,0,0,0,0,0,0,14862,0,0,3492,0,0,0,55878,0,0,0,16486,0,0,0,18119,0,0,0,0,0,0,2154
-,1284,0,0,23113,31751,0,0,29547,0,0,0,0,0,0,36647,0,0,0,0,0,0,0,0,0,0,0,18183,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,7913,0,0,0,0,20644,0,0,10508,0,0,0,0,0,0,0,0,0,0,0,0,
-43622,0,0,0,0,0,40966,0,0,0,0,0,0,0,0,0,0,246,901,11529,5191,0,0,0,0,0,0,0,0,0,0
-,0,24454,0,0,26665,27590,0,27397,0,0,0,0,0,0,23562,2949,0,0,30344,62214,0,47334,
-2026,18885,0,0,0,48678,0,0,0,22694,0,0,1972,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,15465,0,0,0,0,38822,0,0,0,0,945,32708,0,54791,0,14918,0,0,0,0,0,0,
-0,0,0,0,0,0,0,23396,0,0,0,0,0,0,5486,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7722,0,0,
-0,0,0,0,0,0,0,0,0,30856,64166,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35206,0,0,0,30535,0,
-0,0,0,0,0,0,0,0,62663,0,0,1096,17574,31820,0,0,14375,4402,27207,0,0,21448,4676,0
-,0,0,0,16585,5094,0,0,0,0,0,0,0,0,4845,0,0,32870,0,0,0,0,0,0,0,0,0,0,31466,0,0,0
-,0,31783,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4522,16039,0,0,0,0,0,0,0,0,
-0,14469,0,0,0,0,0,0,0,0,0,0,7464,4773,0,0,0,0,0,0,0,0,18636,0,0,0,25640,0,0,0,0,
-0,0,2244,0,0,11818,0,1168,0,0,0,0,0,0,0,6540,23079,13770,7719,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,58150,528,
-34502,32682,0,0,12997,0,0,0,0,0,2214,0,0,0,0,0,58567,0,0,0,26375,0,0,0,0,0,0,0,0
-,0,26437,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26121,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,32005,22952,59047,0,13543,0,0,0,0,0,0,0,0,16328,0,0,33542,0,0,0,19782,0,0,0,
-16644,0,0,0,0,31688,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10276,0,0,0,
-0,0,0,0,36327,0,0,29480,0,0,0,777,12709,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27398,0,0,
-0,4455,9037,31397,0,9221,0,0,0,60487,20840,1796,0,0,0,0,0,0,0,0,8364,0,0,0,0,0,0
-,0,0,0,0,0,19752,44902,0,38566,0,0,18027,0,0,0,0,0,0,0,0,10662,0,0,0,0,0,11812,0
-,0,0,0,0,0,0,0,0,19910,0,0,0,45030,0,0,0,0,0,0,0,0,0,0,0,0,19978,5127,0,11620,0,
+BROTLI_INTERNAL const uint16_t kStaticDictionaryHashWords[32768] = {
+1002,0,0,0,0,0,0,0,0,683,0,0,0,0,0,0,0,1265,0,0,0,0,0,1431,0,0,0,0,0,0,40,0,0,0,
+0,155,8,741,0,624,0,0,0,0,0,0,0,0,0,0,0,0,66,503,0,0,0,451,0,0,0,0,0,0,0,835,70,
+0,0,539,0,0,0,0,0,0,0,0,0,113,0,0,0,0,718,0,0,0,0,0,0,520,0,1070,0,0,0,0,0,1515,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,78,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,610,0,0,750,0,0,0,307,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,964,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,999,0,0,0,0,0,0,0,0,
+645,75,0,649,52,282,0,200,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1621,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,211,225,0,0,687,718,0,0,110,0,58,0,0,0,0,0,0,345,0,0,301,0,0,
+0,203,0,0,1154,674,1949,0,0,0,0,0,0,0,0,0,259,0,0,0,0,0,0,0,1275,0,0,0,1231,254,
+0,0,0,0,0,0,0,277,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,248,0,0,800,0,0,0,29,
+116,100,490,0,0,0,0,0,1641,0,543,0,0,0,0,41,181,0,657,0,0,202,25,0,0,0,0,0,0,0,
+0,0,0,423,0,0,0,113,0,0,0,927,963,0,976,0,206,0,0,0,0,0,0,0,0,0,2002,0,0,0,0,0,
+0,0,0,0,0,0,696,0,1170,0,0,0,0,226,13,0,769,678,551,0,0,0,0,0,0,57,0,0,0,10,188,
+0,0,0,624,0,0,0,0,0,0,0,0,0,1941,130,0,0,0,0,378,269,0,0,528,0,1146,0,0,0,1105,
+0,1616,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,656,0,1940,0,0,0,0,0,173,0,0,0,0,0,0,0,0,0,
+0,0,457,342,810,0,0,0,0,620,0,0,0,0,0,0,0,967,95,447,406,0,0,0,477,0,1268,944,
+1941,0,0,0,629,0,0,0,0,0,375,0,0,0,1636,0,0,0,0,774,0,1,1034,0,0,0,0,0,824,0,0,
+0,0,0,118,0,0,560,296,0,0,0,0,0,0,0,0,1009,894,0,0,0,0,0,0,0,0,0,0,0,0,0,1474,
+366,0,0,0,0,0,0,0,0,0,79,1723,0,0,200,0,0,0,0,0,0,0,0,1759,372,0,16,0,943,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,258,0,0,900,1839,707,30,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,2004,0,0,10,115,0,50,0,0,0,0,0,0,0,0,0,0,520,1,0,738,98,482,0,0,0,0,
+0,0,0,0,0,0,701,2,0,0,0,0,0,0,0,0,557,0,0,0,0,0,0,0,0,0,347,0,0,0,0,572,0,0,0,0,
+0,0,0,0,0,832,0,0,797,809,0,0,0,0,0,0,0,0,0,0,0,528,0,0,0,861,0,0,294,0,0,0,109,
+0,0,0,0,0,0,0,0,1187,290,266,0,0,0,0,49,50,748,0,0,466,399,0,0,0,0,0,0,0,378,0,
+519,0,0,0,0,0,0,0,0,0,0,0,0,667,351,902,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,180,
+0,0,869,0,0,0,0,0,0,0,260,0,0,0,0,0,0,0,0,0,0,523,36,0,0,587,510,809,29,260,0,0,
+0,0,0,0,0,0,570,0,565,0,1464,0,0,0,0,0,0,10,0,0,787,399,380,200,0,0,0,0,516,0,
+844,887,0,0,0,0,0,0,0,44,0,0,0,305,1655,0,0,0,0,0,0,0,0,0,0,0,0,0,0,786,10,0,0,
+0,0,0,0,0,0,0,2031,0,0,0,0,0,684,0,0,0,0,0,1480,0,0,0,27,0,0,0,395,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,813,511,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,56,0,0,0,206,
+496,0,0,0,0,0,909,0,891,0,0,0,0,0,0,0,0,0,687,0,0,0,1342,0,0,0,0,0,0,0,0,0,0,
+160,41,0,0,0,0,0,0,0,0,0,0,0,1718,778,0,0,0,0,0,0,0,0,0,0,1610,0,0,0,0,0,115,0,
+0,0,0,314,294,0,0,0,983,178,193,0,0,0,0,0,0,0,0,0,174,0,0,0,0,0,0,0,0,0,0,848,
+1796,0,0,0,0,0,0,221,0,687,1660,0,0,0,0,262,0,0,179,0,0,0,0,0,66,0,773,0,352,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35,0,152,0,0,1197,0,0,0,0,0,0,0,0,0,0,0,0,560,0,0,
+564,0,0,0,797,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,556,0,819,0,0,0,0,0,0,0,0,719,544,
+637,5,0,0,0,0,0,0,0,0,0,0,0,101,0,1441,0,0,0,893,0,0,0,0,0,0,0,0,0,238,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,1296,0,0,969,1729,314,60,0,0,0,0,0,1144,0,1147,0,0,0,0,0,
+0,0,0,0,0,437,1853,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,828,0,176,0,0,0,0,0,0,434,39,0,
+0,0,0,0,159,0,0,0,902,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,270,0,0,0,0,801,556,0,0,
+0,0,0,0,0,416,19,197,369,0,0,0,0,0,0,0,0,0,28,34,0,757,0,0,898,1553,0,721,0,0,0,
+0,1012,0,0,0,0,1102,0,898,183,0,0,0,0,0,0,0,136,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,247,277,0,0,0,435,0,0,0,0,0,1311,0,0,0,0,
+0,0,211,437,0,0,0,28,0,0,750,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2012,0,702,
+0,808,0,0,0,0,739,166,0,0,0,0,0,0,719,170,500,0,0,0,0,0,0,0,0,1500,327,0,0,450,
+0,0,0,1318,0,0,0,1602,0,0,331,754,0,0,0,0,0,1368,0,0,557,0,0,0,799,850,0,0,0,0,
+0,0,0,0,908,0,0,0,0,0,19,62,459,0,0,0,0,0,0,0,0,0,0,0,0,1802,0,0,0,0,0,0,0,0,0,
+1397,0,0,0,0,120,238,0,0,0,0,0,0,0,0,0,0,0,1324,0,0,0,0,0,0,0,0,602,201,0,0,164,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,615,0,0,0,0,0,0,0,0,0,0,0,0,0,1243,0,0,0,0,968,0,0,
+0,0,0,0,882,0,0,0,907,329,100,0,0,0,0,0,0,0,0,0,0,0,176,26,9,0,0,265,256,0,0,0,
+0,0,0,0,0,0,643,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,127,610,0,0,0,0,973,2001,0,
+0,0,0,0,0,522,0,0,0,0,0,0,0,0,0,0,0,553,0,0,0,0,0,0,1582,0,1578,0,0,0,0,0,0,0,0,
+0,0,0,795,0,0,0,432,0,0,0,0,0,0,84,126,0,0,0,0,790,0,377,64,0,1529,0,0,0,0,530,
+1857,539,1104,0,0,0,0,0,0,0,0,0,0,0,0,977,0,0,0,34,0,0,0,0,0,0,0,0,0,0,0,24,26,
+0,0,918,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,183,379,0,0,0,0,0,0,0,792,
+0,0,0,0,0,0,0,0,0,1920,0,0,0,0,0,0,0,0,0,771,0,0,0,1979,0,901,254,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,140,0,0,0,0,0,440,37,0,
+508,0,0,0,513,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,533,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,752,920,0,1048,0,153,0,
+0,391,0,0,1952,0,0,0,0,0,0,0,0,0,0,126,0,0,0,0,640,0,483,69,1616,0,0,0,0,0,734,
+0,0,0,0,0,0,480,0,495,0,472,0,0,0,0,0,0,0,0,874,229,0,0,0,0,948,0,0,0,0,0,0,0,0,
+1009,748,0,555,0,0,0,0,0,0,193,0,653,0,0,0,0,0,0,0,0,0,0,984,0,0,0,172,0,0,0,0,
+0,0,0,0,83,1568,0,0,384,0,0,0,0,0,0,0,164,880,0,0,0,0,0,0,0,0,0,0,0,367,121,0,0,
+828,0,0,0,0,0,0,0,1541,0,0,0,0,0,0,0,343,0,0,0,0,0,0,0,0,561,57,0,0,0,0,0,0,0,
+926,0,0,0,0,827,0,194,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22,0,0,0,0,0,0,0,
+0,0,0,896,1249,0,0,0,0,0,1614,0,0,0,860,0,0,0,0,0,0,0,0,964,102,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,899,0,569,0,0,0,0,795,2045,0,0,0,
+0,0,0,104,52,0,0,0,0,0,604,0,0,0,0,779,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,32,0,0,0,0,
+494,0,677,0,0,0,0,0,0,0,508,0,0,0,0,0,0,0,0,0,1014,0,957,0,0,630,310,0,0,0,570,
+0,0,449,0,64,537,0,0,0,0,0,0,0,244,0,0,0,0,0,0,0,0,0,0,0,0,0,0,702,1650,49,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,338,0,0,0,0,1279,0,0,0,0,0,0,0,896,0,0,
+178,0,0,0,0,0,0,0,0,0,0,0,0,0,808,695,0,0,0,0,539,1117,0,0,0,0,0,0,0,0,257,0,
+1003,0,0,0,1,448,0,516,0,0,960,0,125,4,0,1268,30,748,0,0,852,0,0,0,6,0,0,848,
+236,1385,862,1811,0,0,0,0,698,803,0,0,0,0,0,0,0,610,992,0,0,878,0,1847,0,0,0,0,
+0,0,0,383,0,1404,0,0,0,0,986,0,347,0,0,0,0,0,0,0,0,0,0,0,592,572,0,1411,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,64,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,606,0,0,0,0,0,0,
+0,0,0,0,0,0,0,1829,0,0,0,0,0,0,0,0,0,0,0,0,700,748,0,0,0,0,0,0,365,0,0,127,0,0,
+83,198,0,0,0,0,0,0,864,55,0,0,0,0,726,1752,0,0,0,0,0,0,0,0,0,0,0,0,0,1066,0,764,
+0,0,0,0,683,0,550,309,0,0,874,1212,0,0,0,1364,0,986,381,723,0,0,0,1573,0,0,0,0,
+0,1025,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1559,0,0,0,0,493,133,0,0,0,0,148,
+119,0,0,0,0,0,0,537,14,541,0,635,126,0,0,0,495,0,0,0,0,861,998,1009,0,0,0,0,0,0,
+0,359,368,0,0,0,0,304,1577,0,0,0,0,0,1107,0,0,0,0,0,929,0,0,0,1142,0,0,0,0,289,
+175,0,432,0,219,0,0,0,0,0,785,0,0,595,0,0,0,0,0,0,0,0,0,0,0,0,0,80,0,0,0,0,0,0,
+931,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1323,0,0,0,0,290,0,559,1751,127,0,0,0,
+934,1167,0,963,0,260,0,0,0,573,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+580,1689,0,0,0,0,0,0,0,0,0,1164,0,0,982,1922,0,63,0,0,0,0,0,793,0,0,0,0,0,0,0,0,
+0,0,0,0,0,67,790,0,0,0,0,0,0,0,0,0,0,391,443,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,271,0,0,0,0,0,0,0,0,0,0,0,1140,0,0,0,0,340,300,0,897,0,0,0,0,0,0,
+0,0,0,0,890,0,0,0,0,818,321,53,0,0,0,0,0,0,0,0,0,468,0,243,0,870,0,0,0,1765,121,
+0,0,0,180,518,0,822,419,634,0,0,0,0,0,0,0,0,0,898,0,0,0,0,454,36,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,806,0,0,0,0,0,0,0,0,0,0,0,0,1326,0,104,0,0,0,0,0,0,0,
+0,0,260,0,0,0,0,0,0,0,0,0,0,0,0,542,45,0,0,263,1516,42,0,0,0,0,0,468,0,1005,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,288,87,0,0,0,0,0,0,0,0,502,988,133,0,0,0,0,0,0,
+141,0,0,872,1842,0,0,0,0,0,0,0,0,261,619,0,0,0,0,189,246,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,678,0,0,0,0,0,0,0,0,0,0,0,0,285,35,0,517,0,0,0,0,0,0,0,0,0,0,
+540,214,667,0,74,0,0,125,0,0,0,0,0,761,131,0,0,0,0,0,0,0,0,0,0,0,0,0,333,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1338,94,0,0,0,0,0,0,0,0,0,0,0,0,449,0,646,103,
+86,641,2028,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,869,87,277,117,39,0,0,0,0,0,0,0,0,938,
+297,0,0,0,0,558,464,0,0,0,0,0,0,0,0,0,0,731,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1608,0,
+0,0,0,0,0,0,1429,0,0,733,1010,0,0,338,1656,0,0,0,1038,979,2010,0,0,0,0,0,0,0,
+1005,0,0,121,0,0,0,219,20,0,0,0,0,0,0,872,1440,0,0,0,683,0,1070,0,0,522,0,0,0,0,
+439,669,0,0,0,0,0,0,0,0,1245,0,0,0,0,0,1218,0,0,547,233,0,0,0,0,0,0,0,0,0,482,0,
+0,0,0,0,0,0,886,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,795,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,371,0,0,0,0,0,0,0,0,0,0,0,0,0,622,0,625,0,0,0,339,29,0,0,338,0,0,0,
+0,130,0,0,0,0,0,0,0,0,0,307,0,0,0,0,0,0,0,0,0,0,2044,0,0,0,0,0,0,0,0,308,770,0,
+0,0,0,0,1266,0,0,0,0,0,0,0,0,0,400,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,690,739,0,0,
+0,0,0,0,0,990,0,0,0,1831,0,0,0,0,0,0,0,0,0,0,0,0,0,613,0,0,0,0,0,0,0,0,0,0,0,0,
+0,763,0,878,0,0,0,977,0,100,0,0,0,0,0,0,0,0,0,463,0,0,0,0,623,318,0,0,296,463,
+137,0,0,454,0,0,0,1527,58,0,0,0,0,0,0,0,18,48,0,0,0,0,0,729,0,0,0,442,0,0,0,0,
+40,449,0,853,0,0,0,0,0,0,227,0,0,0,0,0,0,1491,0,0,0,0,0,0,0,0,0,0,161,55,0,450,
+0,1174,62,0,207,0,0,0,0,0,0,0,0,869,0,0,0,0,80,213,0,0,0,0,0,0,0,0,0,0,354,820,
+0,0,747,0,0,0,954,0,0,1073,0,556,0,0,0,692,0,191,0,804,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,831,162,0,0,35,0,0,0,0,0,0,0,0,1235,0,0,0,0,0,1234,0,0,
+0,0,0,0,0,0,0,0,96,0,0,0,0,0,0,0,149,0,0,0,902,204,0,0,833,0,287,366,0,0,0,0,0,
+0,992,2020,0,0,0,0,0,0,0,0,0,0,0,356,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,784,0,0,567,
+630,0,0,0,539,0,0,27,0,0,0,0,0,0,0,0,0,0,755,0,0,0,0,0,0,0,0,0,0,0,0,814,0,0,0,
+0,0,0,0,0,0,0,0,0,0,987,0,0,255,761,194,0,1086,0,0,0,0,0,0,1016,0,0,1396,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,562,271,913,0,0,0,0,0,0,0,0,320,153,45,475,0,0,
+0,0,0,0,0,713,0,327,0,0,0,0,0,0,604,552,3,359,0,0,0,0,853,80,0,0,0,0,0,0,0,2016,
+6,887,0,0,0,0,975,0,961,0,0,0,0,0,916,1891,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,100,101,390,708,0,0,0,587,983,512,0,0,0,0,0,0,0,0,0,0,0,645,0,0,0,851,0,0,0,
+0,0,498,140,217,0,0,0,1448,0,0,0,0,0,0,0,0,0,905,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+643,105,0,792,0,0,0,0,0,0,0,0,0,0,0,0,56,0,0,0,0,0,0,0,0,0,0,535,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1748,0,0,0,0,0,754,0,0,0,0,0,0,0,0,0,0,0,0,91,0,0,1565,0,91,792,
+939,3,370,0,0,0,0,95,0,0,0,0,551,7,619,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1150,0,
+0,0,0,0,0,0,0,0,0,0,0,0,671,0,0,0,0,0,888,368,149,0,0,105,1134,0,983,0,0,458,31,
+0,643,0,0,0,312,0,740,0,0,0,1642,0,0,0,0,0,0,0,236,0,0,0,0,0,0,0,59,68,0,0,0,0,
+0,867,795,0,0,0,0,970,1977,0,0,0,0,0,0,0,1148,0,775,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,970,0,0,0,0,0,0,0,0,0,665,71,0,0,0,0,827,0,0,0,0,0,0,0,0,0,
+0,479,0,0,0,0,0,0,0,0,99,607,0,0,0,0,0,0,0,1960,0,0,0,793,0,0,871,41,0,0,241,94,
+0,0,0,0,209,0,0,1497,0,0,0,0,0,0,0,0,0,98,0,0,0,463,0,0,0,0,291,0,0,0,0,0,0,0,0,
+0,0,984,0,0,0,0,0,205,0,0,0,0,0,0,205,42,0,801,0,0,0,0,0,635,0,0,533,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,371,0,1282,0,0,0,825,0,0,0,0,0,0,0,0,0,357,879,467,0,317,0,0,
+0,0,0,0,0,924,0,0,0,0,849,1795,0,0,0,0,895,1799,43,0,0,0,0,0,0,0,0,0,0,1820,0,0,
+0,0,0,0,0,525,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,110,0,493,0,174,417,0,0,
+0,0,0,583,733,0,0,0,0,0,0,481,215,0,0,0,0,477,0,0,0,0,0,0,0,0,308,0,0,0,0,0,0,0,
+0,297,126,0,0,361,1551,0,0,0,0,0,0,871,1807,0,0,0,0,0,1307,0,685,0,0,0,0,0,0,0,
+797,0,858,0,565,0,0,0,0,0,0,0,0,0,0,0,0,434,252,826,0,0,0,0,0,0,791,0,0,0,0,509,
+231,178,601,0,0,0,0,0,0,0,0,43,1591,0,0,0,0,0,1683,0,0,0,0,45,0,0,0,0,0,0,0,0,0,
+0,1120,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,556,494,0,398,0,0,0,1030,0,0,0,0,0,0,
+168,0,0,0,0,0,0,0,0,0,0,973,0,642,0,0,0,0,0,0,0,0,0,1615,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,378,594,0,1093,0,679,112,0,0,0,0,1492,540,1374,714,
+1486,0,0,0,0,825,1511,0,0,0,0,0,0,0,0,0,0,0,0,0,952,0,0,736,143,0,700,0,1540,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1557,0,0,0,860,990,0,0,0,807,0,0,0,0,0,131,
+515,0,646,0,0,0,0,117,728,508,121,0,0,0,0,0,0,357,0,0,0,0,0,0,237,0,0,0,0,0,0,0,
+0,0,1784,0,0,0,0,0,0,0,0,0,0,0,713,348,1536,0,738,0,0,0,0,0,0,0,434,0,0,0,0,0,0,
+366,1877,39,0,0,0,0,0,0,580,0,0,0,0,0,0,0,0,0,0,0,0,0,0,873,0,0,0,0,171,0,625,
+550,107,343,943,0,0,0,0,0,0,0,768,0,0,0,0,0,0,0,799,0,0,0,894,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1673,0,0,0,0,0,0,0,0,0,0,0,1052,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+272,0,441,0,0,3,9,0,0,0,1182,0,1346,0,0,0,0,0,0,0,0,682,0,0,1004,24,0,0,968,0,0,
+0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,185,0,0,0,578,
+474,0,0,0,0,0,0,0,0,0,0,0,0,0,0,113,530,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,556,0,0,0,0,0,0,16,1317,0,0,97,0,0,0,703,0,0,0,0,0,0,0,0,892,0,0,0,1571,0,0,
+426,186,0,1101,0,0,0,0,0,0,0,0,937,585,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,644,291,
+0,0,0,0,749,0,162,0,0,381,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,762,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,628,21,0,0,0,0,0,0,0,0,919,0,0,0,0,0,0,0,0,0,
+633,0,0,0,0,332,0,0,0,0,0,0,0,0,0,1489,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,832,398,0,645,0,0,0,13,0,0,0,0,0,0,0,0,0,0,20,0,800,0,0,0,0,0,0,0,0,0,
+0,0,0,0,1993,0,0,0,0,769,0,0,0,665,0,0,0,0,0,0,0,0,0,0,1426,0,0,0,0,60,0,0,0,
+641,1874,0,644,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1757,0,0,0,0,0,937,0,1652,0,654,0,
+0,0,0,0,0,0,527,0,0,0,0,0,0,0,0,0,0,0,0,0,226,0,0,0,0,0,1486,0,0,0,0,0,0,0,0,0,
+0,0,325,0,0,0,0,0,0,0,1345,0,0,91,0,404,0,0,0,0,0,0,0,0,0,0,0,0,973,0,0,0,0,0,0,
+0,1176,0,549,0,0,0,0,0,0,0,0,0,0,976,0,0,0,0,0,21,0,0,0,0,0,51,0,0,0,0,314,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,198,6,0,1093,0,0,0,0,0,0,0,0,0,
+0,0,0,0,1776,0,0,0,0,0,1528,0,419,0,0,0,0,0,0,0,0,76,138,0,0,0,0,638,29,0,0,0,0,
+0,0,0,1418,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1710,0,0,0,0,0,
+0,0,0,0,0,0,0,532,23,0,0,0,0,0,0,0,862,0,0,946,592,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,70,0,0,0,0,0,0,0,0,0,812,0,0,0,76,0,0,988,0,442,0,0,0,896,0,0,0,0,0,0,
+483,0,0,0,0,1709,0,0,0,0,0,0,119,0,0,0,117,0,309,0,0,0,0,0,596,976,0,0,0,0,0,0,
+0,0,0,0,0,768,0,0,0,0,0,0,0,0,0,518,0,0,0,0,0,0,0,0,0,0,0,0,0,0,863,0,0,0,24,
+145,1020,0,0,1984,0,0,0,0,0,0,0,658,0,0,0,0,0,0,0,0,0,0,106,1827,0,1010,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,582,87,0,0,0,0,0,0,0,267,0,0,0,703,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,496,0,0,0,0,1121,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,249,561,0,0,0,0,0,
+0,0,760,0,0,154,0,0,0,255,0,419,323,0,0,0,0,0,368,0,0,0,0,0,0,0,0,0,0,522,0,0,0,
+0,0,0,0,551,562,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,92,0,0,0,0,
+0,0,0,284,525,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,958,0,0,594,0,0,0,0,0,0,6,479,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,61,0,0,0,0,0,0,0,820,1641,0,1556,0,0,0,0,0,0,0,302,0,0,
+0,0,0,148,0,0,676,0,0,0,0,0,0,1674,0,0,0,0,0,0,178,0,0,0,0,0,0,0,94,389,0,0,0,0,
+91,8,0,0,0,0,0,0,0,0,0,0,112,0,0,0,0,0,0,0,0,0,0,747,0,0,0,0,0,0,0,1746,0,0,0,0,
+0,24,0,1352,158,1530,0,0,718,130,280,1401,0,0,0,0,0,1946,8,0,0,0,0,1607,0,0,0,0,
+0,0,882,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,417,0,0,0,1597,633,433,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,234,0,0,0,0,0,0,0,0,680,1950,0,0,0,0,249,5,0,0,0,
+0,0,0,0,0,0,1216,0,1773,0,0,0,0,0,0,0,0,0,0,0,0,0,0,509,180,0,0,0,0,0,0,0,1002,
+0,0,0,0,0,0,0,0,0,0,0,0,0,931,0,0,0,0,0,0,0,0,747,943,0,1837,0,0,0,0,0,0,0,641,
+0,0,0,0,280,0,0,0,5,0,0,0,0,0,72,545,0,0,0,0,0,0,0,0,0,742,0,0,254,151,872,0,0,
+0,0,0,0,0,0,0,0,0,0,921,0,0,517,833,0,1680,0,0,436,251,584,0,0,0,0,0,0,0,0,0,0,
+0,24,500,0,0,0,0,0,0,0,0,195,1775,514,389,0,0,0,0,0,0,0,743,0,0,0,0,0,0,292,0,0,
+0,227,1283,774,1805,0,0,0,0,0,0,0,0,0,0,119,81,0,0,0,0,0,0,0,0,0,0,0,0,0,0,913,
+1910,0,0,0,1826,490,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1162,700,30,
+0,0,0,721,839,0,0,0,617,0,0,0,0,0,0,0,0,0,169,428,0,0,0,0,0,1648,637,1205,0,0,0,
+1596,0,0,4,266,0,0,0,0,0,0,0,0,0,0,0,862,0,0,0,0,0,0,0,0,0,0,16,0,0,0,0,0,0,0,0,
+0,279,157,391,604,0,0,713,945,877,973,0,0,0,0,0,0,0,0,0,0,0,0,0,0,859,567,628,
+1846,0,0,0,0,0,0,0,0,0,762,0,0,191,0,0,0,0,298,0,0,767,909,0,0,0,0,0,0,0,795,0,
+0,301,0,0,1970,0,0,0,0,0,0,0,0,0,1236,0,0,0,0,0,0,644,369,15,0,160,71,0,0,0,0,0,
+1447,0,0,0,0,0,0,0,0,735,1255,76,0,0,0,0,0,0,0,0,0,0,474,0,0,0,0,0,0,0,0,0,0,
+841,0,0,0,0,0,0,0,0,0,0,836,0,0,0,0,0,1622,0,0,735,0,0,0,0,1601,804,1390,394,0,
+0,0,0,0,0,96,0,289,0,0,35,688,0,0,0,667,0,513,0,0,0,0,0,0,0,2034,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,704,0,1524,0,1078,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,306,
+0,0,0,0,0,0,0,431,0,1196,0,0,54,0,15,1448,0,1418,0,0,0,0,0,0,0,0,0,907,0,0,0,0,
+0,0,194,1767,0,0,0,0,0,840,0,900,0,0,0,0,0,0,0,0,0,0,0,1436,0,0,0,0,642,1560,0,
+0,0,0,0,0,94,386,0,0,0,0,0,0,0,0,0,0,830,416,0,0,20,731,0,0,0,0,0,0,0,0,697,0,0,
+662,0,0,0,0,0,0,0,0,0,861,0,0,0,0,0,0,0,871,671,864,0,928,7,0,332,0,0,0,0,1055,
+0,0,0,0,0,0,986,0,0,0,0,0,44,76,0,0,0,0,0,0,0,0,0,0,300,0,0,0,0,0,0,0,175,518,
+831,1108,0,0,0,836,0,1852,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,843,1804,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,246,0,0,0,610,202,0,0,36,0,0,0,240,654,13,0,0,0,0,0,0,0,
+0,391,0,403,0,0,0,0,0,0,0,0,0,0,75,0,366,815,0,0,631,0,0,0,0,0,0,0,0,345,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,952,0,0,0,0,0,0,0,0,0,0,0,673,35,662,0,287,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,5,34,0,0,0,0,0,0,0,0,151,0,427,0,0,382,0,0,0,329,0,0,279,0,0,0,
+0,0,0,0,0,0,0,906,0,0,366,843,0,1443,0,1372,992,0,36,123,0,649,0,0,0,0,0,767,0,
+1018,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,995,0,0,0,0,0,0,0,72,368,0,0,1345,0,0,0,
+589,0,0,0,0,0,0,0,0,0,1988,0,0,220,541,0,0,0,686,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,32,196,0,0,0,0,0,0,0,0,0,0,0,0,0,381,0,0,0,0,0,0,0,0,0,1452,0,
+0,0,616,0,0,0,0,0,0,0,0,0,1229,0,0,0,0,0,0,0,0,0,0,667,120,0,0,0,0,0,0,0,1146,0,
+0,0,0,0,0,0,0,0,0,0,352,0,0,0,0,0,293,0,0,0,0,0,0,0,0,0,0,0,0,0,935,0,1050,0,
+147,88,0,0,923,0,0,0,0,0,934,0,0,0,0,0,0,0,0,114,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,341,222,0,0,0,0,0,0,0,0,0,0,293,0,0,0,0,0,0,0,0,0,0,0,0,
+637,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1159,0,0,0,847,0,0,0,0,0,0,683,0,867,944,0,0,
+0,0,0,1809,0,0,0,0,0,0,0,0,0,0,395,170,0,0,0,0,0,0,0,0,0,0,618,535,0,1625,0,0,0,
+0,0,0,0,0,23,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,778,0,0,0,0,0,46,0,2032,0,0,37,
+1458,0,938,363,34,0,0,0,0,0,0,0,0,0,0,0,0,0,0,314,0,0,0,0,0,0,889,0,0,0,0,0,0,0,
+0,0,0,0,462,0,0,0,0,525,0,0,23,0,0,0,0,0,0,0,0,0,0,0,676,0,0,0,0,0,0,0,0,0,0,0,
+0,498,725,0,0,0,0,7,0,0,0,0,773,0,0,0,164,0,0,0,0,0,0,0,0,936,583,659,1462,0,
+220,0,0,0,0,803,0,0,544,119,0,0,0,0,0,0,0,0,0,0,0,181,176,0,1192,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,1878,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26,0,0,0,0,0,0,
+944,0,0,0,0,0,0,0,273,0,0,0,0,0,855,0,0,0,0,5,127,0,0,0,0,0,0,0,0,752,230,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,68,162,0,654,48,156,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,240,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,197,
+0,0,0,0,0,0,0,963,0,0,0,0,0,0,0,0,0,0,858,0,0,0,0,0,0,0,0,0,0,676,1978,0,0,102,
+972,0,0,0,0,0,0,0,361,0,461,0,0,0,472,0,0,0,0,0,0,0,0,0,0,0,0,0,0,747,905,0,0,0,
+155,0,0,0,0,0,0,0,0,0,0,319,163,0,0,0,0,0,0,0,0,0,848,0,0,36,631,0,0,0,0,0,1769,
+0,0,0,0,0,144,0,0,0,0,0,0,0,0,0,0,369,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,555,247,0,0,
+996,0,0,189,0,0,0,0,0,0,0,0,0,0,280,0,0,0,0,0,0,0,0,0,0,0,526,746,0,0,345,0,0,0,
+1017,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,651,428,0,0,0,1162,230,327,546,792,0,0,0,
+1203,0,0,0,0,0,0,0,0,0,672,189,0,0,0,0,0,0,99,0,0,0,298,0,0,0,0,0,0,555,397,0,0,
+0,0,0,1157,0,0,0,0,0,0,0,0,0,0,398,1523,0,366,0,0,787,0,0,0,282,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,157,0,941,0,0,0,0,0,1336,0,0,116,0,0,0,0,0,0,787,0,0,0,0,0,0,0,0,0,
+0,170,160,0,1815,0,0,0,0,0,866,0,0,0,0,0,0,0,0,0,689,0,0,0,0,820,0,498,108,0,0,
+0,1119,0,0,0,244,609,1005,0,581,0,0,0,0,0,895,0,0,0,1898,0,0,0,0,0,926,0,0,0,0,
+0,0,0,0,0,0,0,0,0,538,496,294,301,0,0,0,18,0,0,757,0,0,0,0,0,1263,0,820,0,722,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2028,0,0,0,0,124,1875,0,0,0,881,0,0,0,1348,
+0,0,0,0,0,0,0,911,0,954,0,0,0,0,414,0,0,0,0,517,0,0,0,0,0,816,0,0,0,0,0,0,0,0,
+713,0,0,0,0,0,0,0,33,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,593,150,0,0,0,0,
+0,553,0,0,0,0,0,0,0,0,0,0,108,0,0,0,0,420,0,0,0,0,0,0,0,0,0,0,0,1777,0,0,55,493,
+0,0,81,0,321,980,0,0,0,0,0,0,0,0,0,0,0,0,0,0,362,112,0,74,0,0,0,0,0,0,0,625,0,0,
+0,0,0,0,377,16,0,0,61,281,0,0,0,0,0,0,0,0,0,0,0,0,0,0,224,1031,0,0,0,0,0,0,51,0,
+0,0,0,0,0,0,211,309,15,125,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,789,173,0,439,9,648,
+0,0,294,0,0,0,0,0,0,0,374,8,0,1099,0,0,0,0,0,0,0,575,0,0,0,518,0,0,0,702,0,0,0,
+0,0,0,87,0,0,0,438,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,464,122,0,0,0,1802,0,0,0,0,
+0,0,499,0,0,0,87,476,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,840,283,0,0,0,0,1620,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,609,1160,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,600,
+323,372,0,0,0,0,471,722,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,
+477,1304,0,1774,0,0,88,0,438,12,0,0,0,0,0,0,0,0,671,997,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,639,22,0,0,782,681,0,0,0,0,0,0,0,0,0,0,1013,664,0,942,0,1349,0,0,0,0,0,0,0,
+0,0,0,0,0,356,0,0,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,215,289,0,1975,
+109,450,0,0,0,0,0,0,0,0,0,0,705,0,0,664,0,0,0,0,0,0,0,1238,0,0,318,0,0,0,0,0,0,
+0,0,0,0,0,0,0,960,1872,0,0,0,0,0,0,0,0,0,0,0,0,0,0,103,0,0,0,0,0,0,0,0,0,239,
+777,0,26,0,0,0,0,0,0,0,0,0,0,0,0,375,414,0,17,0,0,0,1350,0,955,0,0,0,0,0,0,0,0,
+887,960,0,0,0,0,0,0,0,0,0,0,708,710,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,919,0,0,0,
+0,502,280,7,45,0,0,0,0,777,0,0,0,0,410,0,1110,0,0,0,0,0,0,414,341,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,787,0,0,0,436,0,0,0,0,0,0,0,1707,613,377,96,0,0,0,0,451,
+0,0,0,0,0,0,0,0,0,0,0,0,0,680,0,483,916,0,0,0,0,0,0,937,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,739,0,0,0,0,0,0,0,0,82,0,0,663,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,128,0,0,0,0,0,0,0,0,1087,0,0,0,0,0,0,0,503,0,0,0,0,0,0,9,113,104,324,0,460,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,935,702,434,485,1014,949,423,0,900,
+0,0,0,0,0,0,0,2018,574,0,0,0,0,0,0,0,0,0,0,0,0,1206,0,0,0,0,0,0,0,0,38,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,1022,0,0,0,0,143,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,2029,0,0,0,0,0,0,0,0,0,0,0,0,523,0,0,0,0,0,0,625,0,0,425,37,0,0,0,1943,0,0,0,
+0,0,765,0,0,0,0,0,0,0,0,0,0,551,0,0,0,0,0,0,0,0,0,0,0,0,168,0,0,1010,0,0,1994,0,
+0,0,91,0,0,0,0,532,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1884,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,240,15,0,0,0,1227,0,1534,0,0,0,0,0,0,0,0,0,0,0,0,0,0,392,0,
+0,0,0,0,0,0,0,0,0,0,0,655,562,395,0,0,0,501,1019,0,0,0,0,509,267,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1099,0,0,0,0,0,0,948,0,0,0,0,0,0,0,
+462,114,0,0,258,404,0,1717,0,0,0,0,82,1061,0,724,0,0,0,0,0,1133,0,0,0,0,0,0,
+1021,841,0,1021,0,0,0,0,0,0,0,0,0,0,488,373,37,0,0,0,0,564,0,0,0,0,0,513,0,0,0,
+825,0,0,899,0,0,778,0,0,12,1417,0,1116,0,0,0,0,0,0,0,0,0,0,0,0,0,0,114,545,0,5,
+0,0,0,0,0,0,0,192,0,0,763,0,0,0,0,0,0,0,755,759,0,0,0,0,0,0,0,0,0,370,0,1237,0,
+0,0,0,0,0,298,87,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,31,0,0,
+0,0,0,0,814,991,0,757,57,0,0,0,0,0,0,0,0,0,540,0,0,0,0,608,0,0,0,0,0,0,0,0,1014,
+0,0,0,902,0,0,0,0,553,1668,0,0,0,0,0,0,0,0,0,559,60,0,0,0,0,0,511,0,0,675,0,0,
+156,0,0,0,0,0,0,709,0,698,0,0,0,1745,0,0,0,0,0,0,0,0,0,714,0,0,0,0,0,0,0,0,206,
+8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,776,0,0,0,0,0,0,0,0,0,1272,0,0,
+0,0,0,1059,0,0,0,0,0,0,406,0,0,0,0,0,0,0,0,0,0,947,0,0,0,0,0,0,168,0,0,0,0,0,0,
+870,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,554,0,0,0,0,784,908,0,0,0,0,0,0,
+0,396,358,0,0,0,0,0,0,0,0,2,228,0,0,0,0,0,0,0,0,0,0,0,845,14,0,716,1820,594,0,
+81,1428,0,161,0,782,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,64,0,0,0,0,0,998,0,
+0,0,0,0,0,0,0,0,0,0,0,1043,0,1496,0,0,0,0,0,0,0,0,781,0,0,0,0,0,0,0,817,1114,0,
+1814,958,0,0,0,0,812,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,139,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,236,643,0,0,0,0,0,0,0,0,0,1172,0,0,0,0,0,0,0,0,0,1338,0,0,0,
+0,0,0,0,0,0,0,0,54,0,0,0,256,0,0,351,0,955,1885,0,469,0,0,0,1270,0,744,0,313,0,
+0,0,0,0,0,0,0,402,969,0,0,0,0,0,0,50,0,0,0,0,572,0,0,0,0,847,0,0,0,0,0,0,0,248,
+43,0,369,0,0,0,0,0,0,0,0,0,0,0,0,0,766,0,363,0,0,0,0,0,0,0,0,0,0,0,678,0,0,409,
+258,82,249,0,0,0,0,0,0,0,0,0,0,0,0,32,393,0,788,0,0,0,1281,509,1968,0,0,0,0,39,
+291,0,0,0,589,0,0,54,1059,0,0,0,0,0,0,824,0,0,0,0,0,0,0,0,0,0,1005,0,1598,0,0,0,
+0,0,919,0,0,0,0,0,0,0,0,52,132,0,0,0,0,0,328,0,0,0,0,173,0,0,0,0,0,65,1411,0,0,
+0,0,0,0,0,0,0,0,442,0,842,0,0,0,0,0,0,0,0,0,534,0,0,0,0,0,0,0,0,0,0,0,0,0,845,
+210,0,0,0,0,0,0,0,0,892,0,0,223,0,0,0,0,529,0,0,0,807,0,137,218,0,1444,0,0,0,0,
+0,332,661,0,0,0,0,0,0,0,76,1517,0,0,0,0,0,0,0,0,0,0,0,418,0,0,0,0,0,0,0,0,481,
+379,0,0,0,0,0,149,18,0,0,0,0,0,0,0,0,742,304,142,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,799,925,195,51,0,0,0,0,688,0,0,0,0,697,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,1169,751,0,0,0,452,929,0,221,0,1437,0,0,0,0,955,1251,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,192,0,132,0,0,0,0,0,865,0,0,0,0,0,0,0,767,
+672,42,0,0,0,1050,0,0,0,0,0,0,0,0,368,44,0,0,0,0,0,0,0,570,29,0,0,0,0,0,0,227,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,522,0,0,0,0,0,0,0,1529,0,0,0,0,0,0,739,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1667,0,0,0,0,0,0,132,511,0,138,208,1020,0,0,23,565,0,344,0,0,0,
+0,0,922,0,0,0,0,0,0,0,240,0,0,415,171,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,402,0,0,754,31,716,0,982,731,0,0,0,0,0,0,0,888,0,0,0,803,847,0,0,823,
+0,0,0,0,0,0,785,0,0,2,0,0,0,0,0,0,0,532,0,0,681,0,0,314,0,384,684,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,649,447,0,1818,1007,0,321,0,66,360,0,0,0,385,0,0,0,0,0,0,
+0,900,73,254,0,0,0,0,683,1959,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,86,0,0,725,0,0,0,0,0,196,0,0,0,0,0,831,0,0,0,0,723,0,0,0,0,0,994,627,0,0,
+0,0,0,0,0,0,0,0,764,66,0,0,0,0,205,36,0,0,0,0,0,0,0,950,0,0,0,887,111,0,0,831,
+388,165,0,0,0,0,0,155,0,0,0,0,0,0,0,0,0,0,0,0,0,0,780,755,0,0,0,0,898,146,0,0,0,
+0,0,0,0,45,7,0,0,0,0,0,0,0,0,607,0,0,0,0,0,0,65,0,0,0,0,0,0,0,0,0,88,0,0,0,0,0,
+621,600,0,367,0,0,0,0,0,0,0,561,0,559,0,585,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+287,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,672,157,0,0,0,0,714,0,0,0,
+0,0,456,0,925,0,0,0,0,0,0,0,0,19,0,0,0,0,1473,0,0,0,0,0,0,0,0,0,0,113,0,0,0,0,0,
+0,0,0,0,0,0,0,0,69,463,0,0,82,193,2,471,0,0,0,0,633,0,0,0,0,0,0,1148,129,1392,
+542,803,0,0,0,0,0,0,0,0,0,0,0,0,438,0,0,0,0,0,0,875,0,0,0,0,0,237,0,0,0,0,0,0,0,
+65,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,563,0,0,0,9,444,0,0,43,1260,0,0,0,0,0,0,
+971,0,0,699,0,0,0,0,0,1116,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,829,242,0,
+0,593,0,0,0,0,0,0,0,0,201,36,224,0,0,0,0,0,0,1430,0,1806,0,523,0,0,212,1889,0,0,
+0,827,0,0,0,0,0,2043,136,242,0,0,0,0,0,0,284,148,10,0,0,0,0,0,0,1249,0,0,0,807,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,94,0,0,0,494,0,0,0,0,0,0,0,0,1510,0,0,0,0,0,
+0,0,0,0,0,505,1306,0,0,764,268,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,384,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1703,0,0,0,0,159,964,583,0,0,0,
+0,0,0,515,0,0,854,0,0,0,0,0,0,0,0,0,0,0,0,1123,0,0,0,0,0,0,0,136,0,0,0,0,0,1782,
+0,0,44,1287,0,0,0,0,0,732,0,0,0,0,313,679,0,0,316,0,0,0,0,595,0,0,0,0,0,0,753,
+147,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,137,0,0,0,0,414,0,1762,0,0,0,0,0,0,0,0,
+0,0,0,599,0,0,0,0,0,0,0,0,0,1749,0,0,0,1627,0,488,0,0,0,0,0,83,0,0,0,0,676,0,0,
+1639,0,0,0,0,0,0,0,0,0,278,0,0,0,0,0,0,97,0,14,1085,0,0,0,0,0,0,781,388,0,849,
+59,229,0,0,0,0,0,1115,0,0,0,0,108,0,0,0,0,700,0,0,0,0,0,0,0,0,0,1414,0,0,0,0,0,
+0,0,0,0,0,0,0,0,660,737,1035,0,0,0,0,0,0,521,690,0,0,0,0,0,0,0,0,0,0,0,0,272,0,
+0,0,0,0,0,0,0,0,0,1744,0,0,0,0,0,0,128,733,0,0,277,0,0,0,0,0,0,0,0,0,4,0,0,0,0,
+0,0,0,0,0,0,0,0,0,936,1981,40,0,0,0,0,0,0,0,0,775,0,0,0,0,0,0,0,0,0,306,0,0,0,0,
+0,0,0,979,0,0,0,0,0,611,0,0,0,0,0,178,0,0,0,1969,0,0,0,0,0,0,0,664,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,390,0,0,0,1510,0,0,0,0,0,0,0,0,0,0,0,493,0,0,37,0,0,0,0,724,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,96,1537,0,0,168,473,0,0,0,105,0,0,0,0,
+627,438,0,0,0,0,0,0,0,0,0,0,11,1256,0,0,0,1626,0,779,0,0,0,0,25,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,308,0,0,0,0,0,741,0,671,0,0,0,0,649,150,0,0,99,521,0,0,3,339,0,0,0,
+543,0,0,0,0,0,0,0,0,0,1358,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,234,155,
+0,0,0,0,0,0,0,1628,0,766,0,0,0,0,0,0,0,0,0,0,0,0,0,829,0,0,0,1445,0,0,0,486,0,0,
+0,0,2,1635,0,0,0,0,558,0,0,0,0,0,0,0,0,0,0,1461,0,0,0,0,0,599,0,0,0,0,0,0,0,0,0,
+1376,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,93,0,0,0,0,0,0,447,0,0,66,1432,0,0,0,0,
+0,0,307,0,413,609,0,0,0,930,0,0,0,0,21,939,0,0,0,0,0,962,4,651,0,0,0,0,15,579,0,
+0,0,0,0,597,0,0,0,0,0,981,0,0,0,545,0,0,0,0,0,0,0,1558,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,800,17,0,0,17,0,907,0,0,0,110,0,0,0,53,458,0,1983,0,0,0,0,0,0,0,0,0,0,443,0,
+0,0,0,0,0,0,0,0,0,0,924,1844,0,1232,0,0,0,0,70,519,0,993,0,0,0,0,0,0,14,530,0,
+907,0,0,0,0,0,733,0,0,0,0,0,0,0,0,55,0,188,531,56,0,0,1693,0,0,0,0,0,0,0,0,441,
+0,192,928,0,0,0,0,0,241,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1525,0,259,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,512,185,0,464,1603,0,0,0,0,0,0,0,0,0,0,0,1113,
+284,720,0,0,722,0,0,0,0,0,13,0,0,0,0,0,0,0,4,289,43,0,0,0,0,0,0,1694,0,0,0,0,
+193,0,0,0,0,409,0,0,0,0,0,0,0,0,0,0,0,0,308,0,0,1863,0,0,0,0,0,0,0,0,0,790,0,0,
+745,1002,0,0,0,0,0,0,0,0,0,289,68,477,13,0,0,0,0,0,0,0,0,0,0,609,0,0,0,0,0,0,0,
+0,0,0,0,367,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,528,0,0,0,0,0,0,0,0,0,694,58,
+548,0,0,0,0,0,0,687,0,0,0,0,1749,0,0,0,0,0,0,0,0,1004,661,0,0,0,0,0,0,445,0,0,0,
+74,0,0,0,0,213,0,0,0,0,0,0,0,0,0,0,0,0,0,834,0,0,189,1672,0,0,0,0,0,0,0,1548,
+192,0,0,0,0,0,0,0,0,0,0,0,0,0,32,751,0,78,0,0,0,0,0,0,544,1602,105,473,0,0,0,0,
+0,0,156,1949,0,1779,0,0,0,0,0,0,0,0,0,0,0,763,0,0,0,0,0,0,0,0,29,0,0,0,0,0,0,0,
+0,0,0,883,0,0,0,0,0,0,0,488,0,617,0,0,50,0,694,1518,785,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,546,0,0,0,0,0,0,0,0,0,0,22,0,0,0,0,1016,0,0,0,577,0,0,0,0,0,0,
+184,935,114,720,0,0,100,0,0,0,0,0,0,0,0,0,3,0,0,0,0,0,95,14,0,969,0,0,0,0,0,0,0,
+727,0,1021,0,0,0,0,0,1190,0,0,0,0,0,0,0,0,0,0,0,0,0,153,0,0,0,0,0,0,0,0,0,798,0,
+587,0,0,695,42,0,1929,141,957,0,465,7,908,0,0,450,148,0,0,0,1166,0,0,0,0,0,0,0,
+0,0,0,0,0,253,0,1003,0,0,0,0,0,0,0,0,0,0,0,46,0,0,879,0,806,0,1868,0,0,0,0,0,
+1846,0,0,0,730,0,0,0,0,0,0,0,965,0,0,0,0,506,0,0,0,10,0,0,0,22,0,0,0,0,0,0,0,0,
+0,0,0,0,0,960,296,0,0,0,0,0,0,0,0,0,0,0,587,0,0,0,0,20,0,0,0,32,982,0,0,0,0,0,0,
+0,0,0,0,941,0,0,0,0,435,0,0,0,0,0,0,71,419,0,0,0,0,0,0,688,740,94,345,0,0,679,
+582,0,0,0,0,0,0,0,945,0,0,0,0,0,0,0,0,0,0,0,0,539,0,684,1993,0,0,0,659,0,583,0,
+803,0,704,0,0,0,0,0,198,181,347,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,481,405,203,0,0,99,826,0,0,0,0,0,0,0,492,0,408,0,0,0,0,0,0,0,0,0,0,4,0,0,
+0,0,665,349,137,0,0,0,0,612,1270,0,0,0,0,0,371,0,0,0,826,0,0,0,0,21,1535,858,
+374,0,0,0,0,0,0,311,0,0,0,991,1968,0,0,0,0,494,1647,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,769,0,0,0,0,0,642,0,0,157,123,0,0,0,1435,0,0,0,0,0,0,0,0,0,0,79,0,0,0,
+0,0,0,1425,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,106,393,486,1690,0,0,0,0,
+0,0,0,0,0,0,0,0,756,184,0,0,0,1382,0,0,0,175,0,1493,0,1007,0,0,0,0,0,0,0,0,0,0,
+0,219,0,0,0,0,515,99,0,851,0,0,0,0,0,1278,0,0,0,0,0,0,0,1000,982,0,762,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,910,1819,0,0,0,0,0,0,906,0,0,0,0,0,0,0,0,0,0,1730,0,0,
+0,0,0,0,0,0,0,0,0,1185,0,0,0,0,0,0,0,0,40,0,0,0,147,0,0,0,0,0,0,0,0,0,0,0,0,0,
+650,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,56,30,0,553,0,0,20,597,0,1614,0,0,0,0,0,327,
+49,0,0,0,0,0,0,0,78,0,0,786,134,0,0,0,12,496,0,0,0,0,0,0,0,0,0,0,42,204,0,614,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,147,247,0,0,0,0,942,0,0,2023,0,0,0,0,
+0,0,67,285,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1309,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,41,532,0,0,0,0,0,0,0,
+1692,0,0,0,0,55,1704,0,0,0,0,988,0,0,0,223,0,0,0,0,0,0,0,57,1123,0,0,0,0,0,1764,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2015,0,0,0,1599,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,129,0,0,0,0,0,0,0,0,0,0,0,534,0,0,0,0,0,0,0,0,0,0,0,
+0,0,504,621,1248,321,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1397,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,441,75,0,0,0,0,0,0,0,0,0,0,841,0,0,0,0,0,693,0,650,314,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,913,0,0,0,0,0,0,0,0,0,0,0,0,0,0,880,0,475,0,
+0,1016,179,602,111,329,0,0,0,1864,0,0,0,0,846,1888,0,0,780,0,0,0,82,0,0,0,0,821,
+0,0,0,0,0,0,0,0,0,0,0,956,112,0,0,0,261,455,0,0,0,0,0,0,337,385,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,184,1865,0,0,721,16,0,486,0,0,0,265,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,621,0,0,0,0,0,0,0,0,234,0,0,815,0,0,743,
+1987,205,197,0,0,0,0,0,0,0,0,0,314,0,0,0,0,0,0,0,0,0,0,0,0,0,0,219,452,589,0,
+176,333,0,0,0,0,0,0,0,1110,47,0,0,0,0,0,0,0,0,0,0,0,864,0,0,300,0,1237,0,0,0,0,
+0,0,0,0,0,0,0,1685,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,135,395,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,631,0,0,0,0,0,0,835,0,0,0,606,459,0,979,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,612,0,0,0,0,0,0,0,0,158,372,0,854,0,0,0,0,0,
+0,0,1492,0,0,0,833,0,0,0,0,0,0,0,1739,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+195,0,0,0,0,0,0,0,0,730,1997,0,0,0,0,0,0,0,0,61,0,0,0,0,0,0,0,266,751,0,0,0,0,0,
+0,0,821,0,0,0,715,0,0,0,868,0,959,0,0,0,0,0,0,0,0,0,0,0,1053,0,0,0,950,0,1081,0,
+1595,0,0,0,0,59,0,0,0,0,0,0,0,0,0,0,47,684,0,0,0,0,0,0,1606,0,777,0,1020,0,0,0,
+1094,0,0,0,0,0,0,0,350,0,0,0,0,0,0,242,1812,0,0,0,967,0,0,0,473,286,0,0,0,0,0,0,
+798,629,222,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,513,337,306,0,0,0,0,0,0,0,0,0,
+146,0,0,1646,0,0,0,0,0,465,0,0,0,525,0,0,0,0,0,0,299,165,0,0,0,0,0,0,0,1064,0,0,
+0,0,0,596,0,0,0,0,0,0,0,0,0,0,0,0,0,0,238,1741,0,1233,451,1824,0,0,0,0,733,495,
+0,0,0,0,0,1204,0,0,0,559,341,0,224,21,0,0,0,0,0,0,0,0,97,1446,0,0,0,0,0,0,0,729,
+0,0,565,727,0,1948,0,0,0,519,0,0,0,0,0,0,0,0,0,1193,0,0,0,0,0,0,790,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,323,2,201,0,0,59,0,0,34,0,896,961,0,1285,0,0,46,0,479,0,0,
+0,0,549,0,663,0,0,0,0,0,783,65,682,0,0,0,0,0,11,0,0,0,0,0,522,0,0,0,52,0,0,0,0,
+0,383,0,0,0,0,0,0,0,0,127,0,0,0,0,0,397,194,0,0,635,0,0,0,0,0,0,0,0,0,0,975,0,0,
+0,0,0,0,0,0,0,0,116,0,51,0,0,858,0,1075,535,448,0,0,0,0,0,610,0,0,0,0,0,0,0,0,0,
+0,191,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,267,673,319,94,92,0,551,0,0,218,
+1406,69,256,0,0,952,1980,0,833,0,0,0,0,0,0,0,0,0,0,0,0,39,0,0,0,0,0,0,0,81,0,0,
+0,352,634,0,0,0,0,0,618,0,0,0,0,0,0,73,339,0,0,0,0,0,0,0,0,0,0,0,0,0,0,169,759,
+0,0,0,0,0,0,0,0,0,0,0,0,0,1075,0,0,0,0,0,0,482,649,0,0,0,0,0,0,0,0,386,336,0,0,
+0,1035,0,0,0,0,0,0,0,0,0,0,0,924,0,73,0,0,0,0,0,1971,0,0,0,0,0,0,0,0,0,1344,0,
+501,0,0,0,0,0,0,0,0,46,799,0,0,0,0,0,0,0,276,0,0,0,0,0,0,0,770,0,0,0,0,0,0,0,0,
+0,0,0,0,0,158,0,0,0,0,0,1432,0,0,0,0,0,0,0,0,0,0,25,0,0,2001,0,0,0,0,0,0,0,0,0,
+0,0,0,0,478,0,0,0,0,0,0,91,1461,211,602,0,0,0,0,0,0,0,0,0,1068,0,0,124,567,0,0,
+0,1006,0,0,0,0,0,0,0,0,0,735,812,0,0,323,0,0,0,304,0,0,0,0,0,0,0,0,0,148,0,0,0,
+0,0,0,0,0,0,523,0,0,144,730,0,0,981,0,0,111,0,0,132,0,0,0,0,0,0,890,0,0,0,0,0,
+444,0,1787,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,2041,932,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,937,0,995,0,0,255,0,0,138,863,965,0,0,631,0,0,0,0,1394,16,652,0,0,0,0,0,0,
+0,0,0,0,0,0,0,897,0,321,0,0,0,0,0,922,0,619,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,844,0,0,0,0,0,0,1659,0,1100,0,0,0,1173,0,1930,268,251,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,390,711,0,0,0,0,0,0,0,0,0,0,0,0,0,744,0,0,0,0,0,0,0,0,0,624,0,0,0,
+1998,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1125,0,0,0,594,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,268,0,0,0,0,0,0,0,563,0,0,0,0,0,0,0,0,2,39,0,0,0,1332,0,0,0,0,0,
+0,0,508,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,66,796,0,0,0,0,527,0,0,0,0,98,0,0,576,0,
+0,0,0,0,122,0,276,37,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,645,0,0,0,0,
+0,0,0,0,0,0,0,290,0,0,762,1292,0,0,0,1315,0,1955,0,0,0,0,0,0,0,0,0,0,210,131,0,
+0,0,0,797,0,38,0,11,488,0,936,0,441,0,0,0,0,0,595,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+991,0,0,0,0,0,0,0,0,0,0,0,653,0,523,0,0,0,903,0,0,0,0,0,0,0,0,0,0,0,0,80,0,0,0,
+0,0,0,0,0,0,432,0,0,314,0,0,0,0,232,1368,534,0,0,0,0,0,27,0,0,0,12,0,0,0,0,0,0,
+0,0,0,264,736,0,1657,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1117,0,127,0,0,0,1208,0,1294,
+0,0,0,0,364,0,0,0,0,0,125,1334,0,0,0,0,0,0,0,0,0,0,0,0,0,0,792,0,0,0,0,0,0,0,
+849,699,0,0,0,0,0,968,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1446,
+124,397,0,0,0,0,0,0,0,0,0,0,0,641,0,0,0,0,0,0,0,0,0,0,0,0,127,346,0,0,517,75,0,
+0,0,0,0,0,0,0,83,0,0,0,0,0,0,1031,0,0,0,0,0,0,0,1470,0,954,0,0,345,304,410,0,0,
+0,0,734,0,0,0,0,0,1822,0,0,0,1798,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,0,0,0,0,0,161,
+1865,69,0,0,0,0,0,0,922,0,0,0,0,0,0,0,0,0,0,0,541,0,627,0,0,0,0,0,0,0,0,0,166,0,
+0,0,0,0,0,0,0,0,849,0,0,0,0,0,0,0,717,0,0,0,0,0,0,0,0,0,0,0,0,0,0,600,0,0,0,0,0,
+0,654,0,0,188,273,0,0,0,543,0,410,87,0,0,941,0,0,186,250,0,1785,0,0,0,0,0,1339,
+462,961,0,780,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,529,0,0,0,0,0,0,474,1276,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,24,948,0,0,0,0,657,753,0,0,0,0,941,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,706,985,837,0,1861,0,0,0,0,0,0,0,0,0,0,0,0,0,0,292,933,0,0,0,0,0,
+0,0,0,0,767,0,0,0,0,0,0,0,641,0,0,0,1233,114,0,883,0,274,2008,0,1794,285,0,0,
+571,0,0,0,0,0,0,0,0,0,0,823,960,16,617,0,431,0,0,0,0,0,0,0,0,0,0,567,0,401,0,2,
+781,424,33,0,2006,0,0,274,0,0,1882,0,794,0,0,0,1848,0,0,0,0,0,0,448,47,0,0,0,
+1199,0,0,0,0,0,0,0,0,417,0,0,0,0,0,0,0,0,0,0,295,0,0,0,0,0,0,0,1019,0,0,0,0,0,0,
+0,0,0,0,0,0,0,620,0,0,0,0,464,0,0,0,0,208,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,442,0,930,0,0,0,0,0,516,68,0,0,0,0,0,1128,104,0,0,0,0,0,0,0,0,787,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,491,0,0,0,0,0,0,711,0,0,9,0,101,441,0,0,0,0,0,0,0,0,
+0,0,160,396,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,679,326,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,1128,0,0,0,0,0,737,0,1796,0,0,0,0,0,0,0,0,0,0,0,0,338,574,0,0,
+0,0,0,1096,491,405,0,0,0,0,0,1081,0,0,0,0,0,0,0,0,0,0,0,0,0,1676,0,1207,0,0,0,0,
+0,0,969,354,0,0,0,0,598,0,297,0,0,0,0,0,0,0,0,1772,751,0,37,0,0,1828,0,0,0,0,0,
+0,0,0,0,257,191,582,0,0,0,0,0,0,790,0,0,0,0,0,47,0,0,0,0,0,0,0,449,306,1011,0,0,
+0,0,0,299,0,0,0,0,0,0,837,0,0,0,0,0,0,10,329,0,0,0,0,0,1320,0,0,0,0,0,0,158,657,
+0,1191,0,0,0,0,0,0,7,0,974,1939,0,1665,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,288,
+66,0,0,0,0,494,175,0,1643,0,0,0,0,0,0,0,0,570,750,719,0,0,0,0,0,0,0,0,0,0,0,0,0,
+13,0,0,1247,0,0,221,356,0,0,0,0,0,0,0,0,0,0,694,1809,0,0,0,0,0,0,0,411,0,44,31,
+0,0,0,0,669,0,673,0,0,0,0,0,0,0,0,0,1303,704,299,0,0,0,275,0,0,216,1761,0,0,0,0,
+0,0,0,0,0,0,0,1319,0,0,428,0,0,0,0,0,0,0,0,0,0,514,0,0,0,0,0,0,49,55,102,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,364,0,0,0,0,379,0,921,971,52,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1258,0,0,0,1058,0,0,0,0,0,656,0,0,0,0,0,144,0,0,0,0,0,0,0,0,0,0,
+0,1373,10,605,0,0,0,0,0,0,0,838,0,1012,0,0,0,0,0,0,0,0,0,0,0,0,0,0,154,365,0,0,
+0,0,0,0,0,0,0,340,0,0,0,0,0,810,0,0,0,0,0,0,495,0,0,0,0,0,0,0,0,0,261,0,535,248,
+0,358,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,567,445,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,697,0,0,0,1336,0,0,0,0,0,0,0,0,917,174,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,972,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,351,0,0,0,0,0,0,0,0,0,0,
+0,0,0,286,0,0,56,438,0,0,0,0,0,1950,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,738,0,0,0,0,0,
+0,0,0,0,0,969,2047,0,0,0,0,0,0,0,818,0,0,0,0,0,0,0,866,0,0,0,0,0,0,0,1467,0,0,0,
+0,0,0,0,0,0,0,0,0,0,972,0,355,0,0,0,116,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,267,189,104,0,0,0,0,1613,0,0,0,0,0,0,0,116,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,886,0,86,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,45,0,0,863,0,0,0,0,0,
+0,0,1953,450,1773,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,381,0,0,0,0,0,0,0,
+0,0,0,0,0,1142,0,1189,0,0,0,663,0,0,0,0,0,0,0,846,0,0,528,0,393,378,0,0,0,0,0,0,
+325,899,680,1880,0,1770,0,0,0,0,0,648,0,0,0,0,0,0,185,167,0,2046,0,0,0,0,0,0,
+249,1645,0,152,0,0,0,1733,0,0,0,0,0,1006,0,0,0,0,0,420,0,0,0,832,0,0,0,0,0,351,
+0,0,0,0,6,40,0,0,60,0,0,0,0,1354,745,724,0,0,0,0,0,0,0,0,772,1951,275,108,639,0,
+0,0,0,0,0,0,0,0,500,1758,0,0,0,0,0,0,0,0,0,0,0,1886,711,205,0,0,965,865,0,0,0,
+534,0,0,0,0,691,0,0,0,237,443,0,878,0,0,0,0,0,1410,0,0,0,0,0,0,0,0,0,0,0,0,0,
+995,0,0,0,0,0,0,0,0,0,0,0,0,0,578,0,0,0,0,881,0,0,0,0,0,0,0,0,822,0,923,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,924,0,0,0,665,0,0,0,0,0,1901,0,0,0,0,0,950,498,93,
+0,0,0,1451,0,0,0,0,0,747,828,788,400,184,0,198,0,0,0,0,0,0,0,0,0,0,0,994,0,0,0,
+0,0,0,0,0,615,320,0,0,0,978,843,905,0,0,0,0,0,0,0,0,850,974,0,0,0,0,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,509,0,0,0,0,0,273,0,0,0,0,0,0,0,0,0,0,0,0,0,
+201,0,0,0,1041,0,0,0,1040,0,0,0,0,0,0,0,0,0,693,234,774,0,336,0,1399,22,0,805,
+802,777,167,789,0,0,1705,0,0,0,0,0,0,0,0,0,0,0,10,13,11,0,0,204,264,0,0,56,0,0,
+1917,0,470,0,0,0,0,0,0,0,0,0,0,0,1198,0,0,0,0,0,0,0,0,0,0,1015,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,715,0,0,1002,0,0,0,298,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,867,0,0,724,0,0,0,0,0,0,0,0,0,0,0,0,768,0,0,0,0,0,1066,0,0,0,0,67,0,174,948,
+0,0,0,0,0,0,0,0,0,0,0,0,0,764,0,0,0,0,75,137,0,756,0,0,0,0,0,0,1008,842,643,0,0,
+0,67,0,0,0,0,0,0,0,0,0,0,0,135,821,0,0,0,0,0,0,0,0,736,0,389,355,0,0,786,0,0,0,
+0,0,0,2044,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1030,0,0,0,1083,0,0,0,0,0,
+1226,0,0,0,0,356,319,8,389,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,474,0,0,0,427,
+0,413,0,730,0,0,0,0,0,373,0,0,0,0,0,0,0,0,0,799,0,0,0,1793,0,0,0,322,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,89,290,2,0,0,0,0,0,0,0,0,0,0,672,
+699,1860,0,0,0,737,0,0,0,1612,0,0,0,0,0,0,0,0,0,0,0,145,124,884,0,0,0,0,0,387,0,
+0,0,0,0,0,0,0,0,0,0,679,0,550,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1305,0,0,0,0,0,0,0,
+576,0,0,0,0,0,0,0,686,0,607,0,0,37,0,0,0,0,0,0,0,0,0,101,1726,0,0,0,0,0,958,0,0,
+0,903,0,0,0,0,147,0,0,0,0,0,0,0,0,0,0,0,367,0,0,0,0,690,0,705,273,0,0,887,0,0,0,
+0,0,0,0,0,0,0,0,90,0,0,0,0,0,0,0,908,0,0,0,0,0,0,0,1261,0,0,497,1235,0,429,0,0,
+0,0,904,0,12,125,0,0,0,841,0,0,0,0,0,860,946,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,768,0,770,160,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,271,0,0,0,0,0,0,0,719,0,699,581,0,0,0,0,0,0,0,0,0,0,862,304,0,631,0,0,0,0,880,
+1513,0,0,0,0,0,981,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,434,0,0,0,0,0,550,0,0,476,930,
+824,553,0,0,452,0,151,0,0,0,0,0,0,772,0,292,135,0,0,0,0,0,0,0,504,0,0,1089,0,0,
+0,0,0,0,0,0,0,0,0,783,0,0,0,0,0,0,206,393,0,0,0,0,0,0,0,0,232,912,0,0,0,0,0,977,
+0,0,716,98,0,0,0,0,0,733,0,0,0,0,0,0,0,0,19,0,0,0,0,668,0,360,0,0,0,0,0,0,656,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,726,0,0,0,0,0,0,0,0,0,0,0,0,72,0,0,1269,0,0,463,0,
+0,0,0,0,0,1454,0,1287,245,0,989,0,0,0,0,0,0,0,0,0,107,164,0,0,0,0,0,0,0,1061,0,
+0,0,0,2,484,0,0,0,0,0,0,0,1127,0,0,0,0,0,0,0,460,0,0,0,0,0,932,0,0,0,0,0,0,0,
+588,625,0,0,0,0,76,92,0,0,0,0,0,0,0,0,0,0,0,0,0,104,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+763,0,622,0,0,0,253,0,546,0,0,110,0,256,916,0,0,35,212,0,0,746,0,0,0,150,0,0,
+1466,0,0,0,1299,0,0,0,0,0,0,0,0,0,1518,0,0,0,0,0,0,0,0,0,0,0,0,0,1229,0,0,0,816,
+0,0,0,0,0,0,159,0,0,0,0,0,734,869,126,1716,0,0,0,0,0,0,202,232,0,0,0,0,212,0,0,
+0,0,0,111,1003,0,0,0,0,0,0,0,0,0,0,0,1712,0,0,216,0,0,0,0,516,0,0,0,0,0,650,0,0,
+0,0,57,99,0,0,0,0,300,574,0,0,0,0,1023,0,0,302,0,1871,0,728,252,0,0,461,0,0,0,
+323,0,0,0,0,0,0,775,461,0,0,0,0,0,0,172,0,0,464,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,73,727,0,1023,0,0,0,0,0,0,0,0,0,0,577,0,0,0,0,0,0,0,0,1037,0,0,0,0,0,0,
+0,0,280,677,0,0,0,0,0,0,0,0,0,0,0,799,0,0,0,0,159,0,446,1730,0,0,0,0,0,0,0,0,0,
+395,0,0,0,0,145,0,0,0,0,0,0,0,20,0,0,426,608,0,0,0,0,0,977,0,250,0,0,0,0,0,100,
+0,0,0,0,1982,0,0,0,0,0,476,0,0,0,0,0,0,594,76,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,447,0,0,0,0,526,0,0,14,1124,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,188,0,0,0,0,0,0,0,0,362,301,0,0,0,1743,0,178,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,872,0,831,0,0,208,202,0,0,0,0,0,0,0,1954,0,
+0,0,0,516,872,0,0,313,224,0,0,24,0,11,546,0,0,0,1937,242,241,46,0,0,0,830,1273,
+0,0,0,0,0,0,0,825,327,1006,0,0,0,0,0,1580,516,366,0,0,0,0,0,1736,0,0,0,0,0,0,0,
+0,0,0,0,1935,0,826,0,0,0,0,139,331,0,0,0,0,0,0,0,0,0,0,0,288,0,916,0,0,0,0,0,
+1888,0,0,0,0,0,0,0,1471,0,1570,0,394,0,0,0,0,0,0,0,1931,0,1719,0,658,228,0,0,0,
+0,0,374,0,0,0,0,735,0,0,0,0,0,0,323,498,0,1063,0,0,0,0,155,0,0,0,0,0,0,0,0,906,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1139,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,108,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,616,
+902,0,0,0,0,0,692,0,0,0,0,0,0,823,0,0,0,305,0,0,0,0,0,0,0,681,0,0,0,0,0,214,
+1004,0,0,0,0,0,0,0,23,0,0,1703,0,0,0,0,0,0,0,0,0,1443,0,0,19,714,0,0,0,0,64,737,
+0,0,345,1758,0,0,579,47,0,0,539,139,0,0,0,0,388,0,0,0,0,253,0,0,0,0,0,0,252,0,
+745,0,0,0,0,0,0,0,0,0,0,0,504,107,0,871,0,0,0,229,0,0,0,0,0,903,0,0,71,0,0,549,
+6,47,0,0,0,0,0,0,0,0,0,980,865,705,0,0,0,161,0,0,0,0,143,1331,0,0,0,1388,33,724,
+0,0,0,19,0,0,0,395,0,0,0,0,0,846,210,0,0,0,122,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,695,937,497,0,0,0,0,0,718,0,0,0,0,0,0,0,1581,0,
+0,0,0,0,0,161,49,0,0,0,0,0,0,0,0,0,597,0,0,0,1094,0,0,0,811,908,0,0,0,0,0,0,0,0,
+0,0,1471,0,0,0,0,0,0,0,0,0,0,42,1935,0,0,0,2014,66,2007,0,0,586,0,0,0,0,0,0,0,0,
+0,28,1077,0,0,0,1221,0,0,62,0,0,0,0,0,0,0,0,0,0,1766,0,0,0,0,0,0,0,0,0,0,0,0,25,
+0,499,1388,0,0,97,10,0,0,0,0,0,481,0,0,0,0,0,0,0,0,0,0,37,134,155,486,0,1442,0,
+0,0,0,0,591,0,0,0,0,0,0,310,1173,0,0,0,0,409,1156,0,0,0,482,0,0,263,926,0,0,0,0,
+0,0,0,0,0,0,0,0,0,804,0,0,0,0,0,0,0,0,0,0,0,0,0,1265,0,415,0,348,0,0,0,1012,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,165,1803,0,0,0,0,0,0,0,408,
+0,0,0,0,0,0,257,1321,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1138,0,0,0,249,0,
+0,0,576,0,0,0,0,231,0,0,0,288,0,0,0,0,0,0,0,0,0,433,1487,569,1678,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,87,0,0,0,0,0,779,538,0,0,0,413,0,0,0,
+0,0,0,0,0,0,0,495,0,0,0,0,0,191,54,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,530,567,
+0,0,0,0,0,1484,0,0,0,0,0,0,815,609,0,0,0,0,0,484,0,0,0,0,0,0,0,0,0,0,900,0,0,0,
+0,1335,0,1724,0,0,0,0,0,0,0,0,0,0,0,640,0,0,0,0,0,0,0,0,0,0,0,1831,0,0,0,0,0,0,
+0,0,0,0,0,0,0,474,0,0,0,0,0,0,0,0,0,1103,0,1504,655,1034,0,0,0,0,0,305,0,0,0,0,
+0,0,0,0,0,1236,0,0,429,217,0,0,0,0,739,278,0,0,0,0,0,0,0,708,0,0,0,0,0,1840,233,
+0,0,0,0,0,0,0,0,2017,0,0,0,0,0,1488,0,0,0,1590,0,0,0,0,0,1800,28,0,0,0,0,0,0,0,
+0,0,45,0,36,0,22,1442,378,0,0,0,0,0,0,1507,0,0,0,0,0,0,0,0,0,0,39,0,0,1054,725,
+1955,0,2036,0,0,0,0,0,0,0,0,0,0,896,1871,0,0,0,0,0,0,0,0,0,0,805,0,0,0,0,2046,0,
+0,0,0,17,712,0,617,55,320,271,0,0,0,0,0,0,0,0,0,445,0,184,103,0,0,0,0,0,0,0,0,
+659,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,676,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+337,0,0,0,506,0,0,0,0,0,843,77,0,458,0,0,0,0,0,1420,382,109,142,330,0,0,0,0,0,0,
+0,0,0,0,0,0,87,0,0,0,492,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1239,0,0,0,0,0,0,
+211,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1049,0,321,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,1985,0,0,122,0,0,234,0,0,0,1098,0,0,0,0,0,0,549,253,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,522,131,0,0,149,0,0,0,0,0,0,0,0,0,0,0,0,0,0,507,0,0,0,0,811,630,0,0,0,343,
+0,0,0,0,0,448,591,455,0,1381,0,0,0,0,0,0,0,575,0,0,0,0,0,1175,0,0,0,0,0,0,0,0,0,
+653,0,0,0,1761,0,1198,0,0,0,0,297,1127,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,678,0,0,
+164,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,35,0,45,0,0,0,0,0,121,0,0,0,0,0,0,
+0,0,125,0,0,0,1622,0,0,0,0,0,721,145,0,0,0,970,792,0,0,0,715,0,0,0,0,0,1999,0,0,
+74,531,0,0,65,0,0,0,105,220,0,0,0,0,0,0,0,960,0,0,0,0,0,0,428,19,0,0,401,96,0,0,
+0,0,0,1595,116,0,1021,0,0,0,0,0,750,1961,0,0,148,0,0,0,0,0,0,0,0,0,0,0,0,0,75,0,
+0,1383,0,0,0,0,0,0,0,0,0,0,0,0,0,0,779,0,0,0,0,0,0,0,0,598,0,424,0,0,0,0,0,0,0,
+1222,0,0,0,876,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,133,0,0,0,0,187,0,8,0,0,0,0,0,
+0,0,429,0,685,0,0,0,0,0,0,0,0,0,0,0,132,472,0,0,0,0,0,0,0,0,0,938,0,0,874,0,0,0,
+0,0,774,0,0,0,0,0,92,0,0,0,0,0,0,830,701,0,0,0,0,0,426,350,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,603,59,0,0,0,0,0,0,0,0,0,0,293,0,0,0,0,0,0,0,0,0,0,0,0,0,0,441,163,4,0,
+0,0,0,0,0,0,0,0,806,0,0,0,0,0,0,233,0,0,0,0,1994,0,1739,0,0,393,0,47,1038,0,0,0,
+309,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,363,0,0,0,175,0,0,0,0,0,0,0,666,
+0,0,1675,0,1600,0,0,0,808,0,0,0,0,0,0,0,0,0,0,0,280,54,0,0,0,0,0,0,0,0,421,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,249,0,0,103,254,0,262,1,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,805,0,0,0,0,0,0,0,0,0,1630,0,0,0,0,0,0,0,0,0,0,0,0,0,671,972,989,0,0,
+0,0,0,0,0,889,0,0,0,1382,0,0,0,0,0,0,0,775,0,0,0,0,0,0,0,0,0,0,388,202,0,0,0,0,
+16,560,0,0,0,841,0,0,566,0,0,0,938,0,0,0,0,0,0,0,0,0,0,912,0,0,0,1361,0,0,0,0,0,
+0,618,236,0,1854,0,0,318,190,0,1376,0,0,0,0,0,0,0,349,0,0,0,0,951,1972,0,0,0,0,
+0,0,344,0,0,0,0,0,0,0,0,850,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,910,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,0,163,85,0,487,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,145,0,83,0,0,1013,0,0,0,1922,0,0,169,557,66,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,1193,82,0,352,454,57,0,0,1333,396,107,0,370,0,0,0,0,0,0,0,0,0,204,0,0,0,
+0,0,1706,0,0,0,0,0,0,0,0,0,0,0,0,394,1204,0,0,0,0,0,1007,0,0,0,1696,0,1519,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,981,0,0,0,0,1072,0,0,0,712,0,1629,0,0,0,0,0,0,0,728,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1271,0,0,0,1608,16,0,0,0,0,485,0,0,0,0,0,0,
+153,27,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1991,0,0,0,0,0,0,0,0,52,0,21,0,
+0,0,0,0,0,0,0,0,819,0,0,0,0,0,917,0,0,0,0,784,0,0,0,0,135,0,0,0,0,0,454,0,0,0,0,
+0,0,0,0,0,852,1719,0,0,0,0,0,852,0,0,0,0,0,952,0,0,0,0,568,0,0,0,0,0,448,0,0,0,
+67,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1826,657,0,729,666,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+669,0,0,0,0,0,0,0,402,0,0,152,0,0,0,0,912,0,0,0,0,0,0,51,320,0,445,0,0,0,0,308,
+0,0,0,0,0,386,0,0,239,0,0,130,83,0,143,0,348,0,0,0,0,0,0,0,958,0,0,0,0,0,210,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,430,0,0,0,0,0,0,0,0,0,0,0,0,7,213,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,801,0,0,0,0,0,0,0,0,0,936,0,108,0,0,
+0,0,0,0,0,0,0,885,587,219,398,364,0,1165,0,0,342,241,303,0,0,0,0,0,0,0,0,0,0,
+1454,0,0,0,0,0,0,0,0,0,0,254,562,0,786,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1294,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,493,216,0,0,0,0,219,341,0,0,0,0,0,
+0,0,0,0,0,130,1734,154,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,701,604,0,0,879,0,195,
+666,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1669,0,0,0,1791,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1228,0,0,0,0,0,623,0,0,0,0,0,0,0,798,0,0,0,0,0,0,0,0,0,0,0,0,84,
+122,0,0,0,837,0,0,0,0,0,0,1013,0,0,577,0,0,0,460,932,0,0,0,0,0,0,0,0,0,0,0,31,
+131,0,0,0,605,0,0,0,1246,0,0,0,0,68,278,165,307,781,0,0,0,0,0,0,33,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,1113,0,0,720,1953,203,0,0,0,0,0,0,0,425,326,0,0,0,0,0,
+0,0,0,0,0,241,1316,0,0,0,0,0,416,0,0,0,1300,0,847,0,0,662,358,0,0,0,0,839,1823,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,654,1522,0,0,0,0,0,0,163,0,0,0,0,0,314,978,0,0,0,
+601,0,0,0,0,0,946,434,0,0,0,402,411,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13,1467,
+410,0,0,0,0,0,0,0,0,0,0,0,0,0,0,483,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,677,0,0,0,0,0,0,0,0,0,0,0,0,70,0,0,0,0,1405,0,0,0,0,0,0,108,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,777,0,0,0,0,0,747,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,68,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,505,0,326,0,0,164,628,654,0,0,0,
+37,32,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,668,152,0,0,0,0,0,0,0,0,0,0,0,581,
+0,0,0,0,44,126,89,0,0,0,0,0,0,0,0,1531,0,0,0,0,0,0,0,0,203,1167,0,0,0,0,0,0,0,0,
+531,1232,0,0,0,0,0,943,0,670,231,880,0,1617,0,0,0,1957,0,0,0,0,0,0,0,975,0,0,0,
+0,0,0,0,0,0,0,0,242,0,0,0,0,0,0,0,0,0,421,0,0,14,834,0,0,0,0,0,0,0,0,0,0,0,0,
+465,0,0,0,0,0,834,688,413,855,0,0,0,590,0,0,0,0,0,0,0,0,114,0,0,0,0,0,0,0,0,0,0,
+0,45,169,0,0,0,0,0,0,0,0,0,0,0,198,0,0,565,585,0,0,0,0,0,0,0,0,0,0,0,0,0,691,0,
+0,0,593,0,0,0,0,0,0,0,0,0,913,116,0,0,0,0,1360,0,0,0,802,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,673,308,0,709,1006,1895,0,228,0,0,0,1840,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,608,0,0,0,0,0,0,0,0,0,1573,0,2039,136,540,0,0,0,0,0,0,0,
+897,0,0,938,1878,0,0,0,0,0,0,0,0,0,1469,0,999,0,299,0,0,0,0,0,0,0,578,0,0,0,0,0,
+456,0,0,0,1679,163,693,0,0,0,0,0,0,48,755,0,0,0,0,0,0,0,0,0,0,0,0,338,0,0,0,0,
+1091,0,0,0,0,695,0,0,1464,0,0,0,0,0,975,0,0,335,0,0,1979,0,0,0,0,269,1566,630,
+396,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1815,634,0,0,0,966,0,0,0,0,0,0,0,9,
+412,0,958,0,0,579,382,0,212,0,0,0,0,965,681,0,0,16,0,0,0,0,0,0,0,0,0,0,0,0,655,
+0,0,0,0,67,0,0,0,0,0,0,751,0,0,0,0,423,231,0,0,1016,300,0,0,0,0,100,237,0,0,0,
+1370,0,0,0,1208,0,0,0,0,0,1219,129,0,0,0,0,0,0,0,0,0,0,0,0,0,0,199,0,0,427,0,0,
+0,0,949,665,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,712,0,0,0,0,0,1186,0,0,0,0,0,0,0,0,0,0,295,312,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+151,0,0,0,0,588,4,0,0,0,0,0,414,104,0,0,757,263,0,561,0,0,0,320,0,0,0,0,0,0,0,0,
+0,0,0,225,0,0,0,0,37,817,0,974,0,0,0,0,0,0,0,0,0,0,0,0,0,2026,131,235,16,0,590,
+1157,0,0,0,0,0,0,0,0,221,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,140,390,0,0,0,0,
+0,0,0,1144,0,0,0,464,0,0,0,0,0,0,0,0,0,0,0,0,204,407,303,1218,0,0,0,0,5,325,0,0,
+0,0,12,800,0,1783,0,0,0,0,0,0,0,0,0,0,504,621,0,0,0,0,0,0,0,0,0,920,0,376,0,0,0,
+0,0,218,580,0,768,454,0,0,0,0,0,0,0,0,0,0,0,0,676,0,0,0,0,0,0,164,0,0,0,0,0,0,0,
+0,50,0,0,0,0,0,0,0,0,0,0,0,0,0,120,285,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,226,343,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,29,0,0,1812,0,0,8,0,0,0,21,1125,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,1327,0,0,0,0,575,1598,0,0,0,0,0,0,0,0,0,895,0,0,0,959,0,0,
+0,0,0,1759,173,0,0,0,0,266,261,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,1427,0,0,300,1033,0,0,0,0,0,0,0,0,0,0,0,584,0,0,0,0,52,734,
+0,0,217,239,0,1129,0,0,0,0,0,0,0,0,732,20,0,0,0,0,0,0,0,0,0,0,0,418,0,0,0,613,0,
+0,0,0,0,0,0,0,0,632,0,0,85,984,0,0,0,0,909,694,7,1109,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,167,0,0,0,0,280,62,0,0,33,0,0,359,186,980,0,0,0,0,0,0,0,0,0,0,0,585,0,0,0,
+211,0,0,336,145,0,1130,0,873,0,0,840,263,0,0,0,0,0,0,0,0,0,916,0,0,0,0,0,0,0,0,
+0,0,155,0,0,0,461,97,0,0,0,0,0,1356,0,0,0,0,0,0,0,593,0,0,0,0,0,1392,0,0,0,0,
+126,0,0,0,0,1179,0,0,0,0,0,162,0,0,0,0,0,765,0,187,0,1286,0,0,0,0,0,0,0,0,0,635,
+0,0,23,215,0,0,0,1306,0,0,97,716,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,657,0,
+0,0,0,0,0,0,0,299,0,0,0,0,0,0,134,0,0,0,0,0,0,0,0,0,0,0,658,1082,0,0,0,0,0,2002,
+0,0,0,0,0,0,833,248,0,0,0,0,0,1654,0,0,531,0,0,0,0,0,0,634,0,0,0,0,0,0,0,0,0,
+853,573,249,0,0,0,0,0,0,0,0,527,0,0,0,0,1419,0,0,0,0,0,0,20,49,0,0,0,992,0,0,0,
+728,0,0,0,0,0,0,0,0,0,0,0,0,497,1579,0,0,0,0,62,268,0,0,0,0,0,0,0,1201,0,0,0,0,
+0,0,0,0,0,0,0,0,495,193,0,0,0,0,106,0,0,859,0,0,23,0,0,0,0,0,0,0,813,925,0,0,
+223,613,953,0,0,0,0,0,0,0,0,666,0,0,0,0,0,0,0,0,0,670,0,0,40,216,0,0,0,0,0,0,
+259,0,0,0,440,1114,0,0,0,0,0,0,0,0,74,475,0,0,188,139,0,797,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,1572,0,0,0,0,39,0,0,0,0,0,0,0,0,0,0,0,0,1594,0,0,0,0,0,0,0,290,0,232,
+0,0,887,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,521,14,0,0,0,0,0,741,0,0,0,992,0,
+0,0,0,0,0,0,0,111,0,0,425,0,0,0,0,0,789,0,0,0,1593,0,1768,0,0,233,0,0,0,0,943,0,
+0,0,0,0,0,0,955,225,245,0,0,0,0,0,0,241,0,0,0,0,1943,0,0,0,1284,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,709,0,0,0,0,0,0,554,0,0,0,0,0,0,0,0,1564,0,0,0,
+443,0,0,0,0,0,0,280,0,0,0,0,0,0,0,0,729,0,0,0,348,0,0,0,0,0,0,0,758,848,298,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,829,1422,189,121,0,0,632,812,0,0,556,0,0,0,0,0,436,172,
+530,844,232,984,0,0,0,0,0,0,0,0,0,0,147,0,0,0,0,0,0,0,0,537,0,0,0,0,0,859,0,0,
+842,0,0,0,0,0,0,0,0,0,0,1291,0,0,0,0,0,0,0,0,0,0,0,1482,612,392,0,0,0,262,31,0,
+0,0,0,0,0,0,0,0,0,753,549,0,0,0,0,0,0,696,0,0,0,0,0,0,0,834,0,0,0,0,0,771,0,0,0,
+0,0,0,0,0,0,0,0,0,0,921,0,0,0,674,0,0,0,0,0,0,0,0,0,0,308,444,0,0,0,0,0,0,805,
+180,0,0,278,271,0,0,214,505,0,1215,0,0,0,0,0,0,387,271,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,1645,42,92,0,459,0,0,330,1557,0,0,0,0,0,0,0,0,113,18,0,0,0,
+1742,0,0,0,965,0,0,0,0,0,0,0,0,0,0,0,0,0,182,0,0,65,0,0,0,0,0,0,0,0,0,0,0,0,973,
+0,0,0,0,0,328,0,0,588,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1786,
+0,0,962,1985,0,0,0,308,508,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,588,0,0,0,0,0,0,614,793,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,290,0,0,0,0,0,0,0,0,0,0,1136,0,0,0,0,0,0,0,0,0,0,796,719,0,0,
+326,210,0,0,0,701,758,472,0,0,0,1947,278,1079,0,0,0,0,0,0,497,41,0,0,634,46,961,
+0,810,524,0,0,33,0,0,0,0,0,0,0,0,0,0,0,0,532,0,997,0,0,0,0,0,0,0,0,0,0,0,1301,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1298,0,671,0,0,0,306,0,0,0,0,0,0,0,0,0,0,
+693,1823,0,0,0,759,0,0,0,0,0,1932,0,0,0,0,0,0,0,0,0,0,0,0,0,0,88,182,0,0,0,1964,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,521,0,0,0,0,0,0,424,857,0,0,0,0,671,328,0,
+529,0,0,0,0,0,716,0,1509,80,67,0,0,0,0,59,141,0,0,0,0,0,0,783,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1498,0,0,0,0,343,430,803,1183,677,
0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,19817,0,5579,9350,0,0,21002,19718,0,0,0,21926,0,0,0,0,0,0,0,0,0,0,0,0,0,20711,
-0,0,0,20197,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,40550,0,0,0,57510,0,0,0,53895,
-0,0,15017,0,17000,39367,2347,0,0,0,0,0,0,0,0,0,8588,0,0,0,0,0,3273,17862,3498,
-2085,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19048,0,0,0,0,0,11978,58631,0,0,0,0
-,0,0,523,0,12969,198,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28197,0,47846,0,0,0,0,0,0
-,0,0,0,4549,0,0,0,0,0,0,0,0,0,0,687,14917,748,8229,0,0,0,0,0,0,2476,12935,0,0,0,
-0,0,0,22792,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27528,59142,0,0,20876,20134,0,0,0,
-0,440,12068,0,58951,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,48038,0,0,0,60999,0,0,0,0,
-0,0,0,0,0,0,0,0,0,15716,7498,5476,0,0,0,0,20202,37959,0,0,0,0,0,0,0,0,0,0,0,0,
-29801,0,5451,0,0,0,0,0,0,0,0,0,0,50790,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24485,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13573,0,0,22856,0,0,0,0,21927,0,0,0,0,0
-,0,9130,0,0,0,0,0,0,13732,0,0,0,0,0,0,0,0,0,0,2282,583,0,0,0,0,0,0,0,0,0,0,3726,
-26503,0,0,0,0,0,0,9258,0,0,0,0,0,0,0,0,21604,0,0,0,45574,0,0,0,0,0,20710,0,0,0,
-42694,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1163,6694,0,0,0,0,0,0,0,10948,0,0,0,29700,0,0,
-0,0,0,58823,3796,27399,20939,10180,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-19,29287,28649,14534,0,0,16428,45607,0,0,0,0,0,0,25322,0,4908,0,0,0,0,0,0,25476,
-29097,14246,11053,0,0,0,0,0,0,0,0,18502,0,0,0,44390,0,0,0,17765,0,0,0,0,0,0,
-24520,0,0,0,0,0,0,0,0,0,0,17319,0,0,0,0,0,0,0,0,0,0,0,0,0,28166,0,0,0,0,0,48198,
-0,0,31467,0,24585,0,0,0,0,18692,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23596,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,7236,968,13637,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-3763,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14791,0,0,0,12324,0,12741,0,0,0
-,0,0,0,0,0,0,11108,0,0,0,0,4009,40295,20616,4357,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-15015,0,0,0,0,0,43751,0,0,0,0,0,0,0,0,0,0,0,23013,0,0,0,0,0,0,0,0,0,0,0,0,0,
-45542,0,0,0,0,0,0,0,0,0,23974,0,0,0,0,17480,20647,0,0,0,0,0,0,8876,0,0,40806,0,0
-,0,0,0,0,0,14502,17160,17764,0,0,31594,35431,0,0,2890,0,0,0,0,0,0,0,0,27524,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8228,0,56583,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,34278,0,0,0,0,0,0,0,0,0,0,0,0,0,2662,0,26724,0,0,0,0,0,0,0,64198,0,0,0,
-0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22281,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3049,
-54983,0,0,0,0,0,0,0,837,0,17604,0,0,0,0,0,28838,0,0,0,0,0,0,26312,0,0,3910,0,0,0
-,25830,0,0,0,0,0,8391,0,19845,19240,1092,0,0,5449,0,0,0,0,17188,0,0,0,0,0,0,0,0,
-0,10629,0,0,6671,61094,5832,8358,0,0,0,55078,0,0,0,0,0,29860,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,51494,0,28647,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,25989,0,0,30153,61318
-,0,0,0,0,0,0,0,24903,0,0,0,4388,0,42054,0,0,0,0,0,0,0,53158,0,0,0,0,0,0,0,50918,
-0,0,0,0,0,0,26251,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5929,2853,0,37126,
-7372,197,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,2027,934,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,55686,0,0,5672,5447,0,62758,0,0,0,0,0,0,0,0,0,0,0,0,2923,0,556,1415,
-0,0,0,0,0,0,0,0,0,8645,0,9477,0,0,0,0,0,0,0,48742,0,0,0,0,0,0,0,0,0,0,24235,228,
-0,0,0,0,0,0,0,0,0,0,16970,18823,0,0,0,0,0,0,0,0,0,25158,0,0,0,0,0,18567,20072,
-2823,14313,1830,0,0,0,0,0,0,0,0,27048,23526,0,0,0,0,0,997,492,0,14730,16677,396,
-13574,0,0,0,41671,0,0,0,0,0,0,0,19045,0,0,0,421,17545,3110,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,47111,14475,56551,0,0,0,0,0,0,0,0,0,0,3697,0,0,0,0,0,0,49382,0,35559,0,
-0,0,0,40,0,11496,15621,0,8550,0,0,0,63462,0,0,0,0,0,0,0,36966,0,50406,0,46022,
-1001,0,0,12069,3249,0,0,0,0,0,0,0,0,0,0,0,0,0,15241,0,0,0,0,0,0,0,0,64743,0,0,0,
-0,0,58759,0,0,0,0,1136,26981,0,0,0,0,0,0,0,17732,0,0,0,17157,20011,6629,0,43879,
-0,0,0,13572,25128,10759,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28676,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,875,24007,0,0,0,0,7628,0,0,0,0,0,12268,0,0,0,0,0,0,0,0,19300
-,23210,356,0,0,0,0,0,0,0,0,0,15236,0,0,0,0,0,49670,0,0,0,0,0,0,0,21764,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,13931,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,45799,0,0,436,3589,
-0,0,11402,0,0,0,0,0,0,0,0,0,0,62822,0,0,0,39814,588,0,0,0,0,0,0,27750,0,0,0,0,0,
-0,1609,22660,2346,18951,0,16068,0,0,0,0,0,0,5162,11110,0,0,0,0,15048,1060,0,7879
-,18280,326,0,14886,19656,0,7594,0,0,0,0,0,781,581,0,16198,0,0,0,0,0,0,1078,9892,
-0,0,0,0,0,0,0,0,0,0,4489,0,0,0,0,33798,0,0,0,54534,0,0,0,0,0,0,0,33158,0,0,0,0,0
-,0,0,0,0,42086,13834,2757,8456,16773,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,3434,0,0,0,
-0,0,3946,29668,0,0,30634,36775,0,0,0,0,0,24901,0,16069,6280,0,0,0,0,41990,0,0,0,
-0,0,0,0,27365,0,0,0,0,0,0,0,0,0,0,1450,44807,0,0,0,32100,0,0,0,0,0,35110,0,0,0,0
-,0,0,0,0,17448,19591,0,0,0,0,0,0,0,0,0,0,0,0,1739,0,0,0,0,5511,0,0,0,32934,0,0,0
-,0,0,0,0,0,0,18180,0,0,0,23428,19754,0,0,31174,3021,31655,23464,0,0,0,0,0,0,
-57255,0,0,21292,64487,0,0,0,0,0,0,25802,9189,0,0,0,0,0,49254,0,0,0,0,0,0,0,0,0,0
-,5837,50023,0,0,0,0,0,0,0,0,0,15495,0,0,0,0,0,51942,0,0,0,0,0,0,0,0,28104,58662,
-0,50214,0,0,0,0,0,0,0,0,2988,0,22888,31812,0,0,0,0,0,2020,0,18916,0,0,0,0,0,0,0,
-23973,0,0,0,0,17516,11717,0,0,0,55911,0,0,0,0,0,0,0,2855,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,46822,0,24710,28586,0,0,0,1556,0,0,30117,0,0,22090,57127,3403,14087,0
-,0,0,0,0,0,0,0,0,0,1041,0,10633,6916,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27269,0,0,13322,18055,0,29380,0,56454,0,0,120
-,0,0,8773,0,0,0,0,16040,0,0,0,0,0,0,0,27242,23781,0,1572,0,28134,0,0,1512,0,0,0,
-0,0,0,27684,0,38470,0,0,0,0,0,0,1513,8709,0,0,0,0,0,0,0,0,0,0,0,46566,0,0,0,0,
-28521,61159,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24356,0,0,0,0,0,0,0,0,0,13028,0,
-5863,0,0,15693,0,0,0,0,0,0,0,1131,23398,0,0,0,0,0,0,0,26212,0,0,0,0,0,0,0,0,0,0,
-0,0,0,18404,0,0,0,0,1457,26183,0,0,2475,7110,0,0,0,0,27180,60166,0,0,0,20262,0,
-41862,0,0,0,0,0,0,0,0,0,0,2762,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26148,0,0,0,0,0,0,0,0
-,0,28229,0,0,0,29254,0,0,0,0,0,0,0,0,0,0,27690,0,0,13636,12776,1862,0,0,0,0,0,0,
-17225,3271,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28039,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,4457,18117,0,2023,402,0,0,0,0,0,0,0,0,0,0,0,0,0,104,3654,0,0,
-0,0,0,0,0,0,18440,0,0,0,0,0,0,0,0,29861,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,22150,0,0,0,0,0,0,0,0,0,0,0,0,24074,0,0,0,0,0,0,0,0,12004,0,32358,
-0,0,3081,0,0,0,0,0,0,0,0,0,4749,0,0,0,0,0,0,0,0,0,0,0,10792,1799,21322,0,7880,
-12613,0,0,0,0,0,0,0,0,13993,0,0,0,16202,0,0,0,0,32102,0,37223,0,10500,0,0,0,0,0,
-0,0,0,32008,0,0,0,0,0,23816,3236,0,0,0,0,0,23237,0,0,5642,0,4684,294,0,0,0,0,0,0
-,0,0,0,0,0,0,0,0,0,0,0,0,0,26852,0,0,0,0,0,0,7148,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
-0,0,0,0,0,0,0,0,0,0,7890,61798,939,0,0,56679,0,0,0,0,0,27078,202,5029,0,0,0,0,0,
-0,0,0,0,28005,0,0,15273,24741,5676,20452,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,55910,0,0
-,0,0,5069,27942,0,21092,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12517,0,0,0,0,0,0,
-0,0,0,0,0,0,21384,28260,0,2502,20108,0,0,0,0,0,0,0,0,0,0,0,0,46726,0,30790,0,0,0
-,0,0,14725,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1099,6372,0,0,0,12422,15182,0,8683,0,
-10665,19462,0,0,0,0,0,0,1590,0,31628,0,22632,19750,0,0,0,0,0,0,0,24198,0,0,0,0,0
-,50662,0,0,0,0,0,0,0,0,0,0,9131,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11015,0,0,0,0,0,0,0,
-0,16490,54695,0,0,0,0,0,0,0,0,12937,0,0,0,0,16004,0,0,0,0,0,0,0,0,0,2181,6923,0,
-0,0,0,0,0,0,15624,11302,0,0,5673,7559,0,0,14668,15684,0,0,0,0,0,0,24204,48134,0,
-24230,0,55527,0,0,3464,19141,0,0,0,0};
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1357,53,0,0,0,0,590,0,0,0,0,0,0,0,0,0,0,
+0,0,0,329,0,0,0,0,0,0,0,469,0,0,0,0,0,0,0,0,0,0,460,0,0,1743,0,0,963,340,0,0,0,
+0,0,1603,0,0,250,0,0,0,0,0,646,218,0,1794,0,0,0,571,0,455,0,0,0,1012,0,0,0,0,0,
+0,0,0,0,0,0,0,597,161,0,349,0,524,0,0,0,0,0,0,0,0,0,0,0,0,322,432,0,0,0,0,0,0,
+325,223,0,0,0,0,0,566,0,0,0,1394,481,436,0,48,457,610,756,618,0,0,0,755,0,1217,
+0,0,0,0,0,197,0,0,0,0,0,0,0,0,0,0,0,0,0,0,544,492,107,414,0,0,0,0,0,0,0,0,0,0,0,
+1007,0,0,0,0,5,0,0,1580,0,0,0,0,0,0,0,0,0,0,0,0,0,673,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,1843,0,0,0,0,0,0,0,0,0,165,0,0,0,0,0,0,809,885,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,498,0,0,0,306,9,0,0,0,0,0,0,0,437,721,146,0,0,0,0,0,0,0,0,0,0,0,177,0,0,0,0,
+0,0,0,1377,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,200,0,959,0,0,0,1928,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1435,0,481,0,0,0,0,0,0,142,84,0,0,0,0,0,
+1015,0,0,0,315,0,0,0,0,0,0,759,0,0,0,0,0,0,0,0,712,0,0,0,1722,0,0,0,0,0,0,0,0,0,
+0,0,0,222,0,985,1414,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1273,
+538,706,0,0,0,0,0,0,0,0,115,0,0,0,0,0,0,0,0,0,0,1781,0,0,0,0,0,431,97,665,42,
+237,0,0,0,264,0,0,213,0,0,0,0,0,0,0,455,0,0,0,906,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+624,0,574,0,0,0,0,0,0,0,0,0,0,0,0,354,0,0,0,1558,0,0,0,0,0,0,0,0,0,0,0,0,0,0,68,
+235,723,1813,0,0,0,957,0,830,0,0,0,0,0,0,0,0,0,0,0,0,23,0,0,496,0,0,0,0,0,0,0,
+547,239,88,0,0,0,0,0,0,0,0,0,1310,0,0,0,0,0,0,0,0,80,1076,0,0,118,0,0,0,479,274,
+0,0,0,0,0,0,0,0,0,0,0,497,0,0,669,261,0,0,0,0,13,0,0,0,0,0,0,791,250,642,0,0,0,
+1429,939,949,0,0,0,0,0,0,0,0,0,0,0,0,0,818,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,982,330,0,0,0,0,545,0,0,0,0,0,0,947,0,1188,0,0,0,0,0,904,0,0,0,0,0,1372,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,693,377,0,0,0,0,0,0,0,0,0,0,0,0,0,0,695,0,0,
+713,386,0,0,0,0,128,1575,0,0,0,0,0,0,424,893,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,904,0,0,0,0,0,552,322,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,28,1808,49,0,0,0,0,
+1832,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,421,0,0,442,415,0,0,289,
+0,0,0,0,0,206,110,0,0,0,0,0,205,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+19,1539,0,0,0,0,0,1340,0,1194,0,0,0,0,0,0,0,0,549,0,0,0,0,0,0,0,0,1720,0,0,0,0,
+0,0,0,0,0,319,0,0,0,0,112,1180,0,0,0,0,0,0,0,0,0,0,0,967,0,0,0,0,0,0,0,0,0,1940,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,735,0,0,0,0,0,0,0,0,0,897,132,0,0,0,0,0,0,0,
+0,0,0,38,838,0,0,0,379,218,8,660,1017,0,0,0,0,0,0,111,387,647,877,0,0,53,790,0,
+0,0,0,0,0,0,0,458,0,0,0,0,0,0,954,0,0,0,394,0,1367,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,882,0,0,0,0,0,0,0,1409,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,38,124,342,199,0,0,0,0,
+0,0,0,0,0,0,724,628,0,0,0,0,804,266,0,0,0,0,0,208,0,79,0,0,0,0,0,0,0,0,741,0,0,
+0,0,0,0,0,0,0,0,606,0,1494,821,1553,0,0,135,405,0,0,178,100,0,0,0,0,0,0,0,0,0,0,
+0,0,0,481,0,0,0,1378,0,0,0,0,0,0,0,0,0,0,0,0,0,791,33,1227,857,0,467,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,447,0,0,0,0,0,0,86,128,0,0,0,0,0,0,587,0,0,0,692,1018,0,
+195,0,0,0,0,0,0,0,1546,0,0,0,0,0,0,0,0,0,0,0,684,0,0,345,0,0,0,0,0,0,365,0,1683,
+0,0,472,0,433,0,0,0,0,0,0,0,28,0,0,0,997,0,705,3,0,0,0,0,0,0,0,0,0,229,0,0,0,0,
+102,0,0,0,0,866,1022,0,0,0,0,0,0,0,0,0,55,0,115,0,0,0,0,933,0,0,0,0,0,0,0,702,0,
+0,0,0,0,0,0,1728,26,484,0,0,0,185,618,417,0,803,0,0,0,0,0,0,0,0,0,0,0,1262,0,0,
+0,0,0,0,0,0,0,0,0,0,0,633,0,0,0,0,0,0,0,0,0,0,0,0,0,479,262,0,0,0,0,0,0,830,0,0,
+0,0,26,70,0,0,0,0,0,0,0,0,217,0,640,51,0,0,360,1586,0,0,0,0,0,652,0,0,0,0,0,766,
+0,0,0,0,298,737,0,0,0,0,0,0,0,0,0,0,655,222,906,0,0,1013,991,2009,0,0,0,0,503,0,
+0,0,216,154,0,0,0,716,0,844,0,0,0,0,621,252,0,0,0,0,748,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,103,0,2,0,0,0,0,0,0,0,0,0,0,0,0,0,0,576,0,0,0,648,0,0,0,331,0,0,0,
+0,0,0,0,0,0,0,0,0,632,0,0,0,518,107,0,0,0,0,0,0,0,0,851,0,0,0,0,504,0,0,0,0,0,0,
+0,0,0,0,0,0,7,883,0,0,0,0,0,0,0,922,0,0,0,0,0,0,0,0,91,993,0,0,0,0,0,0,200,131,
+10,0,0,0,0,0,0,0,0,0,0,0,0,0,365,1433,0,0,0,0,28,103,0,0,798,1013,0,0,0,0,0,0,0,
+0,39,1925,0,853,0,0,271,519,0,0,0,0,338,0,0,300,470,419,0,0,0,0,0,0,836,0,0,0,0,
+0,0,1937,0,0,0,0,0,393,0,0,357,0,0,0,0,0,703,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,387,0,0,0,0,0,0,75,708,453,1351,0,303,0,0,772,0,0,0,0,0,0,0,0,749,0,0,
+0,0,0,0,0,0,0,0,0,0,0,1065,0,0,717,226,0,0,0,0,0,890,431,626,0,0,0,0,706,0,0,0,
+51,698,0,0,0,0,0,0,0,0,0,0,0,828,0,0,17,0,0,0,0,1929,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,84,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27,871,498,0,101,1793,0,0,0,0,0,0,435,0,
+0,0,0,0,966,0,129,1644,0,0,0,0,0,0,0,0,0,0,0,0,0,997,502,0,0,0,0,0,0,0,0,0,0,0,
+0,823,0,1927,0,0,0,0,98,1756,0,0,0,0,0,0,0,0,0,0,0,0,8,0,160,1046,0,492,0,0,0,0,
+0,0,129,45,0,0,0,0,0,0,353,558,0,0,0,0,0,785,0,0,0,1145,189,0,0,0,26,353,0,0,0,
+0,0,2024,0,0,0,606,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,32,855,0,0,0,0,0,0,0,0,0,0,0,
+0,0,2011,0,0,5,4,0,0,461,764,0,0,0,1449,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1445,0,0,
+0,1168,0,0,0,233,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,255,0,0,216,0,0,0,286,0,0,0,
+3,0,0,0,723,536,0,0,0,0,0,285,0,0,0,560,0,0,0,0,0,690,0,0,0,0,0,1246,0,0,63,0,
+33,0,0,0,0,0,520,1862,0,0,0,0,0,0,0,0,0,0,0,0,630,0,0,0,0,554,0,0,0,0,0,1001,0,
+0,0,0,0,446,0,0,0,0,0,0,0,1313,0,0,837,636,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,278,
+0,0,0,0,0,0,0,0,868,0,0,0,0,1010,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+1231,0,304,0,506,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,26,0,93,1408,794,
+843,704,0,285,114,485,898,145,0,19,2035,0,0,0,1933,0,0,0,0,0,0,0,1728,0,0,0,0,0,
+0,0,0,746,0,0,0,0,0,0,0,995,1964,0,0,0,0,0,0,0,0,0,0,0,1550,0,874,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,1018,0,0,0,814,126,0,0,1264,0,0,814,955,0,0,0,0,0,0,
+0,981,0,0,0,0,0,0,0,0,915,56,0,0,100,0,0,0,0,0,0,0,0,0,638,0,0,0,0,738,0,0,0,0,
+0,0,0,0,0,758,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1112,0,0,214,0,0,0,133,0,196,
+168,0,0,0,0,0,1152,0,1245,0,0,538,169,871,1816,0,0,413,133,0,0,0,978,0,0,43,93,
+371,0,0,0,0,0,0,526,25,0,754,335,0,0,0,0,182,0,0,0,0,0,0,0,0,0,0,0,39,601,0,0,0,
+0,0,0,0,181,370,0,0,1652,358,0,0,0,0,0,0,0,0,0,176,286,0,788,0,0,0,0,0,1223,780,
+254,1003,896,0,0,0,1447,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,744,0,0,0,0,0,126,0,
+41,788,0,0,0,629,0,0,0,0,0,0,0,0,0,0,0,293,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,420,37,1900,0,0,0,0,542,1570,957,0,0,0,0,0,0,
+0,373,31,0,0,0,0,125,325,0,0,0,0,0,0,323,0,0,1547,0,0,0,0,0,0,0,0,0,0,0,0,0,
+1216,0,0,0,0,0,0,198,1905,629,15,0,0,0,0,0,0,20,75,543,1353,0,0,0,533,0,0,6,0,0,
+0,0,0,0,538,0,0,0,0,0,0,0,0,0,0,0,338,0,0,0,0,11,0,0,0,284,659,0,989,0,0,0,0,0,
+0,0,0,0,848,0,0,507,0,0,0,0,0,0,0,0,188,991,884,0,0,0,0,60,959,0,0,0,0,0,1653,0,
+0,922,337,0,638,0,0,500,0,0,0,0,0,0,0,0,0,0,0,166,0,0,0,0,0,0,0,0,0,0,0,0,418,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,760,0,0,0,0,0,0,1277,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,770,0,0,0,0,0,0,0,243,89,0,0,0,0,0,0,0,0,0,1396,0,
+560,0,0,3,1658,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,586,0,0,1271,0,0,0,505,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,637,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1947,
+41,445,0,0,0,0,0,0,0,0,57,189,0,0,371,0,0,0,0,552,0,883,0,923,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,875,0,0,0,1788,49,0,0,0,0,0,
+0,0,0,0,0,0,661,0,0,1945,0,0,0,0,0,794,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,1135,0,0,0,745,0,0,0,0,0,0,0,84,0,0,0,0,0,0,0,410,0,976,0,0,0,0,0,703,0,0,
+0,0,0,0,187,322,0,0,0,227,0,0,0,0,560,0,31,1395,0,0,0,0,0,466,0,0,0,0,643,167,0,
+0,0,1428,0,412,0,0,0,0,0,0,0,0,0,1118,562,0,0,0,0,0,256,0,0,0,0,0,0,1771,0,0,0,
+0,0,1190,132,0,66,0,0,0,0,0,0,0,0,0,0,317,0,0,0,63,0,0,0,0,0,0,0,1475,0,0,0,0,0,
+0,0,288,0,0,0,0,608,0,0,0,0,0,0,0,0,1225,0,1189,0,0,0,0,0,0,0,1468,0,0,0,0,0,
+689,120,0,0,0,0,0,0,0,1,0,329,0,0,0,0,226,0,0,0,0,0,1855,0,0,461,0,0,0,0,1346,0,
+0,0,0,0,85,0,0,299,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1171,0,0,
+0,980,0,0,0,0,0,0,0,0,637,279,0,0,0,0,0,293,0,0,0,0,528,17,0,0,0,0,5,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,48,0,0,0,0,0,0,0,601,0,0,0,0,0,0,779,0,
+196,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1322,737,752,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,412,192,80,0,0,8,1470,0,0,0,0,0,0,0,0,0,873,0,0,0,0,0,835,0,0,0,0,256,
+38,986,0,0,0,0,0,0,0,0,0,91,257,278,911,0,0,0,0,0,0,0,0,749,151,0,0,0,0,0,0,0,0,
+0,0,0,0,989,0,0,990,0,0,90,194,0,0,0,0,0,425,0,0,0,0,0,774,0,0,0,0,0,0,0,0,0,0,
+646,827,752,0,0,0,662,0,22,21,0,0,0,0,0,0,95,239,0,0,0,431,0,0,0,0,0,874,0,0,
+265,65,0,0,0,1350,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1887,0,0,0,0,0,0,0,809,
+0,696,0,1074,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,630,0,0,802,0,0,0,56,776,0,
+970,0,0,797,0,0,0,0,0,400,0,0,1951,0,0,41,0,11,118,0,0,0,0,0,0,0,0,251,615,0,0,
+0,1044,0,0,0,0,0,0,0,0,0,0,0,225,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,370,0,0,0,0,
+104,48,209,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,930,0,0,0,0,
+0,0,0,0,0,0,0,1286,0,759,0,120,385,0,0,0,429,0,0,0,0,0,0,0,0,820,0,0,0,0,0,0,
+199,0,10,151,0,0,0,761,365,0,0,0,0,0,0,0,0,0,46,1086,0,0,0,0,11,1624,58,344,0,0,
+1008,1868,0,0,0,888,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,711,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,440,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,914,1913,0,958,0,885,0,0,0,0,0,0,0,0,0,0,0,
+0,0,847,276,0,302,65,0,0,0,510,0,1514,0,0,0,0,0,0,152,291,0,0,0,0,0,0,0,0,0,0,0,
+0,282,589,0,0,0,0,0,0,0,0,0,0,0,0,0,130,0,0,463,42,0,0,0,0,0,372,0,0,0,0,0,0,0,
+0,0,680,0,0,0,0,0,0,0,0,977,1997,0,0,0,810,0,0,0,0,0,0,0,0,0,1390,0,0,0,644,0,0,
+867,982,0,0,0,0,0,0,0,540,0,123,0,0,0,1978,0,0,0,0,789,623,0,1723,0,1220,0,0,0,
+0,0,0,0,480,0,0,0,0,0,0,0,0,0,0,0,888,0,0,0,0,0,0,0,0,0,0,0,0,299,1995,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,788,179,0,0,0,0,0,0,431,156,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1373,39,80,196,0,0,507,0,0,0,646,0,0,0,0,
+0,1214,0,0,0,0,926,0,0,0,1,114,0,0,0,0,0,446,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,490,0,0,0,491,0,1584,0,0,507,250,0,0,0,158,
+10,362,1,0,0,0,0,0,0,0,0,0,408,228,860,480,0,779,0,0,0,557,0,0,142,197,0,0,0,0,
+0,0,0,0,0,0,0,1490,11,378,316,1057,0,0,18,579,299,1546,0,177,0,0,0,0,0,0,0,0,0,
+411,0,0,0,0,727,439,0,0,0,0,0,1528,0,0,0,0,0,0,58,0,482,0,0,0,505,1952,0,0,0,0,
+0,0,0,0,0,0,0,242,0,0,0,0,0,0,0,953,0,0,0,0,802,0,0,0,0,0,0,0,0,0,0,290,0,0,791,
+52,0,0,0,0,0,0,0,0,0,0,0,112,0,0,0,0,0,1028,0,0,138,0,0,0,0,1811,0,0,0,0,0,0,
+934,1821,0,0,0,0,371,38,0,0,0,1296,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,723,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1330,0,0,0,0,0,0,0,1255,296,109,0,0,0,0,0,660,0,0,0,0,270,591,0,
+0,0,0,0,0,0,1090,81,0,0,0,0,391,0,0,0,0,249,322,0,0,0,0,0,0,0,1412,0,0,0,0,0,0,
+0,0,0,0,526,632,0,0,0,0,0,0,235,144,0,0,0,0,0,940,0,0,0,52,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,309,196,0,0,0,0,0,1912,0,1290,0,686,0,0,625,0,0,0,0,0,0,0,0,0,0,0,412,0,
+0,0,0,43,0,0,0,0,11,967,758,0,0,0,0,0,0,0,0,0,0,0,0,0,0,220,0,0,0,0,0,0,0,0,0,0,
+873,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,890,0,0,2,0,0,0,0,0,0,0,0,1774,
+393,263,0,0,0,0,0,0,818,456,0,0,251,178,393,97,0,0,0,0,0,674,168,0,0,0,0,0,0,0,
+159,1639,0,0,0,0,0,0,0,0,59,934,0,191,0,0,0,0,346,165,0,877,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,128,0,0,0,0,0,0,1297,0,0,0,0,0,0,164,0,0,0,15,132,241,1073,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,228,324,53,0,0,910,0,0,0,0,0,0,0,0,734,705,
+217,73,0,0,0,0,0,0,0,0,636,389,0,1409,0,0,0,0,0,893,0,0,0,0,21,0,0,0,0,0,0,0,0,
+0,0,0,0,0,721,0,0,0,959,0,0,0,0,1433,0,0,0,0,0,0,0,0,0,0,0,0,174,189,0,0,0,0,0,
+0,0,0,0,0,22,2,0,0,815,354,0,0,0,0,425,0,411,60,13,1611,0,0,0,0,0,0,0,0,0,0,0,0,
+0,1478,596,0,0,398,0,50,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,192,1159,0,0,0,0,0,
+592,223,0,0,0,0,0,0,0,245,64,0,0,0,0,278,0,604,0,0,1502,265,0,0,0,0,0,0,0,310,
+1763,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,129,0,0,0,0,0,0,0,0,0,1356,0,0,0,0,0,0,0,
+0,505,0,0,0,0,0,0,0,1000,0,0,966,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,839,0,0,0,0,0,0,
+0,0,0,0,0,0,0,637,0,0,0,0,0,0,0,0,0,0,0,0,0,0,590,0,0,0,0,280,0,0,0,1386,0,0,0,
+281,0,1064,0,0,0,0,0,917,0,0,15,555,0,0,1014,1883,0,0,0,965,0,0,117,33,0,0,0,
+801,0,0,0,0,0,877,0,824,0,0,0,0,0,0,0,0,0,0,0,365,0,0,0,0,0,0,774,7,0,430,0,0,
+231,360,0,0,0,0,0,0,0,0,822,740,0,0,929,1485,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,852,0,0,0,0,17,0,0,0,0,0,0,1001,0,0,0,0,35,831,0,0,384,457,0,0,0,1351,0,27,
+0,0,984,0,264,552,0,401,0,0,0,710,0,1211,0,0,11,205,0,0,0,0,0,0,0,0,0,0,0,0,5,
+579,0,717,0,0,1011,0,0,0,0,0,0,0,0,0,0,0,0,0,0,805,0,0,0,0,0,0,0,0,0,0,0,489,0,
+0,0,1024,0,0,0,0,0,0,0,0,0,892,0,0,0,0,0,0,0,0,0,0,0,0,473,0,0,0,659,864,0,0,0,
+0,0,0,152,819,0,51,0,0,0,0,0,0,0,0,0,0,130,0,0,0,0,0,229,0,0,0,0,674,0,0,0,0,0,
+0,0,0,0,770,52,79,0,0,0,1666,0,409,0,0,0,0,0,0,0,195,0,688,0,0,0,0,0,0,0,0,0,0,
+0,889,174,160,0,0,0,0,0,0,0,0,0,0,0,0,0,872,0,918,569,268,0,0,0,1224,0,1361,0,0,
+0,0,0,0,0,0,0,374,0,0,0,0,0,731,0,0,0,0,190,0,0,0,0,0,0,0,202,506,444,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,835,0,17,1526,0,0,0,0,0,477,0,0,
+994,1374,76,0,0,0,0,0,0,0,355,287,0,1389,0,0,0,0,0,0,455,384,0,0,0,264,0,0,0,0,
+0,0,0,0,0,0,0,0,1001,0,0,0,0,0,0,0,0,0,0,0,0,28,0,0,0,851,175,359,0,0,0,0,0,0,0,
+0,287,740,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,857,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+819,1402,0,0,0,0,0,0,174,224,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1649,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,655,573,0,0,0,0,0,0,0,0,128,351,0,0,0,0,0,0,
+0,0,0,0,0,918,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,687,0,0,0,0,0,0,0,0,0,1525,
+0,0,0,1009,0,0,0,0,0,0,0,340,0,0,0,0,0,0,0,0,0,0,861,0,176,0,0,0,0,0,0,0,0,0,96,
+985,0,615,0,0,0,0,0,0,0,1919,0,0,0,0,0,1131,0,0,0,0,0,0,0,247,0,0,0,0,27,23,0,0,
+0,0,0,0,0,0,38,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1015,0,0,0,0,0,1088,0,0,
+0,0,0,1585,0,0,0,0,227,0,0,0,478,360,0,0,0,95,0,0,0,0,0,0,699,0,0,0,26,0,0,0,0,
+1119,0,0,0,739,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,741,67,0,0,0,0,0,0,464,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,42,0,96,0,0,0,26,342,0,0,0,0,0,0,203,0,0,449,0,
+0,0,0,0,0,0,0,0,0,256,311,0,0,0,0,0,0,758,0,0,0,0,0,0,0,0,827,0,0,0,0,581,64,0,
+1047,0,0,0,0,0,288,0,0,0,0,0,1375,0,0,0,0,0,0,0,0,0,0,0,1309,0,0,0,0,0,0,0,0,
+376,12,0,0,0,0,0,154,0,1520,0,1753,95,502,0,0,0,0,0,0,0,269,291,1197,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,0,0,0,0,1341,0,1017,0,0,0,0,0,0,0,
+0,857,1810,533,0,0,1453,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,836,211,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,19,0,156,0,0,0,0,1009,0,0,0,0,0,0,0,0,0,0,0,0,0,820,0,0,
+0,0,0,0,0,0,0,228,0,0,0,1131,0,1276,0,0,0,0,0,0,0,0,0,0,0,0,849,1792,0,0,389,
+291,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,525,0,0,
+0,453,0,0,0,0,666,0,0,0,422,0,355,0,0,0,0,165,0,260,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,865,0,0,0,0,0,0,0,1625,0,0,0,234,0,1383,0,0,0,0,0,0,0,0,306,0,0,0,802,1921,
+0,0,0,0,0,0,180,0,0,0,0,1312,814,0,0,0,0,0,0,0,0,0,0,707,0,0,0,1493,11,61,733,0,
+0,0,341,0,0,0,98,0,0,0,0,0,0,0,0,0,0,0,1014,0,0,0,0,0,0,0,142,102,0,0,30,0,0,
+823,0,1045,0,0,0,1930,0,1512,0,0,0,0,0,0,0,87,0,1243,245,0,0,0,0,0,0,0,48,68,0,
+0,0,0,0,0,0,0,126,77,625,938,0,0,351,0,0,0,174,1668,0,707,0,0,0,0,0,0,0,0,0,0,0,
+403,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,282,0,0,0,0,0,0,8,44,0,0,363,115,0,0,0,0,0,0,
+0,0,0,0,0,0,545,761,0,0,835,1254,0,0,0,0,930,1936,0,0,0,0,0,0,0,0,653,0,0,0,0,0,
+344,0,0,1483,673,185,0,0,460,93,753,478,0,0,0,0,0,1020,0,0,0,0,0,0,0,103,0,0,0,
+499,0,0,0,0,0,0,207,0,0,0,0,0,0,0,0,0,0,0,0,0,0,96,0,968,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,3,0,0,0,0,399,0,0,0,0,224,563,0,0,0,0,0,704,0,0,0,0,0,0,0,0,0,0,0,
+1559,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,861,0,0,0,0,946,333,746,0,0,0,0,0,
+0,0,910,0,0,0,0,0,0,0,0,0,0,0,0,0,652,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+1393,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1514,0,0,0,0,201,0,510,717,0,0,528,0,0,0,0,
+20,0,0,0,1251,0,0,0,1163,0,0,0,307,0,0,0,0,0,1091,0,0,0,0,0,0,0,0,0,0,0,429,0,0,
+0,881,0,0,0,0,0,621,0,0,0,0,0,0,0,736,0,348,0,868,0,0,0,0,433,0,0,0,771,1495,0,
+0,0,0,215,0,0,0,0,0,124,0,0,0,0,0,0,0,0,0,0,0,55,0,0,0,0,0,0,0,112,62,0,856,270,
+0,572,0,0,0,0,939,0,0,0,0,0,0,0,352,0,0,0,0,0,0,0,0,0,647,0,0,0,0,10,0,0,0,0,0,
+0,0,220,0,0,0,0,0,0,0,0,0,0,0,0,0,464,0,0,109,0,0,0,1746,0,0,0,515,0,0,0,566,0,
+0,0,0,0,0,67,40,0,0,722,992,0,0,923,0,0,0,0,0,0,1145,0,0,0,0,0,0,0,0,0,0,0,568,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,247,0,0,0,0,645,0,0,328,0,0,0,0,0,0,0,0,0,0,0,0,
+1363,0,0,0,0,0,1280,0,0,0,0,0,0,0,0,0,0,7,28,360,162,0,0,0,0,0,0,0,0,0,0,0,764,
+0,0,833,862,0,856,0,0,0,0,0,0,736,92,0,0,948,1944,0,1479,63,590,0,0,0,1521,0,0,
+0,709,0,0,61,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,483,0,0,0,0,1213,
+0,0,0,0,29,1022,0,1712,0,466,0,0,0,0,0,0,0,0,0,0,0,0,0,731,0,0,0,0,0,0,171,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,241,0,0,0,0,0,0,0,0,0,0,0,964,2005,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,1100,0,0,0,954,0,0,0,0,0,0,0,0,0,1958,0,0,34,549,994,0,0,449,
+137,850,0,0,670,146,0,0,0,0,518,159,0,0,0,0,0,0,0,0,151,0,0,1027,0,0,0,0,0,0,0,
+0,0,0,983,0,0,0,0,993,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,141,501,0,0,0,
+0,0,0,0,0,0,452,0,0,0,0,0,0,0,0,0,0,233,149,0,0,0,0,0,0,0,0,582,0,0,0,801,0,0,0,
+0,0,0,70,0,0,369,0,36,0,0,0,0,0,0,0,204,721,430,241,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1817,16,1078,1021,0,0,
+406,0,0,0,0,0,69,0,0,0,0,0,1830,0,0,0,824,0,0,0,0,0,0,0,0,0,826,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,816,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1000,717,1845,0,423,0,0,
+0,0,0,0,0,0,510,0,0,1048,0,0,0,618,0,0,0,520,0,0,0,0,990,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,321,0,0,0,0,0,0,0,1135,0,0,921,0,0,0,24,397,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,856,0,0,0,139,282,981,0,288,0,0,0,1890,651,56,0,0,0,0,0,0,0,
+0,261,0,0,0,0,0,0,0,0,0,0,0,617,1403,0,1205,0,0,563,0,0,0,0,0,0,0,0,333,0,0,0,0,
+0,369,0,0,0,0,0,0,0,0,0,622,0,0,0,1407,0,0,0,0,0,0,0,0,0,0,0,0,624,160,0,363,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,619,0,174,292,0,0,656,616,0,0,0,685,0,0,0,0,0,0,0,0,0,0,0,0,0,647,0,0,0,631,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1267,0,0,0,1797,0,0,0,1684,0,0,469,0,531,
+1230,73,0,0,0,0,0,0,0,0,0,268,0,0,0,0,0,102,558,109,65,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,595,0,0,0,0,0,374,1832,0,0,0,0,0,0,16,0,405,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,881,0,1495,0,0,0,0,0,0,0,0,0,142,0,0,0,0,0,0,0,0,0,0,21,466,23,
+257,0,0,0,0,0,0,77,404,0,0,0,0,0,0,712,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,860,
+1848,0,0,652,629,0,0,0,0,13,377,0,1842,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1501,0,
+0,0,1906,0,0,0,0,0,0,0,0,0,0,0,0,0,491,234,171,0,0,0,0,631,1186,0,0,0,0,0,0,0,0,
+0,0,0,0,931,0,170,0,0,0,0,0,0,0,0,0,0,1587,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+765,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,424,0,0,714,0,0,0,0,685,0,0,0,0,0,
+0,285,0,0,0,0,0,0,429,0,0,0,0,0,0,0,0,0,0,71,18,0,0,0,0,0,0,0,0,0,0,116,828,0,0,
+0,0,0,0,289,0,0,0,0,0,0,0,0,675,0,0,0,1424,0,0,0,0,0,647,0,0,0,1334,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,36,209,0,0,0,0,0,0,0,342,0,0,0,928,0,0,0,0,0,1838,118,856,654,
+318,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,915,895,454,0,0,513,1425,0,0,
+0,0,0,0,791,0,153,0,0,0,0,0,0,796,909,445,345,0,0,0,0,0,0,0,0,578,0,0,0,1387,0,
+0,0,555,0,0,0,0,0,0,766,0,0,0,0,0,0,0,0,0,0,541,0,0,0,0,0,0,0,0,0,0,0,0,0,880,0,
+0,0,0,0,1506,0,0,983,0,768,0,0,0,0,584,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,737,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,226,30,426,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+117,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,462,0,0,0,385,0,398,0,0,0,0,0,0,
+0,0,0,347,0,0,0,0,125,1259,644,136,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,469,0,0,0,0,0,
+1367,0,0,0,0,0,0,0,0,0,0,0,719,0,0,0,0,0,0,0,0,0,0,0,0,0,1423,0,0,0,0,0,0,0,0,0,
+749,0,0,0,0,546,645,0,0,0,0,0,0,277,0,0,1275,0,0,0,0,0,0,0,453,536,555,0,0,987,
+1107,0,0,90,0,0,0,0,0,0,0,0,860,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+257,0,1768,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1071,0,0,0,0,0,0,0,0,0,0,0,0,0,83,
+0,835,0,0,0,0,0,0,0,2006,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,696,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,95,1718,0,0,0,0,0,0,0,26,0,550,0,0,0,0,0,901,0,0,0,0,0,
+0,822,0,0,122,0,0,0,807,0,0,0,0,0,262,0,620,601,34,0,0,170,0,0,0,0,537,0,0,0,0,
+0,0,0,0,0,332,0,0,208,1909,182,261,0,0,0,1721,0,0,0,0,0,933,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,1609,0,895,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,812,0,0,942,1916,0,0,0,0,
+0,0,0,778,0,0,0,137,0,1314,0,0,0,0,0,0,0,1661,0,0,0,0,0,0,0,1591,0,0,0,0,0,0,
+820,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,185,89,0,1160,230,6,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,63,29,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1740,0,0,177,
+170,0,1961,0,0,0,0,0,0,0,0,0,0,0,0,91,0,17,44,0,0,0,0,0,0,0,0,0,270,0,296,0,0,0,
+0,0,0,0,1523,0,0,0,0,0,0,0,0,0,0,757,7,0,0,0,0,0,0,0,0,0,0,530,588,0,0,0,0,0,0,
+0,0,0,786,0,0,0,0,0,580,627,88,447,57,0,0,0,0,0,0,0,0,845,735,0,0,0,0,0,31,15,0,
+460,521,12,424,0,0,0,1302,0,0,0,0,0,0,0,595,0,0,0,13,548,97,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,1472,452,1767,0,0,0,0,0,0,0,0,0,0,115,0,0,0,0,0,0,1543,0,1111,0,0,0,0,
+1,0,359,488,0,267,0,0,0,1983,0,0,0,0,0,0,0,1155,0,1575,0,1438,31,0,0,377,101,0,
+0,0,0,0,0,0,0,0,0,0,0,0,476,0,0,0,0,0,0,0,0,2023,0,0,0,0,0,1836,0,0,0,0,35,843,
+0,0,0,0,0,0,0,554,0,0,0,536,625,207,0,1371,0,0,0,424,785,336,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,896,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,27,750,0,0,0,0,238,0,0,
+0,0,0,383,0,0,0,0,0,0,0,0,603,725,11,0,0,0,0,0,0,0,0,0,476,0,0,0,0,0,1552,0,0,0,
+0,0,0,0,680,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,435,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+1431,0,0,13,112,0,0,356,0,0,0,0,0,0,0,0,0,0,1963,0,0,0,1244,18,0,0,0,0,0,0,867,
+0,0,0,0,0,0,50,708,73,592,0,502,0,0,0,0,0,0,161,347,0,0,0,0,470,33,0,246,571,10,
+0,465,614,0,237,0,0,0,0,0,24,18,0,506,0,0,0,0,0,0,33,309,0,0,0,0,0,0,0,0,0,0,
+140,0,0,0,0,1056,0,0,0,1704,0,0,0,0,0,0,0,1036,0,0,0,0,0,0,0,0,0,1315,432,86,
+264,524,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,107,0,0,0,0,0,123,927,0,0,957,1149,0,0,
+0,0,0,778,0,502,196,0,0,0,0,1312,0,0,0,0,0,0,0,855,0,0,0,0,0,0,0,0,0,0,45,1400,
+0,0,0,1003,0,0,0,0,0,1097,0,0,0,0,0,0,0,0,545,612,0,0,0,0,0,0,0,0,0,0,0,0,54,0,
+0,0,0,172,0,0,0,1029,0,0,0,0,0,0,0,0,0,568,0,0,0,732,617,0,0,974,94,989,733,0,0,
+0,0,0,0,1789,0,0,665,2015,0,0,0,0,0,0,806,287,0,0,0,0,0,1539,0,0,0,0,0,0,0,0,0,
+0,182,1563,0,0,0,0,0,0,0,0,0,484,0,0,0,0,0,1623,0,0,0,0,0,0,0,0,878,1833,0,1569,
+0,0,0,0,0,0,0,0,93,0,715,994,0,0,0,0,0,63,0,591,0,0,0,0,0,0,0,749,0,0,0,0,547,
+366,0,0,0,1747,0,0,0,0,0,0,0,89,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1463,0,772,
+893,0,0,0,48,0,0,941,0,0,690,1785,106,440,0,0,0,0,0,0,0,0,0,0,32,0,332,216,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,852,0,
+0,416,564,0,918,0,1764,0,0,3,0,0,274,0,0,0,0,501,0,0,0,0,0,0,0,851,743,0,49,0,
+879,0,0,47,0,0,0,0,0,0,865,0,1202,0,0,0,0,0,0,47,272,0,0,0,0,0,0,0,0,0,0,0,1455,
+0,0,0,0,891,1911,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,761,0,0,0,0,0,0,0,0,0,407,0,
+183,0,0,490,0,0,0,0,0,0,0,35,731,0,0,0,0,0,0,0,819,0,0,0,0,0,0,0,0,0,0,0,0,0,
+575,0,0,0,0,45,818,0,0,77,222,0,0,0,0,849,1880,0,0,0,633,0,1308,0,0,0,0,0,0,0,0,
+0,0,86,0,0,0,0,0,0,0,0,0,0,0,0,0,0,817,0,0,0,0,0,0,0,0,0,882,0,0,0,914,0,0,0,0,
+0,0,0,0,0,0,865,0,0,426,399,58,0,0,0,0,0,0,538,102,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,876,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,139,566,0,63,12,0,0,0,
+0,0,0,0,0,0,0,0,0,0,3,114,0,0,0,0,0,0,0,0,576,0,0,0,0,0,0,0,0,933,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,692,0,0,0,0,0,0,0,0,0,0,0,0,752,0,0,0,0,
+0,0,0,0,375,0,1011,0,0,96,0,0,0,0,0,0,0,0,0,148,0,0,0,0,0,0,0,0,0,0,0,337,56,
+666,0,246,394,0,0,0,0,0,0,0,0,437,0,0,0,506,0,0,0,0,1003,0,1163,0,328,0,0,0,0,0,
+0,0,0,1000,0,0,0,0,0,744,101,0,0,0,0,0,726,0,0,176,0,146,9,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,839,0,0,0,0,0,0,223,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,246,1931,29,0,0,1771,0,0,0,0,0,846,6,157,0,0,0,0,0,0,0,0,0,875,0,0,477,
+773,177,639,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1747,0,0,0,0,158,873,0,659,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,391,0,0,0,0,0,0,0,0,0,0,0,0,668,883,0,78,628,0,0,0,
+0,0,0,0,0,0,0,0,0,1460,0,962,0,0,0,0,0,460,0,0,0,0,0,0,0,0,0,0,0,0,0,0,34,199,0,
+0,0,388,474,0,271,0,333,608,0,0,0,0,0,0,49,0,988,0,707,617,0,0,0,0,0,0,0,756,0,
+0,0,0,0,1583,0,0,0,0,0,0,0,0,0,0,285,0,0,0,0,0,0,0,0,0,0,0,0,0,0,344,0,0,0,0,0,
+0,0,0,515,1709,0,0,0,0,0,0,0,0,404,0,0,0,0,500,0,0,0,0,0,0,0,0,0,68,216,0,0,0,0,
+0,0,0,488,353,0,0,177,236,0,0,458,490,0,0,0,0,0,0,756,1504,0,757,0,1735,0,0,108,
+598,0,0,0,0};
+BROTLI_INTERNAL const uint8_t kStaticDictionaryHashLengths[32768] = {
+8,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,0,0,0,12,0,0,0,0,4,22,5,0,
+4,0,0,0,0,0,0,0,0,0,0,0,0,14,6,0,0,0,5,0,0,0,0,0,0,0,7,13,0,0,4,0,0,0,0,0,0,0,0,
+0,6,0,0,0,0,8,0,0,0,0,0,0,7,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,15,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,4,0,0,0,4,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,10,4,0,5,13,7,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,8,7,0,0,9,0,8,0,0,0,0,0,0,6,0,
+0,9,0,0,0,11,0,0,6,8,7,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,7,0,0,0,6,8,0,0,0,0,0,
+0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,9,0,0,0,8,4,13,7,0,0,0,0,0,
+7,0,5,0,0,0,0,8,5,0,5,0,0,8,7,0,0,0,0,0,0,0,0,0,0,9,0,0,0,8,0,0,0,10,4,0,5,0,4,
+0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,8,7,0,4,9,4,0,0,0,0,0,0,
+9,0,0,0,8,5,0,0,0,6,0,0,0,0,0,0,0,0,0,7,18,0,0,0,0,4,9,0,0,4,0,6,0,0,0,6,0,6,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,5,8,7,0,0,0,
+0,9,0,0,0,0,0,0,0,8,6,10,6,0,0,0,4,0,6,8,6,0,0,0,4,0,0,0,0,0,5,0,0,0,6,0,0,0,0,
+10,0,12,7,0,0,0,0,0,4,0,0,0,0,0,5,0,0,8,7,0,0,0,0,0,0,0,0,9,5,0,0,0,0,0,0,0,0,0,
+0,0,0,0,6,11,0,0,0,0,0,0,0,0,0,8,7,0,0,10,0,0,0,0,0,0,0,0,6,10,0,17,0,8,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,8,6,9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+7,0,0,11,4,0,5,0,0,0,0,0,0,0,0,0,0,10,5,0,6,8,5,0,0,0,0,0,0,0,0,0,0,11,5,0,0,0,
+0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,9,0,0,0,0,5,0,0,0,0,0,0,0,0,0,6,0,0,8,7,0,0,0,0,0,
+0,0,0,0,0,0,5,0,0,0,6,0,0,10,0,0,0,20,0,0,0,0,0,0,0,0,6,9,5,0,0,0,0,10,4,8,0,0,
+4,13,0,0,0,0,0,0,0,9,0,9,0,0,0,0,0,0,0,0,0,0,0,0,4,8,6,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,12,0,0,4,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,12,5,0,0,10,4,10,7,13,
+0,0,0,0,0,0,0,0,6,0,6,0,6,0,0,0,0,0,0,19,0,0,4,12,6,9,0,0,0,0,4,0,4,11,0,0,0,0,
+0,0,0,12,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,4,0,0,0,0,0,0,0,0,0,6,0,0,0,0,
+0,5,0,0,0,0,0,6,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,8,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,17,0,0,0,9,6,0,0,0,0,0,4,0,4,0,0,0,0,0,0,0,0,0,4,0,0,0,
+6,0,0,0,0,0,0,0,0,0,0,13,6,0,0,0,0,0,0,0,0,0,0,0,6,8,0,0,0,0,0,0,0,0,0,0,6,0,0,
+0,0,0,5,0,0,0,0,14,4,0,0,0,4,12,5,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,8,6,0,
+0,0,0,0,0,12,0,9,6,0,0,0,0,13,0,0,5,0,0,0,0,0,4,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,13,0,9,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,5,0,0,0,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,8,7,8,4,0,0,0,0,0,0,0,0,0,0,0,7,0,7,0,0,0,4,0,
+0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,8,6,8,4,0,0,0,0,0,6,0,7,0,
+0,0,0,0,0,0,0,0,0,10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,7,0,0,0,0,0,0,9,5,0,0,
+0,0,0,7,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,9,4,0,0,0,0,0,0,0,4,
+12,5,11,0,0,0,0,0,0,0,0,0,8,7,0,5,0,0,8,7,0,5,0,0,0,0,8,0,0,0,0,7,0,4,10,0,0,0,
+0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+13,5,0,0,0,4,0,0,0,0,0,6,0,0,0,0,0,0,14,5,0,0,0,7,0,0,10,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,6,0,4,0,5,0,0,0,0,8,5,0,0,0,0,0,0,9,5,9,0,0,0,0,0,0,0,0,6,9,0,
+0,4,0,0,0,7,0,0,0,6,0,0,10,4,0,0,0,0,0,6,0,0,10,0,0,0,8,5,0,0,0,0,0,0,0,0,10,0,
+0,0,0,0,18,4,12,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,8,7,0,0,0,
+0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,8,4,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,
+0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,8,0,0,0,0,0,0,6,0,0,0,4,10,5,0,0,0,0,0,0,0,0,0,0,
+0,4,8,7,0,0,8,6,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,
+0,0,0,8,6,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,6,0,7,0,0,0,0,0,0,
+0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,8,7,0,0,0,0,8,0,12,6,0,6,0,0,0,0,9,7,11,7,0,0,0,
+0,0,0,0,0,0,0,0,0,11,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,10,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,
+0,0,0,6,0,0,0,7,0,4,14,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,14,0,0,0,0,0,8,4,0,4,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,20,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,12,5,0,7,0,5,0,0,10,0,0,7,0,0,0,0,0,0,0,0,0,0,14,0,0,0,0,6,0,4,9,7,0,0,0,
+0,0,7,0,0,0,0,0,0,10,0,9,0,9,0,0,0,0,0,0,0,0,4,9,0,0,0,0,6,0,0,0,0,0,0,0,0,11,4,
+0,6,0,0,0,0,0,0,8,0,8,0,0,0,0,0,0,0,0,0,0,4,0,0,0,5,0,0,0,0,0,0,0,0,13,6,0,0,11,
+0,0,0,0,0,0,0,9,7,0,0,0,0,0,0,0,0,0,0,0,6,18,0,0,4,0,0,0,0,0,0,0,6,0,0,0,0,0,0,
+0,5,0,0,0,0,0,0,0,0,9,7,0,0,0,0,0,0,0,6,0,0,0,0,9,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,11,7,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,0,11,
+4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,4,0,0,0,0,8,
+6,0,0,0,0,0,0,9,6,0,0,0,0,0,4,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,0,0,0,
+0,6,0,6,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,6,0,6,0,0,10,6,0,0,0,7,0,0,8,0,8,7,0,
+0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,20,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,9,0,0,0,0,6,0,0,0,0,0,0,0,5,0,0,18,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,
+0,0,0,8,7,0,0,0,0,0,0,0,0,12,0,12,0,0,0,11,6,0,5,0,0,12,0,12,5,0,7,11,6,0,0,11,
+0,0,0,12,0,0,4,12,7,8,6,0,0,0,0,8,5,0,0,0,0,0,0,0,4,11,0,0,6,0,7,0,0,0,0,0,0,0,
+5,0,6,0,0,0,0,8,0,10,0,0,0,0,0,0,0,0,0,0,0,9,7,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,
+0,0,0,0,0,0,0,0,0,11,7,0,0,0,0,0,0,10,0,0,5,0,0,12,6,0,0,0,0,0,0,10,6,0,0,0,0,8,
+6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,5,0,0,0,0,11,0,10,6,0,0,8,6,0,0,0,6,0,7,10,6,0,
+0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,10,7,0,0,0,0,
+10,6,0,0,0,0,0,0,8,5,11,0,8,4,0,0,0,4,0,0,0,0,9,4,8,0,0,0,0,0,0,0,11,6,0,0,0,0,
+10,7,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,7,0,0,0,0,9,6,0,5,0,7,0,0,0,0,0,7,0,0,11,0,0,
+0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,
+0,0,0,0,13,0,8,6,13,0,0,0,11,7,0,7,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,6,0,0,9,6,0,6,0,0,0,0,0,5,0,0,0,0,0,0,0,0,
+0,0,0,0,0,5,9,0,0,0,0,0,0,0,0,0,0,4,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,9,7,0,7,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,
+5,11,5,0,0,0,0,0,0,0,0,0,4,0,7,0,6,0,0,0,6,20,0,0,0,10,7,0,5,14,4,0,0,0,0,0,0,0,
+0,0,6,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,
+0,0,6,0,4,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,9,7,0,0,11,6,15,0,0,0,0,0,
+10,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,7,0,0,0,0,0,0,0,0,9,7,13,0,0,0,0,0,
+0,7,0,0,8,6,0,0,0,0,0,0,0,0,9,4,0,0,0,0,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,5,0,0,0,0,0,0,0,0,0,0,0,0,8,5,0,4,0,0,0,0,0,0,0,0,0,0,12,6,8,0,12,0,0,7,0,0,0,
+0,0,5,10,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,
+14,0,0,0,0,0,0,0,0,0,0,0,0,5,0,5,8,7,10,7,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,18,6,
+14,7,0,0,0,0,0,0,0,0,11,6,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,0,11,7,0,0,10,7,0,0,0,6,8,6,0,0,0,0,0,0,0,6,0,0,
+19,0,0,0,9,5,0,0,0,0,0,0,11,7,0,0,0,7,0,6,0,0,11,0,0,0,0,4,8,0,0,0,0,0,0,0,0,6,
+0,0,0,0,0,6,0,0,8,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,7,
+0,7,0,0,0,7,15,0,0,5,0,0,0,0,10,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,7,0,0,
+0,0,0,0,0,0,9,6,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+11,7,0,0,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,
+0,0,5,0,4,0,0,0,4,0,4,0,0,0,0,0,0,0,0,0,6,0,0,0,0,11,6,0,0,8,5,14,0,0,4,0,0,0,7,
+17,0,0,0,0,0,0,0,13,5,0,0,0,0,0,5,0,0,0,5,0,0,0,0,16,6,0,4,0,0,0,0,0,0,12,0,0,0,
+0,0,0,6,0,0,0,0,0,0,0,0,0,0,12,5,0,5,0,6,10,0,12,0,0,0,0,0,0,0,0,7,0,0,0,0,8,4,
+0,0,0,0,0,0,0,0,0,0,8,7,0,0,8,0,0,0,8,0,0,6,0,7,0,0,0,5,0,6,0,4,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,22,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,0,0,
+0,0,0,0,0,0,0,13,0,0,0,0,0,0,0,18,0,0,0,9,4,0,0,8,0,9,7,0,0,0,0,0,0,8,6,0,0,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,9,7,0,0,0,6,0,0,14,0,0,0,0,
+0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,7,10,4,
+0,6,0,0,0,0,0,0,8,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,9,6,0,0,0,0,0,0,
+0,0,11,6,12,7,0,0,0,0,0,0,0,6,0,5,0,0,0,0,0,0,9,6,11,6,0,0,0,0,9,5,0,0,0,0,0,0,
+0,6,8,5,0,0,0,0,8,0,10,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,
+5,10,7,0,0,0,5,8,7,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,4,8,7,0,0,0,6,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,22,
+0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,5,0,0,0,0,0,0,0,
+0,0,0,0,0,17,0,0,6,0,6,12,4,19,6,0,0,0,0,16,0,0,0,0,7,15,7,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,4,10,4,0,0,8,7,0,7,0,0,9,
+4,0,6,0,0,0,4,0,5,0,0,0,7,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,7,10,0,0,0,0,0,11,7,0,0,
+0,0,12,6,0,0,0,0,0,0,0,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,
+0,0,0,0,0,0,0,0,0,10,4,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,8,7,0,0,
+0,0,0,0,0,6,0,0,0,4,0,0,11,4,0,0,12,7,0,0,0,0,9,0,0,6,0,0,0,0,0,0,0,0,0,5,0,0,0,
+4,0,0,0,0,14,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,6,0,0,0,0,0,0,9,4,0,6,0,0,0,0,0,4,
+0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,6,0,0,0,5,0,0,0,0,0,0,0,0,0,7,9,6,0,7,0,
+0,0,0,0,0,0,6,0,0,0,0,8,6,0,0,0,0,10,6,11,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,5,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,5,0,4,8,0,0,0,0,0,9,7,0,0,0,0,0,0,
+13,5,0,0,0,0,8,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,8,5,0,0,11,7,0,0,0,0,0,0,8,6,0,
+0,0,0,0,7,0,4,0,0,0,0,0,0,0,5,0,6,0,5,0,0,0,0,0,0,0,0,0,0,0,0,10,4,9,0,0,0,0,0,
+0,4,0,0,0,0,10,5,10,7,0,0,0,0,0,0,0,0,16,7,0,0,0,0,0,7,0,0,0,0,11,0,0,0,0,0,0,0,
+0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,5,0,4,0,0,0,7,0,0,0,0,0,0,13,0,0,
+0,0,0,0,0,0,0,0,7,0,4,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,13,7,0,7,0,4,16,0,0,0,0,6,8,7,9,7,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,
+0,6,0,0,8,5,0,4,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,5,11,7,0,0,11,
+0,0,0,0,0,9,5,0,4,0,0,0,0,9,7,8,6,0,0,0,0,0,0,10,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,
+0,7,0,0,0,0,0,0,0,0,0,0,0,4,10,6,0,7,0,0,0,0,0,0,0,5,0,0,0,0,0,0,10,7,10,0,0,0,
+0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,7,0,6,8,7,12,4,0,0,0,0,0,0,0,5,14,
+0,0,0,0,0,0,4,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,4,0,0,20,4,0,0,0,7,0,6,0,0,0,0,0,0,0,0,8,0,
+0,6,15,0,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,12,0,0,0,9,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,5,0,0,0,0,0,0,8,6,0,0,18,0,0,0,10,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,9,6,0,
+6,0,0,0,0,0,0,0,0,9,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,7,0,0,0,0,9,0,9,0,0,4,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,9,5,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,10,0,0,0,0,7,0,0,0,0,0,0,0,0,0,7,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,8,0,8,0,0,0,16,0,0,0,0,0,0,0,
+0,0,0,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,8,0,0,0,11,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,0,11,0,0,0,9,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,7,0,7,0,6,
+0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,
+0,0,0,0,0,0,0,6,0,0,18,0,8,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,7,0,4,0,0,0,
+0,0,0,0,0,0,0,8,0,0,0,0,0,16,0,0,0,0,0,16,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,18,0,0,0,0,0,0,0,0,0,9,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,4,0,
+0,0,0,0,0,0,0,9,4,0,0,0,0,12,5,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,12,5,0,0,0,0,0,0,0,5,0,0,10,6,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,9,0,0,0,11,0,0,6,0,6,0,0,
+0,7,0,0,0,0,0,0,8,0,0,0,0,6,0,0,0,0,0,0,19,0,0,0,12,0,9,0,0,0,0,0,10,7,0,0,0,0,
+0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,16,7,12,
+0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,12,6,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,10,5,0,0,0,0,0,0,0,4,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,7,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,4,0,0,0,0,0,0,0,4,0,0,9,0,0,0,8,0,12,4,0,0,0,0,
+0,4,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,5,0,
+0,0,0,0,0,13,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17,0,0,0,0,0,0,0,8,6,0,6,0,0,0,0,0,0,
+0,4,0,0,0,0,0,6,0,0,9,0,0,0,0,0,0,6,0,0,0,0,0,0,11,0,0,0,0,0,0,0,10,6,0,0,0,0,8,
+6,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,7,0,0,0,0,0,7,0,6,
+10,7,0,0,10,5,11,6,0,0,0,0,0,7,16,0,0,0,0,6,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,5,0,0,0,7,9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,
+0,0,0,0,0,8,7,0,0,0,0,11,6,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+8,7,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,12,7,0,7,0,0,0,
+0,0,0,0,6,0,0,0,0,9,0,0,0,23,0,0,0,0,0,10,5,0,0,0,0,0,0,0,0,0,4,0,0,11,7,10,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,0,8,7,0,7,0,0,8,7,8,0,0,0,0,0,0,0,0,0,0,0,14,5,0,0,0,0,
+0,0,0,0,18,6,8,7,0,0,0,0,0,0,0,4,0,0,0,0,0,0,11,0,0,0,9,7,12,6,0,0,0,0,0,0,0,0,
+0,0,12,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,7,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,8,7,0,0,0,6,10,0,0,0,9,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,6,
+10,7,0,0,0,7,0,0,8,4,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,19,0,0,0,0,0,0,
+0,0,0,8,7,8,6,0,0,11,7,10,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,4,8,7,0,0,0,0,0,0,0,0,
+0,5,0,0,13,0,0,0,0,5,0,0,9,7,0,0,0,0,0,0,0,4,0,0,11,0,0,7,0,0,0,0,0,0,0,0,0,6,0,
+0,0,0,0,0,12,7,19,0,8,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,10,6,8,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,7,0,0,12,0,0,0,0,6,9,6,
+14,0,0,0,0,0,0,6,0,5,0,0,8,7,0,0,0,6,0,4,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,4,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,5,0,
+7,0,0,10,0,9,7,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,12,6,0,0,0,0,0,5,0,6,0,0,0,0,
+0,0,0,0,0,0,0,6,0,0,0,0,9,7,0,0,0,0,0,0,11,6,0,0,0,0,0,0,0,0,0,0,11,7,0,0,13,7,
+0,0,0,0,0,0,0,0,12,0,0,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,6,11,5,0,5,13,0,8,0,
+0,0,0,6,0,0,0,0,0,0,11,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,11,5,
+9,6,0,0,0,4,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,10,0,0,0,8,5,0,0,9,0,0,0,8,7,9,0,0,0,0,0,0,0,0,7,0,6,0,0,0,0,0,0,0,0,0,
+0,11,0,13,6,0,0,9,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,
+0,0,0,0,0,5,21,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,24,5,0,0,0,0,0,0,0,0,10,0,8,0,
+0,6,0,0,0,4,0,0,9,0,0,0,0,0,0,0,0,0,0,4,0,0,8,6,0,6,0,7,10,0,8,4,0,4,0,0,0,0,0,
+5,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,6,12,0,0,7,0,0,0,5,0,0,
+0,0,0,0,0,0,0,6,0,0,8,6,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+15,7,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,6,0,0,24,7,0,0,0,0,0,0,0,0,0,
+7,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,6,0,
+0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,4,12,0,0,7,0,0,0,0,0,5,0,0,0,0,0,0,0,0,15,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,8,0,0,0,
+0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,9,0,9,6,
+0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,8,4,0,7,0,0,0,0,0,0,0,0,
+22,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,4,0,7,0,0,21,7,0,7,9,6,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,8,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,23,0,0,0,0,7,0,0,0,
+4,0,0,0,0,0,0,0,0,9,4,11,7,0,5,0,0,0,0,11,0,0,4,20,0,0,0,0,0,0,0,0,0,0,0,11,5,0,
+7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+21,0,0,0,0,0,0,7,0,0,0,0,0,0,0,5,0,0,0,0,0,6,0,0,0,0,11,6,0,0,0,0,0,0,0,0,9,6,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,5,0,4,9,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,
+0,0,0,10,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,8,7,0,0,11,7,0,0,0,0,0,0,0,4,
+0,4,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,5,0,0,0,0,0,0,0,0,0,0,8,7,0,
+0,0,0,0,0,0,0,0,6,0,0,21,6,0,0,0,0,0,6,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,14,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,8,0,0,7,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,
+0,0,0,8,7,0,0,11,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,5,0,0,0,7,13,7,10,4,0,
+0,0,6,0,0,0,0,0,0,0,0,0,5,10,0,0,0,0,0,0,5,0,0,0,7,0,0,0,0,0,0,8,4,0,0,0,0,0,6,
+0,0,0,0,0,0,0,0,0,0,12,7,0,6,0,0,10,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,6,0,
+0,0,0,0,7,0,0,8,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,10,5,0,6,0,0,0,0,0,4,0,0,0,0,
+0,0,0,0,0,4,0,0,0,0,9,0,11,4,0,0,0,6,0,0,0,5,12,7,0,5,0,0,0,0,0,4,0,0,0,7,0,0,0,
+0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,4,13,6,10,0,0,0,17,0,0,4,0,0,0,0,0,6,0,4,0,5,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,11,7,0,0,0,7,0,0,0,6,0,0,0,0,0,0,
+0,6,0,4,0,0,0,0,8,0,0,0,0,5,0,0,0,0,0,4,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,9,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,5,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,12,0,0,
+0,0,7,0,0,0,0,0,0,0,0,0,0,0,7,0,0,16,4,0,0,11,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+8,7,0,4,0,0,0,0,0,0,0,4,0,0,0,0,0,0,8,6,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,
+7,0,0,0,0,0,0,9,0,0,0,0,0,0,0,12,5,10,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,5,0,
+5,18,7,0,0,14,0,0,0,0,0,0,0,9,4,0,7,0,0,0,0,0,0,0,5,0,0,0,6,0,0,0,6,0,0,0,0,0,0,
+8,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,5,0,0,0,7,0,0,0,0,0,0,11,0,0,0,
+10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,14,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+11,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,14,6,0,0,0,0,11,4,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,10,7,0,6,0,0,9,0,9,5,0,0,0,0,0,
+0,0,0,10,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,8,5,0,0,0,0,0,0,0,0,0,0,11,4,0,6,
+0,6,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,12,4,0,6,8,6,0,0,0,0,0,0,0,0,0,0,8,0,0,5,0,0,0,0,0,0,0,7,0,0,13,0,0,0,0,0,0,0,
+0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,12,7,0,6,0,0,0,
+0,0,0,0,0,0,0,0,0,13,4,0,7,0,0,0,7,0,7,0,0,0,0,0,0,0,0,10,4,0,0,0,0,0,0,0,0,0,0,
+9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,10,6,21,5,0,0,0,0,8,0,0,0,0,4,0,
+7,0,0,0,0,0,0,11,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,4,0,0,0,0,0,0,
+0,7,9,6,11,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,7,10,0,0,0,0,0,0,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,19,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,18,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,7,0,0,0,0,0,0,9,4,10,4,0,7,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,9,7,9,7,10,4,0,7,0,0,0,0,0,0,0,6,12,0,
+0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,20,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,
+0,14,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,8,0,
+0,0,0,0,0,5,0,0,8,7,0,0,0,7,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,
+0,0,0,0,4,0,0,8,0,0,6,0,0,0,7,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,7,9,7,0,0,0,4,8,0,0,0,0,6,11,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,10,0,0,0,0,0,0,0,13,4,0,0,
+12,6,0,6,0,0,0,0,8,7,0,7,0,0,0,0,0,6,0,0,0,0,0,0,12,6,0,4,0,0,0,0,0,0,0,0,0,0,9,
+7,22,0,0,0,0,4,0,0,0,0,0,6,0,0,0,4,0,0,9,0,0,6,0,0,24,7,0,7,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,10,6,0,5,0,0,0,0,0,0,0,7,0,0,8,0,0,0,0,0,0,0,10,5,0,0,0,0,0,0,0,0,0,7,0,
+7,0,0,0,0,0,0,13,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,0,
+0,0,0,0,0,7,12,0,9,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,8,0,0,0,0,0,0,0,0,4,0,0,0,7,0,
+0,0,0,8,7,0,0,0,0,0,0,0,0,0,4,18,0,0,0,0,0,10,0,0,5,0,0,11,0,0,0,0,0,0,5,0,6,0,
+0,0,6,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,
+4,0,0,0,0,0,0,10,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,
+0,0,0,5,8,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,20,7,0,0,0,0,0,0,0,0,0,0,0,4,9,0,12,
+6,8,0,14,7,0,5,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17,0,0,0,0,0,10,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,9,6,0,7,12,0,0,0,0,4,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,
+0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,4,0,0,9,0,
+12,6,0,5,0,0,0,6,0,4,0,6,0,0,0,0,0,0,0,0,10,7,0,0,0,0,0,0,8,0,0,0,0,4,0,0,0,0,
+10,0,0,0,0,0,0,0,8,6,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,5,0,0,0,0,0,0,0,0,0,0,0,
+6,0,0,12,6,20,5,0,0,0,0,0,0,0,0,0,0,0,0,9,5,0,5,0,0,0,6,13,7,0,0,0,0,15,6,0,0,0,
+6,0,0,13,7,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,5,0,7,0,0,0,0,0,4,0,0,0,0,0,0,0,0,
+10,6,0,0,0,0,0,6,0,0,0,0,9,0,0,0,0,0,19,6,0,0,0,0,0,0,0,0,0,0,13,0,11,0,0,0,0,0,
+0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,0,0,0,0,0,10,0,0,6,0,0,0,0,8,0,0,
+0,9,0,15,4,0,6,0,0,0,0,0,6,12,0,0,0,0,0,0,0,14,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,
+0,0,0,0,0,8,7,0,0,0,0,0,6,10,0,0,0,0,0,0,0,0,7,8,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,7,10,5,0,0,0,0,8,0,0,0,0,4,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,6,12,0,0,0,10,7,0,5,0,6,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,6,0,4,0,0,0,0,0,7,0,0,0,0,0,0,0,4,9,6,0,0,0,7,0,0,0,0,0,0,0,0,8,6,0,0,
+0,0,0,0,0,4,12,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,7,0,
+0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,12,6,0,6,9,4,0,0,8,4,0,6,
+0,0,0,0,0,4,0,0,0,0,0,0,0,6,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,8,0,0,6,13,4,0,5,8,0,0,0,0,0,0,0,8,0,0,0,10,5,0,0,9,0,0,0,0,0,0,6,0,0,
+24,0,0,0,0,0,0,0,8,0,0,7,0,0,12,0,8,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,7,0,
+6,8,0,10,0,9,7,0,0,0,5,0,0,0,0,0,0,0,4,8,5,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,0,0,4,0,0,0,0,0,6,0,0,0,0,0,5,0,0,0,0,8,0,0,
+0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,10,4,0,0,0,0,0,0,0,6,0,0,0,4,20,0,0,7,
+10,6,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,7,0,0,0,0,9,6,0,0,0,0,0,0,0,4,
+12,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,9,4,0,5,0,0,
+0,0,0,0,0,6,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,6,9,0,0,0,0,7,0,0,0,0,0,6,0,5,0,0,0,0,0,0,0,0,9,0,0,0,
+0,6,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,17,7,0,0,13,6,14,6,0,0,0,0,
+8,0,0,0,0,0,0,7,12,7,8,7,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,4,0,0,0,0,0,4,0,
+0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,12,4,0,0,10,7,0,0,0,
+0,0,0,10,0,0,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,12,0,0,6,
+0,0,0,0,0,0,0,0,8,7,12,0,0,0,0,0,0,6,0,6,0,4,0,0,18,6,0,0,0,6,0,0,0,0,0,6,10,6,
+0,0,0,0,0,0,8,7,14,0,0,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,
+0,0,0,8,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,8,7,0,0,10,5,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,
+0,0,9,4,8,0,0,0,0,0,0,4,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,4,0,0,0,0,
+0,6,0,0,9,7,0,0,0,0,0,5,0,0,0,0,8,7,0,0,14,0,0,0,0,6,0,0,0,0,0,0,9,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,5,0,7,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,
+0,0,0,6,0,0,0,6,0,4,0,0,0,0,0,4,0,0,0,0,12,0,0,7,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,
+0,12,0,16,6,0,0,0,0,0,0,11,7,0,4,8,7,0,0,0,0,0,6,0,0,0,0,16,0,0,0,0,6,0,0,0,0,0,
+0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,10,7,0,0,0,0,0,0,12,7,0,0,0,0,0,0,0,0,0,0,
+0,0,10,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,13,4,0,0,10,0,0,0,0,0,0,0,0,0,19,0,0,0,
+0,0,0,0,0,0,0,0,0,0,8,6,22,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,
+5,0,0,0,0,0,5,0,0,0,0,0,5,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+4,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,7,0,0,18,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,14,7,0,0,11,5,0,0,0,5,0,0,0,0,12,5,0,0,0,0,0,0,0,0,0,0,24,6,0,0,
+0,7,0,4,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,7,0,4,0,0,0,0,8,7,0,0,
+9,6,0,0,14,5,0,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,12,6,0,0,0,0,0,0,0,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,7,0,0,0,5,0,0,
+0,0,12,7,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,6,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,6,0,0,13,7,0,0,0,0,0,0,14,0,11,4,0,
+0,0,4,0,0,0,0,14,5,0,0,0,0,0,5,11,5,0,0,0,0,22,5,0,0,0,0,0,7,0,0,0,0,0,4,0,0,0,
+4,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,17,0,10,0,0,0,8,0,0,0,19,
+5,18,7,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,10,6,0,6,0,0,0,0,10,4,0,4,0,
+0,0,0,0,0,14,7,0,5,0,0,0,0,0,6,0,0,0,0,0,0,0,0,8,0,9,6,12,0,0,6,0,0,0,0,0,0,0,0,
+12,0,10,6,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,4,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,5,13,0,9,7,0,0,0,0,0,0,0,0,0,0,0,7,9,7,0,0,8,0,0,0,0,0,
+22,0,0,0,0,0,0,0,23,6,14,0,0,0,0,0,0,7,0,0,0,0,11,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,
+0,0,10,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,8,5,0,0,0,0,0,0,0,0,0,7,11,6,21,0,0,0,0,0,
+0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,
+0,0,0,0,0,0,0,4,9,7,0,0,0,0,0,0,12,0,0,0,0,7,0,0,0,0,0,0,0,0,10,4,0,0,0,0,0,0,9,
+0,0,0,20,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,11,7,0,0,0,0,0,0,0,6,15,0,0,
+0,0,0,0,0,0,0,0,0,0,0,12,4,0,5,0,0,0,0,0,0,11,7,17,6,0,0,0,0,0,0,15,6,0,7,0,0,0,
+0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,14,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,6,0,5,
+0,0,11,0,11,7,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,
+17,0,0,0,0,6,0,0,0,5,0,0,0,0,0,0,8,7,9,6,0,0,14,0,0,0,0,0,0,0,0,0,16,0,0,0,0,0,
+8,7,0,4,0,0,0,0,0,0,0,6,0,5,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,
+0,0,0,5,0,4,0,0,8,7,0,6,12,5,0,7,18,7,0,0,8,5,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,
+10,0,11,0,0,0,0,0,0,0,0,0,0,0,9,0,0,4,0,6,0,7,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,
+7,0,0,0,0,8,0,0,0,15,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,0,0,0,0,0,0,
+0,0,6,0,0,0,0,23,0,0,0,10,7,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,5,0,0,0,0,0,0,8,6,0,0,
+0,0,0,0,12,7,9,7,0,0,10,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,9,0,8,7,0,0,0,
+6,0,6,0,4,0,5,0,0,0,0,0,5,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,7,10,5,0,0,11,6,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,14,0,0,0,0,4,9,7,0,
+0,0,0,11,7,0,0,0,0,0,5,0,0,0,7,0,0,0,0,23,6,11,4,0,0,0,0,0,0,9,0,0,0,10,6,0,0,0,
+0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,6,0,0,10,6,0,0,0,7,0,0,
+0,0,0,0,0,0,0,0,20,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13,
+6,11,7,0,0,0,0,0,0,0,0,0,0,0,0,10,5,0,0,0,6,0,0,0,5,0,6,0,6,0,0,0,0,0,0,0,0,0,0,
+0,6,0,0,0,0,8,7,0,5,0,0,0,0,0,6,0,0,0,0,0,0,0,4,10,0,8,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,10,6,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,0,
+0,0,0,0,0,0,10,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,11,6,0,4,0,0,14,5,0,7,0,0,0,0,0,6,16,0,0,0,0,0,0,0,10,0,0,7,15,0,0,0,11,7,0,0,
+0,0,0,0,0,0,0,0,8,7,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,5,0,0,0,
+0,8,0,0,6,0,0,0,0,0,0,9,5,0,0,23,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16,6,0,
+0,0,0,0,0,0,7,0,0,0,0,15,7,0,0,0,0,8,0,0,0,14,0,0,0,0,0,0,0,16,7,0,0,0,0,0,7,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,12,6,11,7,
+9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13,
+7,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,12,0,10,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,8,0,0,5,8,7,10,6,0,0,0,7,0,0,0,0,12,6,
+0,0,9,0,0,0,12,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,4,10,0,0,0,10,5,0,0,0,0,0,0,9,6,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,6,0,0,9,5,0,4,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,9,0,0,5,0,0,8,7,8,
+6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,10,0,9,4,0,0,0,0,0,0,0,6,
+11,0,0,0,0,0,0,0,0,0,0,0,8,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,8,7,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,
+0,0,0,10,0,0,0,8,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,
+0,0,8,4,0,5,0,0,0,0,0,0,0,7,0,0,0,6,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,22,0,0,0,0,0,0,0,8,5,0,0,0,
+0,0,0,0,7,0,0,0,6,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,5,0,6,0,7,0,0,0,0,
+20,0,0,0,0,0,0,0,0,0,0,7,9,0,0,0,0,0,0,6,0,6,0,7,0,0,0,7,0,0,0,0,0,0,0,4,0,0,0,
+0,0,0,14,7,0,0,0,5,0,0,22,4,10,0,0,0,0,0,0,4,8,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,11,5,13,0,0,0,0,0,0,0,0,0,8,0,0,7,0,0,0,0,0,4,0,0,0,4,0,0,0,0,0,0,10,7,0,
+0,0,0,0,0,0,6,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,7,0,7,14,6,0,0,0,0,9,5,
+0,0,0,0,0,6,0,0,0,5,10,0,8,6,0,0,0,0,0,0,0,0,9,7,0,0,0,0,0,0,0,6,0,0,8,4,0,6,0,
+0,0,5,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,
+14,0,0,5,0,0,18,0,8,4,0,6,0,0,20,0,13,0,0,0,0,7,0,4,0,0,0,0,0,4,8,4,0,0,0,0,0,6,
+0,0,0,0,0,4,0,0,0,4,0,0,0,0,0,4,0,0,0,0,0,0,0,0,14,0,0,0,0,0,9,7,0,0,9,0,0,0,0,
+0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,20,0,14,0,0,4,0,6,8,5,0,0,0,0,0,7,0,0,0,0,0,0,
+0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,10,4,12,7,0,6,0,0,9,7,10,5,
+0,0,8,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,17,0,0,0,0,0,0,0,18,0,0,0,14,7,0,0,0,0,0,4,
+0,0,0,0,0,0,17,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,13,4,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,
+0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,8,5,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,5,0,7,0,0,0,0,0,
+7,0,0,0,0,0,0,0,0,0,7,0,6,0,0,0,0,0,0,0,0,8,5,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,5,0,
+0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,23,0,0,7,0,0,0,0,0,0,
+0,0,0,0,0,0,0,4,0,0,0,0,0,0,12,7,8,4,0,0,0,0,0,0,0,0,0,6,0,0,9,5,0,0,0,7,0,0,0,
+0,0,0,0,0,0,4,10,0,0,7,0,0,0,5,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,5,0,0,18,7,
+0,0,8,0,0,5,0,0,10,0,0,0,0,0,0,6,0,0,0,0,0,5,0,7,0,0,0,0,0,0,0,0,0,0,16,0,0,0,0,
+6,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,6,0,0,10,0,0,5,10,4,0,0,12,0,0,0,0,
+6,22,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,5,0,0,0,0,0,7,0,5,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,6,0,7,0,0,0,6,0,6,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,5,0,0,0,7,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,
+0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,16,6,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,12,7,0,0,0,0,9,0,0,0,0,6,0,0,11,0,0,0,0,0,13,0,9,6,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,4,0,0,10,7,0,0,0,7,0,6,0,
+0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,11,0,15,0,22,7,0,4,0,6,0,0,0,0,0,7,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,4,0,7,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,
+18,0,0,0,0,0,0,0,0,0,14,0,0,4,0,0,0,0,8,7,9,0,0,0,0,0,9,0,0,0,14,0,0,0,0,0,0,0,
+0,0,11,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,7,0,0,0,6,0,6,0,0,0,0,8,0,0,0,0,
+0,11,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,9,4,0,0,0,0,0,4,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,8,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,
+0,0,0,0,0,0,8,6,0,0,9,5,0,0,0,0,0,0,0,0,14,0,0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,5,0,
+0,10,6,9,0,0,0,0,6,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,
+11,7,12,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,4,0,5,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,
+0,0,0,0,6,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,5,0,0,10,6,
+0,0,0,4,0,7,13,0,0,4,0,0,11,4,0,6,0,0,0,0,0,6,8,7,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,5,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20,5,0,0,0,0,12,6,0,0,0,0,
+11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,11,5,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,
+7,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,4,0,0,0,6,17,0,9,0,10,6,0,6,12,0,0,4,0,0,0,
+0,0,0,0,0,0,0,8,5,12,7,0,4,0,0,0,0,0,0,0,0,0,0,11,0,9,0,10,6,11,5,0,7,0,0,8,0,0,
+7,0,4,0,0,0,7,0,0,0,0,0,0,8,6,0,0,0,6,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,6,0,
+0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,11,0,0,0,0,6,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,10,0,0,0,0,0,8,6,0,0,0,0,0,6,12,0,0,0,0,0,
+0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,6,0,0,16,0,11,5,0,0,0,0,0,
+0,0,0,0,0,10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,9,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,8,4,0,0,0,0,0,6,10,
+7,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,6,0,0,0,0,0,0,9,5,0,0,0,0,8,0,9,0,0,
+0,0,0,0,0,0,7,10,0,13,0,0,6,0,0,0,0,0,0,0,0,0,6,9,4,0,0,0,0,0,0,10,0,0,0,0,0,10,
+0,0,0,0,0,0,0,10,6,11,0,0,0,0,0,9,0,0,0,0,0,0,4,0,0,0,0,0,0,10,5,0,0,0,0,0,6,0,
+0,0,0,0,0,18,4,0,7,0,0,0,0,0,0,24,0,8,6,0,7,0,0,0,0,15,0,0,0,0,0,0,0,0,0,0,0,0,
+0,8,5,0,0,0,0,10,7,0,6,0,0,0,0,0,0,0,0,8,5,10,0,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,
+6,0,0,8,7,0,0,0,0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,0,4,0,5,15,0,0,0,0,7,0,7,0,0,0,0,
+0,0,0,0,0,6,10,5,0,0,0,6,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,7,0,0,12,0,0,0,0,0,0,0,0,
+0,0,5,0,0,0,0,0,0,14,4,18,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,11,0,10,4,9,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,4,0,0,0,0,0,7,0,0,0,
+0,0,0,0,0,0,0,0,7,13,7,0,0,0,0,0,0,0,5,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,6,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,8,0,10,6,0,4,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,6,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,
+0,0,0,0,0,0,0,10,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,9,7,0,0,0,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,0,0,0,0,6,0,0,0,
+0,0,0,0,5,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,6,0,0,0,5,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,11,0,0,0,0,6,0,0,0,0,0,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,22,0,0,
+6,0,0,0,0,0,0,0,6,10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,0,0,0,0,
+0,0,0,0,0,0,0,6,0,6,0,0,0,5,0,0,0,0,0,0,0,5,0,0,10,0,11,5,0,0,0,0,0,0,14,7,9,7,
+0,6,0,0,0,0,0,4,0,0,0,0,0,0,11,7,0,6,0,0,0,0,0,0,9,7,0,4,0,0,0,7,0,0,0,0,0,5,0,
+0,0,0,0,5,0,0,0,7,0,0,0,0,0,5,0,0,0,0,17,5,0,0,8,0,0,0,0,6,9,4,0,0,0,0,0,0,0,0,
+8,7,11,7,9,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,6,9,5,0,0,8,6,0,0,0,5,0,
+0,0,0,9,0,0,0,9,6,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,
+0,0,0,0,4,0,0,0,0,10,0,0,0,0,0,0,0,0,4,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,4,0,0,0,5,0,0,0,0,0,7,0,0,0,0,0,7,13,5,0,0,0,7,0,0,0,0,0,7,9,6,11,7,0,7,0,0,0,
+0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,8,5,0,0,0,5,9,4,0,0,0,0,0,0,0,0,8,4,0,0,0,0,
+24,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,
+0,0,0,0,6,0,0,0,7,0,0,0,6,0,0,0,0,0,0,0,0,0,5,11,6,0,4,0,7,20,0,8,5,9,5,9,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,7,23,5,0,0,8,4,0,0,10,0,0,6,0,5,0,0,0,0,0,0,0,0,0,0,0,7,0,
+0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,9,0,0,0,
+10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,
+6,0,0,0,0,14,0,18,4,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,9,6,0,4,0,0,0,0,0,0,8,4,
+11,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,8,4,0,0,0,0,0,0,0,0,12,0,10,7,0,0,10,0,0,0,0,
+0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,6,0,0,0,0,8,
+6,10,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,4,0,6,0,4,0,0,0,0,0,5,0,0,
+0,0,0,0,0,0,0,7,0,0,0,7,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,17,7,11,0,0,0,0,0,0,0,0,0,0,4,12,6,0,0,0,5,0,0,0,6,0,0,0,0,0,0,0,0,0,0,
+0,5,12,7,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+7,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,6,0,6,0,0,20,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,4,
+0,0,0,5,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,6,0,4,13,0,0,7,0,0,0,0,0,0,
+0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,0,12,6,0,7,0,0,0,0,10,0,23,6,0,0,
+0,4,0,0,0,0,0,6,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+10,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,11,0,9,7,0,0,
+0,0,0,0,0,0,0,0,9,7,0,4,0,0,0,0,8,7,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,
+0,0,0,0,0,6,0,0,10,7,10,5,0,0,8,0,8,0,0,0,0,0,0,4,0,5,10,0,0,0,0,0,0,0,9,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,11,7,0,0,0,0,0,0,0,0,9,4,0,0,0,0,0,6,0,0,8,
+7,0,0,0,0,0,5,0,0,0,0,0,0,0,0,10,0,0,0,0,5,0,4,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,24,7,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,6,0,0,9,0,0,0,0,0,0,7,0,6,13,0,8,
+0,0,0,0,0,0,0,0,0,9,7,0,0,0,0,0,0,0,6,0,0,0,0,8,5,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,
+4,0,0,0,0,0,4,0,0,0,0,0,0,0,6,8,0,0,0,0,6,8,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,4,0,4,0,0,0,5,0,7,0,0,10,0,10,7,0,0,12,5,0,0,9,0,0,0,10,0,
+0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,5,0,0,0,0,0,0,
+12,0,0,0,0,0,8,5,13,6,0,0,0,0,0,0,9,4,0,0,0,0,8,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,
+0,0,6,0,0,14,0,0,0,0,6,0,0,0,0,0,6,0,0,0,0,17,6,0,0,0,0,12,6,0,0,0,0,8,0,0,7,0,
+7,0,4,9,0,0,6,0,0,0,6,0,0,0,0,0,0,8,7,0,0,0,0,0,0,11,0,0,4,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,18,7,0,4,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,6,0,0,0,0,0,
+0,0,0,12,5,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,8,0,11,7,0,0,0,0,0,0,0,0,0,4,0,0,0,0,
+11,0,0,0,0,0,0,0,21,0,0,6,10,0,0,0,0,0,9,0,10,0,0,0,0,0,11,0,0,0,0,6,0,0,0,0,0,
+5,0,0,0,0,0,0,10,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,4,0,0,23,7,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,9,7,0,0,0,7,
+0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,6,0,0,
+11,6,0,0,0,0,0,0,0,6,0,0,0,0,10,7,0,0,9,4,0,0,11,0,8,5,0,0,0,7,8,5,22,0,0,0,9,6,
+0,0,0,0,0,0,0,6,10,4,0,0,0,0,0,7,9,4,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,4,0,
+0,0,0,11,6,0,0,0,0,0,0,0,0,0,0,0,7,0,6,0,0,0,0,0,7,0,0,0,0,0,0,0,6,0,6,0,4,0,0,
+0,0,0,0,0,7,0,7,0,4,13,0,0,0,0,0,8,0,0,0,0,7,0,0,0,0,0,0,11,6,0,7,0,0,0,0,9,0,0,
+0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,8,0,0,0,0,0,8,0,0,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,6,0,0,0,0,13,5,8,0,0,
+0,0,0,0,0,14,0,0,6,0,0,0,0,0,0,0,0,0,7,0,0,17,6,0,0,0,0,13,4,0,0,9,6,0,0,10,5,0,
+0,10,5,0,0,0,0,13,0,0,0,0,6,0,0,0,0,0,0,10,0,12,0,0,0,0,0,0,0,0,0,0,0,8,4,0,4,0,
+0,0,4,0,0,0,0,0,4,0,0,12,0,0,5,9,4,0,0,0,0,0,0,0,0,0,5,8,5,0,0,0,7,0,0,0,0,8,7,
+0,0,0,6,12,5,0,0,0,5,0,0,0,5,0,0,0,0,0,4,12,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,8,7,0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,
+0,9,6,0,0,0,0,0,0,0,0,0,4,0,0,0,6,0,0,0,4,11,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,
+0,0,0,0,12,7,0,0,0,7,10,7,0,0,11,0,0,0,0,0,0,0,0,0,11,7,0,0,0,6,0,0,11,0,0,0,0,
+0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,22,0,10,7,0,0,8,5,0,0,0,0,0,5,0,0,0,0,0,0,
+0,0,0,0,9,6,8,7,0,6,0,0,0,0,0,5,0,0,0,0,0,0,8,7,0,0,0,0,9,7,0,0,0,6,0,0,8,7,0,0,
+0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,4,0,5,0,0,0,4,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,6,0,0,0,0,0,0,0,4,0,0,0,0,0,0,9,
+6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,4,0,0,0,5,0,0,0,0,14,0,0,0,
+9,0,0,0,0,0,0,0,0,0,9,7,12,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,12,0,0,0,0,0,12,7,0,0,0,5,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,10,7,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,6,0,0,0,0,0,0,9,6,0,0,0,0,0,6,0,0,0,0,0,
+0,0,0,0,0,9,0,0,0,0,7,0,6,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,
+0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,6,0,7,12,6,0,0,0,0,0,5,0,0,0,0,0,0,0,0,
+0,7,0,0,8,6,0,0,0,0,10,7,0,0,0,0,0,0,0,6,0,0,0,0,0,6,12,0,0,0,0,0,0,0,0,6,0,0,0,
+0,0,6,0,0,0,6,0,0,0,0,0,6,16,0,0,0,0,0,0,0,0,0,9,0,17,0,14,7,8,0,0,0,0,0,0,6,0,
+0,0,0,0,0,0,0,0,0,11,0,0,6,8,7,0,6,0,0,0,0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,0,0,0,0,
+9,0,0,0,0,7,0,0,0,0,11,5,0,4,9,6,8,0,0,0,0,0,0,0,0,0,10,0,11,7,0,0,0,0,0,0,0,0,
+9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,
+0,0,0,12,0,0,0,0,0,10,5,0,4,0,0,0,0,0,7,10,6,11,6,0,0,0,0,0,0,0,0,0,0,0,0,17,0,
+0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,8,0,0,4,0,0,0,6,0,0,0,
+0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,14,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,4,0,0,0,0,9,6,0,0,0,4,0,0,0,0,0,4,10,7,0,7,0,0,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,
+0,0,0,0,0,0,6,0,0,0,6,0,6,0,0,0,0,10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,18,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,13,0,0,0,0,0,10,0,0,0,0,0,0,0,0,4,
+0,0,0,6,0,0,0,0,0,4,8,0,0,0,11,7,0,0,0,4,0,0,0,0,0,7,0,0,8,5,0,0,16,0,0,0,13,6,
+0,0,0,0,0,0,0,6,0,0,0,0,20,0,11,6,0,0,8,7,0,0,0,0,0,6,17,0,8,0,0,0,0,0,8,7,0,0,
+9,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,
+0,0,4,0,7,0,0,0,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,8,
+0,8,0,0,0,0,0,0,0,11,0,8,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,6,0,0,9,0,
+0,0,0,0,8,0,0,0,0,0,18,0,0,0,0,0,0,4,9,0,0,0,0,0,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,9,6,0,0,0,0,0,0,0,0,0,0,13,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,8,7,0,0,0,0,0,0,0,0,
+0,4,0,0,0,0,0,0,14,0,0,0,0,7,0,6,0,0,8,0,20,7,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,8,0,0,0,14,0,0,0,0,0,0,0,8,0,0,7,0,6,0,0,0,7,0,0,0,0,0,0,0,0,
+0,0,0,4,12,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,10,6,0,
+5,16,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,
+0,0,0,5,8,4,0,0,0,0,0,0,0,4,0,0,0,7,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,12,7,0,
+0,0,0,13,6,0,0,0,7,0,0,8,0,0,0,8,0,0,0,0,0,0,0,0,0,0,5,0,0,0,7,0,0,0,0,0,0,11,5,
+0,6,0,0,8,5,0,7,0,0,0,0,0,0,0,7,0,0,0,0,8,6,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,4,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+14,0,10,7,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,19,0,0,4,0,0,0,7,
+0,0,11,5,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,16,0,10,5,18,0,0,7,9,6,0,5,0,0,0,0,0,
+0,0,0,0,5,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,5,0,0,0,7,0,6,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,6,0,0,0,4,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,0,0,7,23,0,0,0,0,5,0,0,0,0,0,0,8,5,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,14,0,20,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,
+11,0,0,0,0,7,0,0,0,0,15,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,7,0,0,0,0,
+0,4,0,0,0,0,10,0,0,0,0,0,9,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,10,0,11,6,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,5,0,0,11,0,0,0,0,7,0,0,0,0,0,0,8,7,0,
+4,0,0,0,0,11,0,0,0,0,0,11,0,0,5,0,0,8,7,0,4,0,7,0,0,0,0,0,0,0,6,0,0,0,0,0,4,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,10,5,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,6,0,5,0,0,0,0,0,0,0,
+0,0,4,11,5,10,7,0,7,0,0,9,6,9,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,9,4,0,4,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,8,6,0,0,0,0,11,7,0,0,0,0,0,0,0,0,0,0,11,7,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,8,5,0,0,8,0,9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,4,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,
+10,7,0,0,0,6,0,0,0,0,0,0,8,0,0,6,0,0,0,6,10,0,0,0,0,0,0,0,0,0,0,0,8,5,0,0,0,6,0,
+0,0,6,0,0,0,0,9,5,8,5,8,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,
+0,8,7,10,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,0,11,7,0,0,0,0,0,5,0,0,0,6,0,7,0,0,
+10,5,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,11,0,0,0,0,0,13,4,
+0,0,0,4,0,0,0,0,0,5,8,0,0,0,12,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,7,14,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,7,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,5,0,0,15,6,10,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,14,6,10,0,0,0,0,0,0,0,0,6,0,
+0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,0,0,9,7,0,0,0,0,0,6,0,5,11,4,0,6,0,0,0,7,0,0,0,0,
+0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,5,0,0,8,5,0,0,0,0,0,0,0,0,0,0,
+0,0,10,0,0,0,0,0,9,6,9,4,0,0,0,4,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,8,5,0,
+0,0,0,0,0,0,0,0,0,0,4,0,0,11,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,5,0,0,0,0,0,0,
+0,0,0,7,12,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,
+4,9,6,0,4,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,6,0,
+7,8,6,0,0,0,0,0,0,0,4,0,0,9,6,0,0,0,0,0,0,0,0,0,6,0,5,0,4,0,0,0,0,0,0,0,5,0,0,0,
+0,0,5,0,0,0,7,12,7,0,0,0,0,0,0,18,4,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,6,0,0,0,
+0,12,0,0,7,0,0,0,0,0,7,0,0,13,0,0,6,0,0,0,0,8,7,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,7,10,5,0,0,8,0,0,0,0,0,0,0,8,6,0,7,0,0,8,4,0,4,0,0,0,0,10,4,0,0,14,0,
+0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,17,0,0,0,0,0,0,6,0,0,0,0,8,6,0,0,10,5,0,0,0,0,8,
+6,0,0,0,6,0,0,0,7,0,0,0,0,0,6,14,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,12,0,0,0,0,6,
+8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,
+0,0,0,6,0,0,0,0,0,0,0,0,0,0,12,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,4,24,0,0,
+0,0,0,12,6,0,0,10,6,0,5,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,17,7,0,5,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,11,5,9,0,8,7,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,10,7,0,0,0,0,0,0,0,7,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,11,5,8,7,0,0,0,
+0,8,5,0,0,0,0,10,7,0,7,0,0,0,0,0,0,0,0,0,0,13,6,0,0,0,0,0,0,0,0,0,6,0,4,0,0,0,0,
+0,6,12,0,8,7,0,0,0,0,0,0,0,0,0,0,16,0,10,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,22,0,0,0,
+0,0,0,0,0,0,0,0,0,0,13,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,22,0,0,6,0,0,21,0,0,0,22,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,6,0,0,0,5,0,0,0,0,0,7,8,0,0,0,0,6,14,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,8,6,0,0,0,0,0,0,
+0,0,0,0,0,6,0,0,0,0,8,5,0,0,11,7,0,6,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,5,0,0,0,0,0,0,0,0,0,4,0,0,8,7,0,0,0,0,8,5,11,7,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,8,5,0,0,10,0,0,4,13,7,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,5,0,0,13,6,
+0,6,0,7,0,0,8,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,15,0,0,0,10,7,0,0,0,0,0,
+7,0,0,0,0,0,0,0,4,0,0,0,0,0,6,0,0,0,0,19,0,0,0,0,6,0,0,0,0,0,4,0,0,0,0,0,6,0,5,
+0,7,0,0,0,0,0,0,0,0,0,6,0,0,11,4,0,0,0,6,0,0,13,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,8,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,14,0,0,0,0,0,0,0,0,0,0,0,12,6,0,0,0,0,
+0,7,0,0,0,0,0,0,11,7,0,0,0,0,0,6,0,0,10,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,5,11,6,
+0,0,0,0,0,0,0,0,10,0,0,0,0,6,0,0,0,0,0,0,8,7,0,0,0,5,0,0,0,5,0,0,0,0,0,0,0,0,0,
+0,0,0,8,7,0,0,0,0,9,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,10,7,0,0,0,0,10,0,
+0,6,0,0,13,0,0,0,0,0,0,0,9,6,0,0,8,6,8,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,4,0,
+0,9,7,0,0,0,0,0,0,11,0,0,0,10,7,0,0,0,0,0,0,0,0,9,6,0,0,12,4,0,4,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,6,0,0,0,0,21,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,5,0,0,
+9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,4,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,
+16,0,0,4,0,0,0,0,0,7,0,0,0,6,0,6,0,0,11,0,0,0,0,5,0,0,0,0,0,0,0,4,8,5,0,0,0,0,0,
+0,14,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,
+0,0,8,0,0,0,0,0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,14,0,0,0,0,0,0,0,0,4,0,0,0,4,0,0,0,
+0,0,0,0,6,9,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,14,7,0,0,9,7,0,0,11,0,0,0,0,0,10,
+4,11,5,13,6,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,5,0,0,0,0,0,4,0,0,9,0,0,0,0,
+0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,6,12,5,0,0,0,6,14,0,0,0,0,0,0,0,0,0,0,4,9,4,
+0,0,0,0,0,5,0,0,0,0,0,0,0,4,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,5,0,0,
+0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,11,6,0,0,13,7,0,0,13,6,0,7,0,0,0,0,0,0,8,6,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,10,6,0,4,0,0,12,6,0,0,0,0,0,0,0,0,10,6,
+0,0,0,6,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,6,0,
+0,0,0,0,7,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,8,6,0,
+0,0,7,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,
+0,0,0,5,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,
+0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,8,7,0,0,8,5,0,0,0,4,9,5,0,0,0,7,10,6,0,0,
+0,0,0,0,9,7,0,0,8,5,8,0,8,4,0,0,13,0,0,0,0,0,0,0,0,0,0,0,0,5,0,5,0,0,0,0,0,0,0,
+0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,4,0,0,0,0,0,0,0,0,0,
+0,11,7,0,0,0,7,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,17,5,0,0,0,7,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,9,7,0,0,0,0,8,5,0,4,0,0,0,0,0,6,0,6,14,
+6,0,0,0,0,9,6,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,6,0,0,0,0,14,7,9,7,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,16,
+0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,14,0,
+0,6,0,0,8,6,0,0,0,0,0,6,0,0,12,0,0,0,0,0,8,5,0,7,11,0,0,5,0,4,0,0,0,6,0,0,0,0,0,
+0,0,0,0,0,0,0,9,6,0,4,0,6,0,0,0,0,0,0,0,0,0,0,0,0,11,6,0,0,0,0,0,0,10,5,0,0,0,0,
+0,4,0,0,0,7,11,6,0,4,8,5,9,5,0,0,0,5,0,7,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,8,5,14,7,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,16,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,9,6,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,9,0,0,0,12,5,0,0,0,0,0,0,0,4,10,5,0,0,0,0,0,0,0,0,0,0,0,6,0,
+0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,4,0,0,0,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,10,4,0,0,0,0,0,5,0,0,0,4,
+0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,8,0,10,7,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,10,7,0,0,0,0,0,0,0,0,15,0,0,0,
+0,0,0,0,0,0,0,7,0,0,0,0,0,7,10,7,9,7,0,0,0,7,0,0,8,0,0,0,0,0,0,0,9,0,0,0,8,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,11,0,8,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,7,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,15,7,12,6,0,0,0,7,0,5,0,0,0,0,0,0,0,0,0,0,0,0,18,0,0,5,0,0,0,0,
+0,0,0,6,9,5,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,9,7,0,0,14,0,0,0,11,7,0,0,0,0,0,
+0,0,0,0,0,0,4,0,0,11,7,0,0,0,0,8,0,0,0,0,0,0,6,8,7,0,0,0,7,10,4,0,0,0,0,0,0,0,0,
+0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,10,0,0,0,0,0,0,
+6,0,6,0,0,0,0,0,4,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,11,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,7,0,0,10,7,0,0,0,0,9,7,0,0,0,0,0,0,13,7,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,12,0,
+0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,9,6,0,0,11,0,0,
+0,0,0,14,4,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,23,7,0,0,
+0,0,0,6,0,7,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,5,0,0,0,0,20,
+7,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,8,0,0,0,0,0,0,0,0,0,11,5,0,0,0,0,0,0,0,0,0,0,10,4,0,0,0,5,8,5,10,4,0,0,0,0,0,
+0,13,6,9,7,0,0,10,7,0,0,0,0,0,0,0,0,14,0,0,0,0,0,0,6,0,0,0,7,0,6,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,7,10,7,0,0,
+0,0,0,0,0,0,0,0,12,4,0,0,0,0,8,7,0,0,0,0,0,7,0,6,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,
+0,0,0,0,6,0,6,9,6,0,0,12,5,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,6,0,0,0,0,
+0,0,0,0,0,0,0,0,0,5,8,7,9,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,11,
+4,0,0,0,0,0,0,8,0,0,0,10,7,0,4,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,0,8,0,
+0,0,0,0,0,5,0,6,0,0,10,0,14,0,0,0,0,0,0,0,23,0,0,0,12,0,10,5,0,0,0,0,0,0,0,0,0,
+5,0,0,0,0,8,0,0,0,0,6,8,0,0,0,0,0,0,0,0,0,22,0,8,0,0,0,0,6,0,0,0,0,0,0,0,5,0,0,
+0,0,0,0,0,6,18,4,0,0,0,7,10,6,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,
+0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,7,10,0,0,0,0,0,0,6,0,0,0,0,11,5,0,0,0,0,0,0,0,0,
+15,0,8,6,0,0,13,7,0,0,0,0,0,7,0,0,0,0,0,7,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,9,5,9,
+0,0,6,8,6,0,0,0,0,10,0,0,0,18,5,0,0,0,5,0,7,0,0,0,0,8,6,0,0,0,0,9,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,14,0,23,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,6,0,0,0,5,0,
+0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,8,5,0,0,0,0,0,0,0,0,9,0,0,0,0,4,0,0,0,0,0,0,0,0,
+0,0,0,0,20,5,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,9,5,0,0,0,0,0,0,8,4,24,0,0,0,0,0,0,
+0,0,0,0,0,0,0,9,7,0,0,0,0,10,5,0,0,8,5,0,0,0,0,0,0,0,0,12,7,0,6,0,0,10,6,0,0,0,
+0,14,0,0,4,9,5,0,0,0,0,0,0,9,0,0,0,0,0,0,6,0,0,0,0,0,4,0,0,8,0,0,0,0,0,11,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,8,5,11,7,0,4,0,0,10,0,0,0,0,
+0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,11,6,0,0,0,0,0,5,14,6,0,0,0,0,10,0,0,
+0,13,4,0,0,0,0,0,0,0,0,0,0,0,6,0,0,10,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,7,12,0,10,6,0,0,0,0,0,0,10,0,0,0,0,0,10,0,9,
+7,0,0,0,0,0,0,0,0,0,0,0,0,0,7,8,0,0,0,0,0,0,0,0,0,0,0,0,4,0,7,0,0,0,0,9,7,0,0,0,
+0,0,0,0,0,0,0,0,0,24,0,11,7,0,7,0,0,0,0,0,0,8,6,0,0,0,0,0,0,8,7,0,0,0,0,0,5,0,0,
+0,6,9,0,0,0,23,5,0,0,0,0,0,6,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,16,7,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,0,18,4,0,0,11,7,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,
+0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,9,0,0,0,11,0,0,0,23,0,0,
+0,10,4,0,0,0,0,0,7,0,0,0,7,0,0,0,0,0,4,0,0,0,0,0,7,0,0,19,0,11,0,0,0,0,0,12,7,0,
+0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,5,0,0,0,0,0,5,0,0,0,0,0,5,0,0,0,0,0,0,0,6,0,0,
+9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,4,0,0,0,0,10,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,4,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,22,0,8,7,10,4,11,0,13,5,8,7,9,0,8,7,0,0,0,7,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,
+0,8,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,4,0,0,0,4,11,0,0,6,0,0,8,5,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,8,5,0,0,
+20,0,0,0,0,0,0,0,0,0,11,0,0,0,0,5,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,7,0,0,14,0,0,0,9,0,13,7,0,0,0,0,0,6,0,7,0,0,8,6,10,6,0,0,8,6,0,0,0,6,0,
+0,12,6,9,0,0,0,0,0,0,5,9,0,12,4,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,8,5,0,0,0,0,0,
+0,0,4,8,0,0,6,8,0,0,0,0,0,0,0,0,0,13,6,0,7,0,0,0,0,0,6,8,7,8,6,0,0,0,7,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,18,0,11,4,0,0,0,5,0,0,0,0,0,0,0,0,0,0,
+0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,14,
+6,0,0,0,0,12,7,8,0,0,0,0,0,0,0,8,7,0,0,0,0,10,4,0,0,0,0,0,0,10,0,0,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,15,6,9,7,0,0,0,0,0,0,15,6,11,7,0,0,0,7,0,0,21,0,0,
+0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,17,6,0,0,10,5,0,5,0,0,0,0,0,0,0,0,0,7,
+0,0,10,0,0,0,0,0,0,0,0,4,11,5,0,0,0,0,16,7,0,0,0,0,0,6,0,0,8,7,0,4,0,0,10,0,0,0,
+0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,8,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,
+0,0,0,10,4,0,0,0,0,0,0,0,0,0,6,0,5,0,0,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,
+0,7,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,6,10,7,0,0,0,0,0,0,0,0,8,4,0,0,10,0,0,0,0,4,0,6,0,6,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,7,17,0,0,0,0,0,
+0,0,0,0,0,0,10,0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+6,0,0,0,5,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,5,0,4,0,0,0,0,0,6,0,0,0,0,0,0,10,5,0,0,
+0,5,0,0,0,0,9,0,19,7,0,0,0,0,0,7,0,0,0,0,10,6,0,0,0,6,0,5,0,0,0,0,0,0,0,0,0,6,8,
+0,0,0,0,0,11,0,0,0,0,0,0,6,0,0,0,0,0,7,9,0,15,0,0,0,0,0,0,0,0,0,0,4,0,0,0,5,0,0,
+0,0,0,0,0,6,0,0,0,0,0,0,0,4,0,0,0,0,9,0,0,0,0,0,0,0,0,6,0,7,0,0,0,0,0,0,0,6,0,0,
+0,0,0,6,10,0,0,0,0,0,0,0,23,0,14,0,0,0,0,7,0,0,0,0,0,7,0,0,9,0,0,0,0,7,0,0,0,0,
+0,6,0,0,14,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,4,0,0,0,
+0,0,0,0,0,9,5,0,0,0,0,0,4,0,0,0,0,9,5,0,0,0,0,22,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,22,0,0,0,0,0,0,0,10,0,0,0,0,0,0,5,0,4,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,11,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,14,7,0,0,12,7,0,0,0,
+0,0,0,0,0,0,4,0,0,0,0,0,6,0,0,0,0,8,6,10,0,0,0,0,0,0,0,0,0,10,7,8,5,0,0,0,0,0,0,
+0,0,8,4,0,0,0,0,0,0,0,0,0,0,0,0,10,0,0,5,0,0,9,5,0,0,0,0,0,5,0,0,0,0,0,4,0,0,0,
+0,0,0,0,0,0,0,12,4,11,0,0,0,9,0,11,7,0,0,0,0,0,0,10,6,0,0,0,6,0,0,0,0,15,5,0,0,
+11,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,4,0,4,0,6,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,8,0,0,0,19,7,0,4,0,0,9,0,0,0,0,0,10,0,
+0,6,0,0,13,0,12,6,0,0,0,0,0,0,0,0,10,7,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,13,7,10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,4,9,0,0,0,10,0,0,0,0,0,0,0,
+0,5,0,0,0,0,0,0,10,0,23,6,0,0,0,6,8,0,0,0,0,0,0,0,0,0,17,7,0,0,0,0,11,6,22,5,0,
+0,9,6,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,5,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,4,11,0,9,4,0,0,
+0,7,0,7,0,0,0,0,0,0,12,4,0,0,0,0,0,0,0,0,0,0,0,0,11,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+4,0,0,11,5,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,8,6,0,0,0,4,0,0,0,0,
+0,0,0,0,0,7,0,0,0,4,0,0,10,4,0,0,0,0,0,0,0,7,0,7,0,0,0,6,0,0,0,0,8,6,0,6,0,6,0,
+0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,0,0,0,0,9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,6,22,6,12,0,0,6,0,0,0,6,0,0,0,0,0,7,0,0,0,0,11,0,0,0,
+9,7,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,6,0,0,0,6,0,6,0,0,8,7,0,0,0,4,9,7,19,0,0,0,0,0,0,0,0,0,9,6,10,6,0,6,0,0,0,
+4,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,6,16,7,10,6,0,0,23,6,11,7,0,4,0,0,0,0,0,0,0,0,0,
+5,0,0,0,0,10,7,0,0,0,0,0,7,0,0,0,0,0,0,15,0,10,0,0,0,14,6,0,0,0,0,0,0,0,0,0,0,0,
+5,0,0,0,0,0,0,0,5,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,5,0,0,11,5,0,0,0,0,0,0,0,0,0,0,
+0,4,0,0,0,0,0,6,0,0,10,0,0,0,0,7,0,0,0,0,0,0,10,6,0,0,0,0,8,4,0,0,0,7,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,7,12,5,0,0,0,0,
+0,6,0,0,0,0,9,6,0,0,0,0,0,0,0,6,9,0,0,0,0,6,0,0,0,0,8,7,0,0,0,0,0,0,0,6,0,0,0,0,
+0,0,0,0,0,0,10,5,0,0,0,0,0,0,8,6,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,8,5,0,0,0,0,0,7,0,7,0,4,0,0,10,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,5,0,0,0,0,13,
+7,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,7,0,0,13,0,0,0,0,0,0,0,0,7,10,5,0,0,0,0,0,0,9,7,0,0,8,6,9,
+5,0,0,0,0,0,6,12,0,0,0,0,0,0,0,18,6,0,0,0,0,0,0,0,0,19,7,0,4,0,0,0,0,9,5,0,5,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,7,0,0,0,0,0,0,14,0,0,0,23,7,8,7,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,22,0,0,7,0,0,0,0,0,0,0,0,9,7,8,4,0,
+0,0,0,0,0,0,0,8,5,0,6,0,0,0,0,0,6,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,
+8,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,12,5,0,0,0,0,0,0,0,0,0,0,8,6,0,0,11,7,0,0,0,
+0,12,0,8,6,19,7,0,0,0,0,0,0,0,0,0,0,0,0,0,6,11,0,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,11,7,0,0,0,0,0,4,10,0,0,0,0,0,0,0,8,7,0,0,0,0,14,0,8,0,0,6,10,0,0,
+0,0,0,0,0,12,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,6,0,0,0,0,
+0,0,0,0,13,0,0,0,0,0,0,0,11,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,
+0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,5,0,0,0,6,0,0,0,5,0,7,0,0,0,
+0,0,6,0,0,21,7,0,0,9,6,0,0,0,6,0,0,13,7,0,0,0,5,0,0,0,0,0,4,0,6,0,0,0,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,0,11,5,0,6,0,0,10,5,0,0,0,0,0,0,0,0,9,6,0,0,8,7,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,9,0,0,0,0,0,0,6,0,0,0,0,15,4,0,0,12,7,0,0,0,6,
+0,7,0,0,8,0,9,5,0,4,0,0,0,6,0,6,0,0,23,4,0,0,0,0,0,0,0,0,0,0,0,0,10,7,0,4,0,0,8,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,6,0,0,0,0,0,0,0,0,0,
+7,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,12,6,0,0,0,0,0,0,10,7,0,7,0,0,0,0,0,0,0,0,0,0,
+9,0,0,0,0,0,8,0,0,0,0,4,0,0,0,0,0,0,0,0,0,4,11,5,0,0,0,6,0,6,0,0,0,0,0,0,0,6,0,
+4,0,0,0,0,0,0,0,0,0,0,0,5,8,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,8,7,0,0,0,6,0,6,0,
+0,0,0,0,0,0,0,0,5,0,0,0,0,0,5,0,0,0,0,11,0,0,0,0,0,0,0,10,5,9,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,23,7,0,0,0,0,0,7,0,0,10,6,18,0,0,0,
+0,0,0,0,8,7,0,6,0,0,0,0,0,0,8,5,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,
+0,0,0,0,0,6,0,0,0,4,12,7,0,0,0,0,0,0,0,0,10,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,13,5,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,4,0,0,0,0,0,0,0,0,
+11,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,
+0,0,0,0,6,0,0,0,4,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,10,0,11,0,0,0,0,0,0,0,0,0,
+17,5,0,4,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,4,0,0,0,0,8,7,0,0,0,0,0,0,0,
+0,13,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,0,
+10,0,0,0,8,6,0,0,0,7,0,0,0,0,0,0,8,0,0,0,14,0,0,0,0,7,0,0,0,4,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,9,4,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,14,0,
+10,0,0,0,16,5,0,0,0,0,0,0,8,0,0,4,0,0,0,0,0,0,0,0,0,0,9,6,0,0,0,0,0,0,10,0,0,0,
+0,0,0,0,0,5,0,0,0,0,12,5,0,7,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,7,0,
+0,0,0,0,0,0,0,12,6,0,0,0,0,0,7,0,6,0,6,12,6,0,0,0,0,0,0,0,4,8,7,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,20,0,0,0,0,6,0,6,0,0,0,0,0,0,0,0,10,6,8,0,0,
+6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+16,0,8,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,23,5,0,0,0,7,0,6,0,
+0,0,0,0,0,0,0,0,0,0,0,10,6,0,0,9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,14,0,0,0,0,7,0,0,0,4,17,5,0,0,0,0,11,0,9,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,6,0,0,0,5,0,7,0,0,0,0,0,0,0,0,8,0,0,0,
+12,6,0,0,0,0,0,0,13,0,0,0,0,7,9,0,0,0,0,0,0,0,0,0,0,5,0,0,0,7,10,7,12,0,0,0,9,0,
+0,0,14,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,0,0,15,6,0,0,23,0,0,7,0,6,0,0,0,7,0,6,
+0,0,0,0,0,0,0,6,0,6,9,0,0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,8,7,9,4,0,0,10,0,0,0,10,
+6,0,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,23,0,0,6,0,0,0,0,0,0,9,4,
+0,0,10,7,0,0,0,0,0,0,0,0,0,0,0,0,9,7,0,0,9,6,0,0,0,0,8,6,0,0,0,0,0,0,0,0,12,0,0,
+0,0,0,8,0,0,6,11,6,0,0,8,7,8,5,0,0,0,0,0,5,0,0,0,0,0,0,0,4,0,0,0,4,0,0,0,0,0,0,
+10,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,
+7,0,0,0,0,9,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,8,0,0,0,0,6,12,5,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,10,0,10,
+7,0,0,8,0,0,0,0,4,0,0,0,6,0,0,0,6,0,0,0,6,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,5,0,
+0,0,4,0,0,0,0,0,4,0,0,0,0,0,0,0,6,0,6,0,5,0,0,0,0,8,0,0,0,10,7,0,0,0,0,10,0,0,0,
+0,0,13,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,19,7,0,4,12,0,8,0,0,0,0,6,0,0,0,0,
+0,0,0,6,0,0,0,0,0,0,0,0,0,4,0,0,0,0,18,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,0,0,0,
+0,14,0,0,4,0,0,0,6,0,0,0,6,0,0,0,7,0,0,0,0,0,0,10,4,0,0,9,7,0,0,11,0,0,0,0,0,0,
+7,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,4,0,0,12,0,0,0,
+0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,22,5,9,7,0,0,0,0,0,0,0,0,0,
+0,0,6,0,0,9,6,0,5,0,0,0,0,0,0,10,5,0,0,8,6,0,6,10,5,0,0,0,6,0,0,0,6,0,0,20,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,6,0,0,0,0,17,4,0,7,0,6,
+0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,14,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,
+0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,
+0,0,7,0,0,8,6,12,0,0,7,18,7,0,0,8,4,0,0,0,0,9,6,0,0,0,0,0,0,0,0,13,0,0,6,0,0,0,
+0,0,0,0,0,0,0,10,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,7,0,0,
+0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,8,5,0,0,0,0,0,0,0,0,12,0,0,0,8,0,0,0,0,0,0,
+4,0,0,10,0,16,0,0,0,0,0,0,0,12,7,10,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,16,6,10,0,0,5,0,0,0,0,0,6,0,0,0,0,
+0,7,0,0,0,7,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,5,8,7,0,7,0,0,0,0,0,0,0,0,8,0,0,6,0,0,0,6,0,0,0,4,0,0,0,0,
+8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,7,0,0,8,0,0,0,
+9,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,7,13,5,0,5,0,0,0,7,8,4,0,0,0,0,0,0,0,
+0,12,0,0,0,0,0,0,0,0,0,0,0,8,6,0,6,0,0,11,0,0,0,0,0,0,0,0,6,0,0,0,0,0,4,0,0,0,0,
+0,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,10,7,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,11,6,0,0,10,6,0,0,
+0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,
+0,0,0,6,0,0,0,7,0,0,9,0,8,7,11,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,9,6,10,5,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,0,0,0,0,0,10,7,0,0,0,0,0,0,11,0,9,6,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,5,0,6,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,15,5,12,5,
+0,0,0,0,0,0,12,7,0,0,0,0,0,0,8,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,12,6,0,
+0,0,0,24,4,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,7,0,0,0,0,0,0,0,0,0,0,
+0,0,0,4,10,4,0,0,0,0,10,7,0,0,0,0,0,0,0,0,0,0,0,0,9,0,11,0,0,0,0,0,0,0,0,0,0,6,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,
+0,0,8,0,0,0,0,7,0,0,0,0,0,0,10,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,10,7,0,0,0,0,0,
+0,0,0,0,0,14,7,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,4,0,0,0,6,0,0,0,0,0,6,0,0,0,6,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,11,6,0,0,0,0,0,0,0,4,0,0,0,4,0,0,0,0,0,7,20,7,11,4,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,19,7,9,6,0,0,12,7,0,0,0,0,0,0,10,0,12,0,
+0,0,0,0,0,4,9,6,13,0,0,0,0,0,0,0,0,6,0,0,0,6,0,0,0,5,0,0,0,0,0,0,8,0,0,0,0,0,0,
+0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,6,0,0,11,0,9,0,0,0,0,4,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,8,5,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,19,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,
+0,4,0,5,0,0,0,0,0,0,0,0,0,4,0,0,0,0,9,7,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,
+0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,6,
+0,0,0,0,8,7,0,0,0,0,0,0,12,0,0,6,0,0,0,0,0,0,0,6,8,4,0,0,10,7,0,0,10,0,0,0,0,0,
+0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,7,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,4,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,9,7,0,0,0,0,0,0,0,5,
+0,4,0,0,0,0,0,6,0,0,0,0,0,0,8,0,0,6,0,0,0,6,0,0,0,0,0,7,0,5,8,4,0,0,9,0,0,0,0,4,
+0,0,0,0,0,0,0,0,0,5,0,0,15,6,8,6,0,0,0,6,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,6,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,9,6,0,0,0,0,0,0,0,7,0,0,0,4,0,
+6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,9,5,0,6,12,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,6,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,8,7,0,6,0,0,0,0,0,0,0,0,0,0,0,0,11,0,12,7,0,0,0,0,
+0,0,0,0,0,5,0,5,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,11,4,0,0,0,0,0,0,0,0,0,0,10,
+7,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,7,8,7,9,6,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,5,12,0,
+10,5,12,6,0,0,0,7,0,0,0,0,0,0,0,5,0,0,0,5,9,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,
+11,7,0,0,0,0,0,0,0,0,0,0,17,0,0,0,0,0,0,6,0,7,0,0,0,0,8,0,8,5,0,6,0,0,0,6,0,0,0,
+0,0,0,0,6,0,6,0,6,9,0,0,5,17,0,0,0,0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,0,0,0,0,7,0,0,
+0,0,0,7,0,0,0,0,16,5,0,0,0,0,0,0,0,4,0,0,0,5,11,5,0,7,0,0,0,4,8,7,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,7,0,0,0,0,12,0,0,0,
+0,0,12,0,0,0,0,0,0,0,0,4,10,4,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,6,0,0,0,0,0,0,0,4,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,20,5,0,0,
+10,0,0,0,0,0,0,0,0,0,0,6,0,0,0,6,12,0,0,0,0,0,0,6,0,0,0,0,0,0,9,4,10,7,0,4,0,0,
+0,0,0,0,10,6,0,0,0,0,8,4,0,7,8,6,0,6,8,0,10,0,0,0,0,0,13,5,0,6,0,0,0,0,0,0,22,4,
+0,0,0,0,0,0,0,0,0,0,9,0,0,0,0,6,0,0,0,6,0,0,0,0,0,0,0,6,0,0,0,0,0,0,0,0,0,6,10,
+5,8,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,10,4,0,0,10,7,0,0,0,0,0,5,0,
+5,8,0,0,0,0,6,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,10,7,0,0,0,4,0,0,0,0,0,6,0,0,
+0,0,0,0,0,0,8,7,0,0,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,7,0,0,0,6,0,0,0,0,0,0,0,0,0,
+4,0,0,0,4,10,0,0,6,13,7,8,0,0,0,0,0,0,7,0,0,12,7,0,0,0,0,0,0,10,5,0,0,0,0,0,6,0,
+0,0,0,0,0,0,0,0,0,13,7,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,6,0,0,0,0,0,0,0,0,8,6,0,6,
+0,0,0,0,0,0,0,0,12,0,8,4,0,0,0,0,0,4,0,4,0,0,0,0,0,0,0,5,0,0,0,0,12,5,0,0,0,7,0,
+0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,10,0,0,0,20,0,0,5,0,0,10,
+7,11,7,0,0,0,0,0,0,0,0,0,0,17,0,9,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,10,7,0,4,0,6,0,0,24,0,0,5,0,0,0,0,8,0,0,
+0,0,0,0,0,10,5,0,4,0,6,0,0,8,0,0,0,0,0,0,4,0,6,0,0,0,0,0,0,9,5,0,0,0,0,0,0,0,0,
+0,0,0,6,0,0,0,0,9,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,4,0,7,
+0,0,13,0,0,0,0,0,0,0,11,6,0,0,0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,4,0,0,0,0,
+17,7,0,0,11,6,0,0,0,0,12,6,0,0,0,6,0,6,0,0,0,0,0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,4,0,0,0,0,0,0,0,0,0,5,0,0,0,6,0,0,0,0,0,0,0,0,0,0,10,0,0,4,8,6,0,0,0,
+0,0,0,9,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,0,0,0,9,5,0,7,18,0,0,0,0,0,0,0,0,0,0,0,0,0,8,6,0,0,0,0,0,0,0,0,8,0,0,0,
+0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,6,0,0,0,0,0,0,
+0,0,0,0,0,0,10,0,0,0,0,0,0,0,0,4,0,6,0,0,9,0,0,0,0,0,0,0,0,0,13,0,0,0,0,0,0,0,0,
+0,0,0,8,7,10,0,8,5,0,0,0,0,0,0,0,0,9,0,0,0,10,0,0,0,0,6,0,7,0,4,0,0,0,0,0,0,0,0,
+8,0,0,0,0,0,8,4,0,0,0,0,0,5,0,0,10,0,12,6,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+4,0,0,0,0,0,0,12,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,18,6,11,0,0,
+7,0,0,0,0,0,6,10,5,0,0,0,0,0,0,0,0,0,5,0,0,9,5,12,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,
+0,6,0,0,0,0,13,6,0,4,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,
+0,0,0,8,4,0,6,12,0,0,0,0,0,0,0,0,0,0,0,0,6,0,6,0,0,0,0,0,5,0,0,0,0,0,0,0,0,0,0,
+0,0,0,0,11,4,0,0,0,6,14,0,11,0,9,6,0,0,0,0,0,0,22,0,12,0,8,6,0,0,0,0,0,0,0,6,0,
+0,0,0,0,6,0,0,0,0,0,0,0,0,0,0,11,0,0,0,0,0,0,0,0,0,0,0,0,0,0,7,0,0,0,0,0,0,0,0,
+10,7,0,0,0,0,0,0,0,0,9,0,0,0,0,4,0,0,0,0,0,0,0,0,0,5,11,0,0,0,0,0,0,0,8,6,0,0,9,
+7,0,0,12,4,0,0,0,0,0,0,12,6,0,6,0,7,0,0,8,5,0,0,0,0};
#if defined(__cplusplus) || defined(c_plusplus)
} /* extern "C" */
diff --git a/c/enc/dictionary_hash.h b/c/enc/dictionary_hash.h
index b3bb959..e553ea5 100644
--- a/c/enc/dictionary_hash.h
+++ b/c/enc/dictionary_hash.h
@@ -15,7 +15,8 @@
extern "C" {
#endif
-extern const uint16_t kStaticDictionaryHash[32768];
+extern const uint16_t kStaticDictionaryHashWords[32768];
+extern const uint8_t kStaticDictionaryHashLengths[32768];
#if defined(__cplusplus) || defined(c_plusplus)
} /* extern "C" */
diff --git a/c/enc/encode.c b/c/enc/encode.c
index 141e70a..8d90937 100644
--- a/c/enc/encode.c
+++ b/c/enc/encode.c
@@ -54,12 +54,19 @@ typedef enum BrotliEncoderStreamState {
BROTLI_STREAM_METADATA_BODY = 4
} BrotliEncoderStreamState;
+typedef enum BrotliEncoderFlintState {
+ BROTLI_FLINT_NEEDS_2_BYTES = 2,
+ BROTLI_FLINT_NEEDS_1_BYTE = 1,
+ BROTLI_FLINT_WAITING_FOR_PROCESSING = 0,
+ BROTLI_FLINT_WAITING_FOR_FLUSHING = -1,
+ BROTLI_FLINT_DONE = -2
+} BrotliEncoderFlintState;
+
typedef struct BrotliEncoderStateStruct {
BrotliEncoderParams params;
MemoryManager memory_manager_;
- HasherHandle hasher_;
uint64_t input_pos_;
RingBuffer ringbuffer_;
size_t cmd_alloc_size_;
@@ -73,10 +80,17 @@ typedef struct BrotliEncoderStateStruct {
int saved_dist_cache_[4];
uint16_t last_bytes_;
uint8_t last_bytes_bits_;
+ /* "Flint" is a tiny uncompressed block emitted before the continuation
+ block to unwire literal context from previous data. Despite being int8_t,
+ field is actually BrotliEncoderFlintState enum. */
+ int8_t flint_;
uint8_t prev_byte_;
uint8_t prev_byte2_;
size_t storage_size_;
uint8_t* storage_;
+
+ Hasher hasher_;
+
/* Hash table for FAST_ONE_PASS_COMPRESSION_QUALITY mode. */
int small_table_[1 << 10]; /* 4KiB */
int* large_table_; /* Allocated only when needed */
@@ -114,8 +128,6 @@ typedef struct BrotliEncoderStateStruct {
BROTLI_BOOL is_initialized_;
} BrotliEncoderStateStruct;
-static BROTLI_BOOL EnsureInitialized(BrotliEncoderState* s);
-
static size_t InputBlockSize(BrotliEncoderState* s) {
return (size_t)1 << s->params.lgblock;
}
@@ -174,6 +186,11 @@ BROTLI_BOOL BrotliEncoderSetParameter(
state->params.dist.num_direct_distance_codes = value;
return BROTLI_TRUE;
+ case BROTLI_PARAM_STREAM_OFFSET:
+ if (value > (1u << 30)) return BROTLI_FALSE;
+ state->params.stream_offset = value;
+ return BROTLI_TRUE;
+
default: return BROTLI_FALSE;
}
}
@@ -195,7 +212,7 @@ static uint8_t* GetBrotliStorage(BrotliEncoderState* s, size_t size) {
if (s->storage_size_ < size) {
BROTLI_FREE(m, s->storage_);
s->storage_ = BROTLI_ALLOC(m, uint8_t, size);
- if (BROTLI_IS_OOM(m)) return NULL;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(s->storage_)) return NULL;
s->storage_size_ = size;
}
return s->storage_;
@@ -234,7 +251,7 @@ static int* GetHashTable(BrotliEncoderState* s, int quality,
s->large_table_size_ = htsize;
BROTLI_FREE(m, s->large_table_);
s->large_table_ = BROTLI_ALLOC(m, int, htsize);
- if (BROTLI_IS_OOM(m)) return 0;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(s->large_table_)) return 0;
}
table = s->large_table_;
}
@@ -499,7 +516,7 @@ static BROTLI_BOOL ShouldCompress(
/* TODO: find more precise minimal block overhead. */
if (bytes <= 2) return BROTLI_FALSE;
if (num_commands < (bytes >> 8) + 2) {
- if (num_literals > 0.99 * (double)bytes) {
+ if ((double)num_literals > 0.99 * (double)bytes) {
uint32_t literal_histo[256] = { 0 };
static const uint32_t kSampleRate = 13;
static const double kMinEntropy = 7.92;
@@ -617,11 +634,7 @@ static void WriteMetaBlockInternal(MemoryManager* m,
/* The number of distance symbols effectively used for distance
histograms. It might be less than distance alphabet size
for "Large Window Brotli" (32-bit). */
- uint32_t num_effective_dist_codes = block_params.dist.alphabet_size;
- if (num_effective_dist_codes > BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS) {
- num_effective_dist_codes = BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS;
- }
- BrotliOptimizeHistograms(num_effective_dist_codes, &mb);
+ BrotliOptimizeHistograms(block_params.dist.alphabet_size_limit, &mb);
}
BrotliStoreMetaBlock(m, data, wrapped_last_flush_pos, bytes, mask,
prev_byte, prev_byte2,
@@ -678,12 +691,23 @@ static BROTLI_BOOL EnsureInitialized(BrotliEncoderState* s) {
s->last_bytes_bits_ = 0;
s->last_bytes_ = 0;
+ s->flint_ = BROTLI_FLINT_DONE;
s->remaining_metadata_bytes_ = BROTLI_UINT32_MAX;
SanitizeParams(&s->params);
s->params.lgblock = ComputeLgBlock(&s->params);
ChooseDistanceParams(&s->params);
+ if (s->params.stream_offset != 0) {
+ s->flint_ = BROTLI_FLINT_NEEDS_2_BYTES;
+ /* Poison the distance cache. -16 +- 3 is still less than zero (invalid). */
+ s->dist_cache_[0] = -16;
+ s->dist_cache_[1] = -16;
+ s->dist_cache_[2] = -16;
+ s->dist_cache_[3] = -16;
+ memcpy(s->saved_dist_cache_, s->dist_cache_, sizeof(s->saved_dist_cache_));
+ }
+
RingBufferSetup(&s->params, &s->ringbuffer_);
/* Initialize last byte with stream header. */
@@ -693,8 +717,14 @@ static BROTLI_BOOL EnsureInitialized(BrotliEncoderState* s) {
s->params.quality == FAST_TWO_PASS_COMPRESSION_QUALITY) {
lgwin = BROTLI_MAX(int, lgwin, 18);
}
- EncodeWindowBits(lgwin, s->params.large_window,
- &s->last_bytes_, &s->last_bytes_bits_);
+ if (s->params.stream_offset == 0) {
+ EncodeWindowBits(lgwin, s->params.large_window,
+ &s->last_bytes_, &s->last_bytes_bits_);
+ } else {
+ /* Bigger values have the same effect, but could cause overflows. */
+ s->params.stream_offset = BROTLI_MIN(size_t,
+ s->params.stream_offset, BROTLI_MAX_BACKWARD_LIMIT(lgwin));
+ }
}
if (s->params.quality == FAST_ONE_PASS_COMPRESSION_QUALITY) {
@@ -712,13 +742,15 @@ static void BrotliEncoderInitParams(BrotliEncoderParams* params) {
params->quality = BROTLI_DEFAULT_QUALITY;
params->lgwin = BROTLI_DEFAULT_WINDOW;
params->lgblock = 0;
+ params->stream_offset = 0;
params->size_hint = 0;
params->disable_literal_context_modeling = BROTLI_FALSE;
BrotliInitEncoderDictionary(&params->dictionary);
params->dist.distance_postfix_bits = 0;
params->dist.num_direct_distance_codes = 0;
- params->dist.alphabet_size =
+ params->dist.alphabet_size_max =
BROTLI_DISTANCE_ALPHABET_SIZE(0, 0, BROTLI_MAX_DISTANCE_BITS);
+ params->dist.alphabet_size_limit = params->dist.alphabet_size_max;
params->dist.max_distance = BROTLI_MAX_DISTANCE;
}
@@ -734,7 +766,7 @@ static void BrotliEncoderInitState(BrotliEncoderState* s) {
s->prev_byte2_ = 0;
s->storage_size_ = 0;
s->storage_ = 0;
- s->hasher_ = NULL;
+ HasherInit(&s->hasher_);
s->large_table_ = NULL;
s->large_table_size_ = 0;
s->cmd_code_numbits_ = 0;
@@ -902,6 +934,7 @@ static void ExtendLastCommand(BrotliEncoderState* s, uint32_t* bytes,
(*bytes)--;
(*wrapped_last_processed_pos)++;
}
+ } else {
}
/* The copy length is at most the metablock size, and thus expressible. */
GetLengthCode(last_command->insert_len_,
@@ -934,6 +967,7 @@ static BROTLI_BOOL EncodeData(
uint32_t mask;
MemoryManager* m = &s->memory_manager_;
ContextType literal_context_mode;
+ ContextLut literal_context_lut;
data = s->ringbuffer_.buffer_;
mask = s->ringbuffer_.mask_;
@@ -951,7 +985,10 @@ static BROTLI_BOOL EncodeData(
BROTLI_ALLOC(m, uint32_t, kCompressFragmentTwoPassBlockSize);
s->literal_buf_ =
BROTLI_ALLOC(m, uint8_t, kCompressFragmentTwoPassBlockSize);
- if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(s->command_buf_) ||
+ BROTLI_IS_NULL(s->literal_buf_)) {
+ return BROTLI_FALSE;
+ }
}
if (s->params.quality == FAST_ONE_PASS_COMPRESSION_QUALITY ||
@@ -1009,7 +1046,7 @@ static BROTLI_BOOL EncodeData(
newsize += (bytes / 4) + 16;
s->cmd_alloc_size_ = newsize;
new_commands = BROTLI_ALLOC(m, Command, newsize);
- if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(new_commands)) return BROTLI_FALSE;
if (s->commands_) {
memcpy(new_commands, s->commands_, sizeof(Command) * s->num_commands_);
BROTLI_FREE(m, s->commands_);
@@ -1024,6 +1061,7 @@ static BROTLI_BOOL EncodeData(
literal_context_mode = ChooseContextMode(
&s->params, data, WrapPosition(s->last_flush_pos_),
mask, (size_t)(s->input_pos_ - s->last_flush_pos_));
+ literal_context_lut = BROTLI_CONTEXT_LUT(literal_context_mode);
if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
@@ -1034,20 +1072,23 @@ static BROTLI_BOOL EncodeData(
if (s->params.quality == ZOPFLIFICATION_QUALITY) {
BROTLI_DCHECK(s->params.hasher.type == 10);
BrotliCreateZopfliBackwardReferences(m, bytes, wrapped_last_processed_pos,
- data, mask, &s->params, s->hasher_, s->dist_cache_,
+ data, mask, literal_context_lut, &s->params,
+ &s->hasher_, s->dist_cache_,
&s->last_insert_len_, &s->commands_[s->num_commands_],
&s->num_commands_, &s->num_literals_);
if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
} else if (s->params.quality == HQ_ZOPFLIFICATION_QUALITY) {
BROTLI_DCHECK(s->params.hasher.type == 10);
BrotliCreateHqZopfliBackwardReferences(m, bytes, wrapped_last_processed_pos,
- data, mask, &s->params, s->hasher_, s->dist_cache_,
+ data, mask, literal_context_lut, &s->params,
+ &s->hasher_, s->dist_cache_,
&s->last_insert_len_, &s->commands_[s->num_commands_],
&s->num_commands_, &s->num_literals_);
if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
} else {
BrotliCreateBackwardReferences(bytes, wrapped_last_processed_pos,
- data, mask, &s->params, s->hasher_, s->dist_cache_,
+ data, mask, literal_context_lut, &s->params,
+ &s->hasher_, s->dist_cache_,
&s->last_insert_len_, &s->commands_[s->num_commands_],
&s->num_commands_, &s->num_literals_);
}
@@ -1072,7 +1113,7 @@ static BROTLI_BOOL EncodeData(
s->num_commands_ < max_commands) {
/* Merge with next input block. Everything will happen later. */
if (UpdateLastProcessedPos(s)) {
- HasherReset(s->hasher_);
+ HasherReset(&s->hasher_);
}
*out_size = 0;
return BROTLI_TRUE;
@@ -1113,7 +1154,7 @@ static BROTLI_BOOL EncodeData(
s->last_bytes_bits_ = storage_ix & 7u;
s->last_flush_pos_ = s->input_pos_;
if (UpdateLastProcessedPos(s)) {
- HasherReset(s->hasher_);
+ HasherReset(&s->hasher_);
}
if (s->last_flush_pos_ > 0) {
s->prev_byte_ = data[((uint32_t)s->last_flush_pos_ - 1) & mask];
@@ -1174,7 +1215,6 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
size_t total_out_size = 0;
uint16_t last_bytes;
uint8_t last_bytes_bits;
- HasherHandle hasher = NULL;
const size_t hasher_eff_size = BROTLI_MIN(size_t,
input_size, BROTLI_MAX_BACKWARD_LIMIT(lgwin) + BROTLI_WINDOW_GAP);
@@ -1190,6 +1230,9 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
uint8_t prev_byte = 0;
uint8_t prev_byte2 = 0;
+ Hasher hasher;
+ HasherInit(&hasher);
+
BrotliEncoderInitParams(&params);
params.quality = 10;
params.lgwin = lgwin;
@@ -1226,6 +1269,7 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
ContextType literal_context_mode = ChooseContextMode(&params,
input_buffer, metablock_start, mask, metablock_end - metablock_start);
+ ContextLut literal_context_lut = BROTLI_CONTEXT_LUT(literal_context_mode);
size_t block_start;
for (block_start = metablock_start; block_start < metablock_end; ) {
@@ -1234,12 +1278,12 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
ZopfliNode* nodes = BROTLI_ALLOC(m, ZopfliNode, block_size + 1);
size_t path_size;
size_t new_cmd_alloc_size;
- if (BROTLI_IS_OOM(m)) goto oom;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(nodes)) goto oom;
BrotliInitZopfliNodes(nodes, block_size + 1);
- StitchToPreviousBlockH10(hasher, block_size, block_start,
+ StitchToPreviousBlockH10(&hasher.privat._H10, block_size, block_start,
input_buffer, mask);
path_size = BrotliZopfliComputeShortestPath(m, block_size, block_start,
- input_buffer, mask, &params, dist_cache, hasher,
+ input_buffer, mask, literal_context_lut, &params, dist_cache, &hasher,
nodes);
if (BROTLI_IS_OOM(m)) goto oom;
/* We allocate a command buffer in the first iteration of this loop that
@@ -1254,7 +1298,7 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
num_commands + path_size + 1);
if (cmd_alloc_size != new_cmd_alloc_size) {
Command* new_commands = BROTLI_ALLOC(m, Command, new_cmd_alloc_size);
- if (BROTLI_IS_OOM(m)) goto oom;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(new_commands)) goto oom;
cmd_alloc_size = new_cmd_alloc_size;
if (commands) {
memcpy(new_commands, commands, sizeof(Command) * num_commands);
@@ -1286,7 +1330,7 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
if (metablock_size == 0) {
/* Write the ISLAST and ISEMPTY bits. */
storage = BROTLI_ALLOC(m, uint8_t, 16);
- if (BROTLI_IS_OOM(m)) goto oom;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(storage)) goto oom;
storage[0] = (uint8_t)last_bytes;
storage[1] = (uint8_t)(last_bytes >> 8);
BrotliWriteBits(2, 3, &storage_ix, storage);
@@ -1297,7 +1341,7 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
CreateBackwardReferences is now unused. */
memcpy(dist_cache, saved_dist_cache, 4 * sizeof(dist_cache[0]));
storage = BROTLI_ALLOC(m, uint8_t, metablock_size + 16);
- if (BROTLI_IS_OOM(m)) goto oom;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(storage)) goto oom;
storage[0] = (uint8_t)last_bytes;
storage[1] = (uint8_t)(last_bytes >> 8);
BrotliStoreUncompressedMetaBlock(is_last, input_buffer,
@@ -1318,14 +1362,10 @@ static BROTLI_BOOL BrotliCompressBufferQuality10(
/* The number of distance symbols effectively used for distance
histograms. It might be less than distance alphabet size
for "Large Window Brotli" (32-bit). */
- uint32_t num_effective_dist_codes = block_params.dist.alphabet_size;
- if (num_effective_dist_codes > BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS) {
- num_effective_dist_codes = BROTLI_NUM_HISTOGRAM_DISTANCE_SYMBOLS;
- }
- BrotliOptimizeHistograms(num_effective_dist_codes, &mb);
+ BrotliOptimizeHistograms(block_params.dist.alphabet_size_limit, &mb);
}
storage = BROTLI_ALLOC(m, uint8_t, 2 * metablock_size + 503);
- if (BROTLI_IS_OOM(m)) goto oom;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(storage)) goto oom;
storage[0] = (uint8_t)last_bytes;
storage[1] = (uint8_t)(last_bytes >> 8);
BrotliStoreMetaBlock(m, input_buffer, metablock_start, metablock_size,
@@ -1576,7 +1616,10 @@ static BROTLI_BOOL BrotliEncoderCompressStreamFast(
BROTLI_ALLOC(m, uint32_t, kCompressFragmentTwoPassBlockSize);
s->literal_buf_ =
BROTLI_ALLOC(m, uint8_t, kCompressFragmentTwoPassBlockSize);
- if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(s->command_buf_) ||
+ BROTLI_IS_NULL(s->literal_buf_)) {
+ return BROTLI_FALSE;
+ }
}
if (s->command_buf_) {
command_buf = s->command_buf_;
@@ -1584,7 +1627,10 @@ static BROTLI_BOOL BrotliEncoderCompressStreamFast(
} else {
tmp_command_buf = BROTLI_ALLOC(m, uint32_t, buf_size);
tmp_literal_buf = BROTLI_ALLOC(m, uint8_t, buf_size);
- if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(tmp_command_buf) ||
+ BROTLI_IS_NULL(tmp_literal_buf)) {
+ return BROTLI_FALSE;
+ }
command_buf = tmp_command_buf;
literal_buf = tmp_literal_buf;
}
@@ -1640,8 +1686,10 @@ static BROTLI_BOOL BrotliEncoderCompressStreamFast(
&storage_ix, storage);
if (BROTLI_IS_OOM(m)) return BROTLI_FALSE;
}
- *next_in += block_size;
- *available_in -= block_size;
+ if (block_size != 0) {
+ *next_in += block_size;
+ *available_in -= block_size;
+ }
if (inplace) {
size_t out_bytes = storage_ix >> 3;
BROTLI_DCHECK(out_bytes <= *available_out);
@@ -1786,6 +1834,10 @@ BROTLI_BOOL BrotliEncoderCompressStream(
}
while (BROTLI_TRUE) {
size_t remaining_block_size = RemainingInputBlockSize(s);
+ /* Shorten input to flint size. */
+ if (s->flint_ >= 0 && remaining_block_size > (size_t)s->flint_) {
+ remaining_block_size = (size_t)s->flint_;
+ }
if (remaining_block_size != 0 && *available_in != 0) {
size_t copy_input_size =
@@ -1793,10 +1845,18 @@ BROTLI_BOOL BrotliEncoderCompressStream(
CopyInputToRingBuffer(s, copy_input_size, *next_in);
*next_in += copy_input_size;
*available_in -= copy_input_size;
+ if (s->flint_ > 0) s->flint_ = (int8_t)(s->flint_ - (int)copy_input_size);
continue;
}
if (InjectFlushOrPushOutput(s, available_out, next_out, total_out)) {
+ /* Exit the "emit flint" workflow. */
+ if (s->flint_ == BROTLI_FLINT_WAITING_FOR_FLUSHING) {
+ CheckFlushComplete(s);
+ if (s->stream_state_ == BROTLI_STREAM_PROCESSING) {
+ s->flint_ = BROTLI_FLINT_DONE;
+ }
+ }
continue;
}
@@ -1810,6 +1870,11 @@ BROTLI_BOOL BrotliEncoderCompressStream(
BROTLI_BOOL force_flush = TO_BROTLI_BOOL(
(*available_in == 0) && op == BROTLI_OPERATION_FLUSH);
BROTLI_BOOL result;
+ /* Force emitting (uncompressed) piece containing flint. */
+ if (!is_last && s->flint_ == 0) {
+ s->flint_ = BROTLI_FLINT_WAITING_FOR_FLUSHING;
+ force_flush = BROTLI_TRUE;
+ }
UpdateSizeHint(s, *available_in);
result = EncodeData(s, is_last, force_flush,
&s->available_out_, &s->next_out_);
diff --git a/c/enc/encoder_dict.c b/c/enc/encoder_dict.c
index 8b2f6ad..c9e963b 100755..100644
--- a/c/enc/encoder_dict.c
+++ b/c/enc/encoder_dict.c
@@ -17,14 +17,15 @@ extern "C" {
void BrotliInitEncoderDictionary(BrotliEncoderDictionary* dict) {
dict->words = BrotliGetDictionary();
+ dict->num_transforms = (uint32_t)BrotliGetTransforms()->num_transforms;
- dict->hash_table = kStaticDictionaryHash;
+ dict->hash_table_words = kStaticDictionaryHashWords;
+ dict->hash_table_lengths = kStaticDictionaryHashLengths;
dict->buckets = kStaticDictionaryBuckets;
dict->dict_words = kStaticDictionaryWords;
dict->cutoffTransformsCount = kCutoffTransformsCount;
dict->cutoffTransforms = kCutoffTransforms;
-
}
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/c/enc/encoder_dict.h b/c/enc/encoder_dict.h
index 3cb6b0a..a1c329f 100755..100644
--- a/c/enc/encoder_dict.h
+++ b/c/enc/encoder_dict.h
@@ -19,13 +19,15 @@ extern "C" {
/* Dictionary data (words and transforms) for 1 possible context */
typedef struct BrotliEncoderDictionary {
const BrotliDictionary* words;
+ uint32_t num_transforms;
/* cut off for fast encoder */
uint32_t cutoffTransformsCount;
uint64_t cutoffTransforms;
/* from dictionary_hash.h, for fast encoder */
- const uint16_t* hash_table;
+ const uint16_t* hash_table_words;
+ const uint8_t* hash_table_lengths;
/* from static_dict_lut.h, for slow encoder */
const uint16_t* buckets;
diff --git a/c/enc/entropy_encode.c b/c/enc/entropy_encode.c
index 97f9dfb..b50ccb5 100644
--- a/c/enc/entropy_encode.c
+++ b/c/enc/entropy_encode.c
@@ -18,6 +18,8 @@
extern "C" {
#endif
+const size_t kBrotliShellGaps[] = {132, 57, 23, 10, 4, 1};
+
BROTLI_BOOL BrotliSetDepth(
int p0, HuffmanTree* pool, uint8_t* depth, int max_depth) {
int stack[16];
diff --git a/c/enc/entropy_encode.h b/c/enc/entropy_encode.h
index f23d9c3..9618e1d 100644
--- a/c/enc/entropy_encode.h
+++ b/c/enc/entropy_encode.h
@@ -76,12 +76,12 @@ BROTLI_INTERNAL void BrotliConvertBitDepthsToSymbols(const uint8_t* depth,
size_t len,
uint16_t* bits);
+BROTLI_INTERNAL extern const size_t kBrotliShellGaps[6];
/* Input size optimized Shell sort. */
typedef BROTLI_BOOL (*HuffmanTreeComparator)(
const HuffmanTree*, const HuffmanTree*);
static BROTLI_INLINE void SortHuffmanTreeItems(HuffmanTree* items,
const size_t n, HuffmanTreeComparator comparator) {
- static const size_t gaps[] = {132, 57, 23, 10, 4, 1};
if (n < 13) {
/* Insertion sort. */
size_t i;
@@ -101,7 +101,7 @@ static BROTLI_INLINE void SortHuffmanTreeItems(HuffmanTree* items,
/* Shell sort. */
int g = n < 57 ? 2 : 0;
for (; g < 6; ++g) {
- size_t gap = gaps[g];
+ size_t gap = kBrotliShellGaps[g];
size_t i;
for (i = gap; i < n; ++i) {
size_t j = i;
diff --git a/c/enc/fast_log.c b/c/enc/fast_log.c
new file mode 100644
index 0000000..2319bae
--- /dev/null
+++ b/c/enc/fast_log.c
@@ -0,0 +1,105 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include "./fast_log.h"
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+/* ", ".join(["%.16ff" % x for x in [0.0]+[log2(x) for x in range(1, 256)]]) */
+const double kBrotliLog2Table[BROTLI_LOG2_TABLE_SIZE] = {
+ 0.0000000000000000f, 0.0000000000000000f, 1.0000000000000000f,
+ 1.5849625007211563f, 2.0000000000000000f, 2.3219280948873622f,
+ 2.5849625007211561f, 2.8073549220576042f, 3.0000000000000000f,
+ 3.1699250014423126f, 3.3219280948873626f, 3.4594316186372978f,
+ 3.5849625007211565f, 3.7004397181410922f, 3.8073549220576037f,
+ 3.9068905956085187f, 4.0000000000000000f, 4.0874628412503400f,
+ 4.1699250014423122f, 4.2479275134435852f, 4.3219280948873626f,
+ 4.3923174227787607f, 4.4594316186372973f, 4.5235619560570131f,
+ 4.5849625007211570f, 4.6438561897747244f, 4.7004397181410926f,
+ 4.7548875021634691f, 4.8073549220576037f, 4.8579809951275728f,
+ 4.9068905956085187f, 4.9541963103868758f, 5.0000000000000000f,
+ 5.0443941193584534f, 5.0874628412503400f, 5.1292830169449664f,
+ 5.1699250014423122f, 5.2094533656289501f, 5.2479275134435852f,
+ 5.2854022188622487f, 5.3219280948873626f, 5.3575520046180838f,
+ 5.3923174227787607f, 5.4262647547020979f, 5.4594316186372973f,
+ 5.4918530963296748f, 5.5235619560570131f, 5.5545888516776376f,
+ 5.5849625007211570f, 5.6147098441152083f, 5.6438561897747244f,
+ 5.6724253419714961f, 5.7004397181410926f, 5.7279204545631996f,
+ 5.7548875021634691f, 5.7813597135246599f, 5.8073549220576046f,
+ 5.8328900141647422f, 5.8579809951275719f, 5.8826430493618416f,
+ 5.9068905956085187f, 5.9307373375628867f, 5.9541963103868758f,
+ 5.9772799234999168f, 6.0000000000000000f, 6.0223678130284544f,
+ 6.0443941193584534f, 6.0660891904577721f, 6.0874628412503400f,
+ 6.1085244567781700f, 6.1292830169449672f, 6.1497471195046822f,
+ 6.1699250014423122f, 6.1898245588800176f, 6.2094533656289510f,
+ 6.2288186904958804f, 6.2479275134435861f, 6.2667865406949019f,
+ 6.2854022188622487f, 6.3037807481771031f, 6.3219280948873617f,
+ 6.3398500028846252f, 6.3575520046180847f, 6.3750394313469254f,
+ 6.3923174227787598f, 6.4093909361377026f, 6.4262647547020979f,
+ 6.4429434958487288f, 6.4594316186372982f, 6.4757334309663976f,
+ 6.4918530963296748f, 6.5077946401986964f, 6.5235619560570131f,
+ 6.5391588111080319f, 6.5545888516776376f, 6.5698556083309478f,
+ 6.5849625007211561f, 6.5999128421871278f, 6.6147098441152092f,
+ 6.6293566200796095f, 6.6438561897747253f, 6.6582114827517955f,
+ 6.6724253419714952f, 6.6865005271832185f, 6.7004397181410917f,
+ 6.7142455176661224f, 6.7279204545631988f, 6.7414669864011465f,
+ 6.7548875021634691f, 6.7681843247769260f, 6.7813597135246599f,
+ 6.7944158663501062f, 6.8073549220576037f, 6.8201789624151887f,
+ 6.8328900141647422f, 6.8454900509443757f, 6.8579809951275719f,
+ 6.8703647195834048f, 6.8826430493618416f, 6.8948177633079437f,
+ 6.9068905956085187f, 6.9188632372745955f, 6.9307373375628867f,
+ 6.9425145053392399f, 6.9541963103868758f, 6.9657842846620879f,
+ 6.9772799234999168f, 6.9886846867721664f, 7.0000000000000000f,
+ 7.0112272554232540f, 7.0223678130284544f, 7.0334230015374501f,
+ 7.0443941193584534f, 7.0552824355011898f, 7.0660891904577721f,
+ 7.0768155970508317f, 7.0874628412503400f, 7.0980320829605272f,
+ 7.1085244567781700f, 7.1189410727235076f, 7.1292830169449664f,
+ 7.1395513523987937f, 7.1497471195046822f, 7.1598713367783891f,
+ 7.1699250014423130f, 7.1799090900149345f, 7.1898245588800176f,
+ 7.1996723448363644f, 7.2094533656289492f, 7.2191685204621621f,
+ 7.2288186904958804f, 7.2384047393250794f, 7.2479275134435861f,
+ 7.2573878426926521f, 7.2667865406949019f, 7.2761244052742384f,
+ 7.2854022188622487f, 7.2946207488916270f, 7.3037807481771031f,
+ 7.3128829552843557f, 7.3219280948873617f, 7.3309168781146177f,
+ 7.3398500028846243f, 7.3487281542310781f, 7.3575520046180847f,
+ 7.3663222142458151f, 7.3750394313469254f, 7.3837042924740528f,
+ 7.3923174227787607f, 7.4008794362821844f, 7.4093909361377026f,
+ 7.4178525148858991f, 7.4262647547020979f, 7.4346282276367255f,
+ 7.4429434958487288f, 7.4512111118323299f, 7.4594316186372973f,
+ 7.4676055500829976f, 7.4757334309663976f, 7.4838157772642564f,
+ 7.4918530963296748f, 7.4998458870832057f, 7.5077946401986964f,
+ 7.5156998382840436f, 7.5235619560570131f, 7.5313814605163119f,
+ 7.5391588111080319f, 7.5468944598876373f, 7.5545888516776376f,
+ 7.5622424242210728f, 7.5698556083309478f, 7.5774288280357487f,
+ 7.5849625007211561f, 7.5924570372680806f, 7.5999128421871278f,
+ 7.6073303137496113f, 7.6147098441152075f, 7.6220518194563764f,
+ 7.6293566200796095f, 7.6366246205436488f, 7.6438561897747244f,
+ 7.6510516911789290f, 7.6582114827517955f, 7.6653359171851765f,
+ 7.6724253419714952f, 7.6794800995054464f, 7.6865005271832185f,
+ 7.6934869574993252f, 7.7004397181410926f, 7.7073591320808825f,
+ 7.7142455176661224f, 7.7210991887071856f, 7.7279204545631996f,
+ 7.7347096202258392f, 7.7414669864011465f, 7.7481928495894596f,
+ 7.7548875021634691f, 7.7615512324444795f, 7.7681843247769260f,
+ 7.7747870596011737f, 7.7813597135246608f, 7.7879025593914317f,
+ 7.7944158663501062f, 7.8008998999203047f, 7.8073549220576037f,
+ 7.8137811912170374f, 7.8201789624151887f, 7.8265484872909159f,
+ 7.8328900141647422f, 7.8392037880969445f, 7.8454900509443757f,
+ 7.8517490414160571f, 7.8579809951275719f, 7.8641861446542798f,
+ 7.8703647195834048f, 7.8765169465650002f, 7.8826430493618425f,
+ 7.8887432488982601f, 7.8948177633079446f, 7.9008668079807496f,
+ 7.9068905956085187f, 7.9128893362299619f, 7.9188632372745955f,
+ 7.9248125036057813f, 7.9307373375628867f, 7.9366379390025719f,
+ 7.9425145053392399f, 7.9483672315846778f, 7.9541963103868758f,
+ 7.9600019320680806f, 7.9657842846620870f, 7.9715435539507720f,
+ 7.9772799234999168f, 7.9829935746943104f, 7.9886846867721664f,
+ 7.9943534368588578f
+};
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
diff --git a/c/enc/fast_log.h b/c/enc/fast_log.h
index cade123..2094f13 100644
--- a/c/enc/fast_log.h
+++ b/c/enc/fast_log.h
@@ -19,10 +19,8 @@ extern "C" {
#endif
static BROTLI_INLINE uint32_t Log2FloorNonZero(size_t n) {
- /* TODO: generalize and move to platform.h */
-#if BROTLI_GNUC_HAS_BUILTIN(__builtin_clz, 3, 4, 0) || \
- BROTLI_INTEL_VERSION_CHECK(16, 0, 0)
- return 31u ^ (uint32_t)__builtin_clz((uint32_t)n);
+#if defined(BROTLI_BSR32)
+ return BROTLI_BSR32((uint32_t)n);
#else
uint32_t result = 0;
while (n >>= 1) result++;
@@ -30,110 +28,31 @@ static BROTLI_INLINE uint32_t Log2FloorNonZero(size_t n) {
#endif
}
+#define BROTLI_LOG2_TABLE_SIZE 256
+
/* A lookup table for small values of log2(int) to be used in entropy
- computation.
+ computation. */
+BROTLI_INTERNAL extern const double kBrotliLog2Table[BROTLI_LOG2_TABLE_SIZE];
- ", ".join(["%.16ff" % x for x in [0.0]+[log2(x) for x in range(1, 256)]]) */
-static const float kLog2Table[] = {
- 0.0000000000000000f, 0.0000000000000000f, 1.0000000000000000f,
- 1.5849625007211563f, 2.0000000000000000f, 2.3219280948873622f,
- 2.5849625007211561f, 2.8073549220576042f, 3.0000000000000000f,
- 3.1699250014423126f, 3.3219280948873626f, 3.4594316186372978f,
- 3.5849625007211565f, 3.7004397181410922f, 3.8073549220576037f,
- 3.9068905956085187f, 4.0000000000000000f, 4.0874628412503400f,
- 4.1699250014423122f, 4.2479275134435852f, 4.3219280948873626f,
- 4.3923174227787607f, 4.4594316186372973f, 4.5235619560570131f,
- 4.5849625007211570f, 4.6438561897747244f, 4.7004397181410926f,
- 4.7548875021634691f, 4.8073549220576037f, 4.8579809951275728f,
- 4.9068905956085187f, 4.9541963103868758f, 5.0000000000000000f,
- 5.0443941193584534f, 5.0874628412503400f, 5.1292830169449664f,
- 5.1699250014423122f, 5.2094533656289501f, 5.2479275134435852f,
- 5.2854022188622487f, 5.3219280948873626f, 5.3575520046180838f,
- 5.3923174227787607f, 5.4262647547020979f, 5.4594316186372973f,
- 5.4918530963296748f, 5.5235619560570131f, 5.5545888516776376f,
- 5.5849625007211570f, 5.6147098441152083f, 5.6438561897747244f,
- 5.6724253419714961f, 5.7004397181410926f, 5.7279204545631996f,
- 5.7548875021634691f, 5.7813597135246599f, 5.8073549220576046f,
- 5.8328900141647422f, 5.8579809951275719f, 5.8826430493618416f,
- 5.9068905956085187f, 5.9307373375628867f, 5.9541963103868758f,
- 5.9772799234999168f, 6.0000000000000000f, 6.0223678130284544f,
- 6.0443941193584534f, 6.0660891904577721f, 6.0874628412503400f,
- 6.1085244567781700f, 6.1292830169449672f, 6.1497471195046822f,
- 6.1699250014423122f, 6.1898245588800176f, 6.2094533656289510f,
- 6.2288186904958804f, 6.2479275134435861f, 6.2667865406949019f,
- 6.2854022188622487f, 6.3037807481771031f, 6.3219280948873617f,
- 6.3398500028846252f, 6.3575520046180847f, 6.3750394313469254f,
- 6.3923174227787598f, 6.4093909361377026f, 6.4262647547020979f,
- 6.4429434958487288f, 6.4594316186372982f, 6.4757334309663976f,
- 6.4918530963296748f, 6.5077946401986964f, 6.5235619560570131f,
- 6.5391588111080319f, 6.5545888516776376f, 6.5698556083309478f,
- 6.5849625007211561f, 6.5999128421871278f, 6.6147098441152092f,
- 6.6293566200796095f, 6.6438561897747253f, 6.6582114827517955f,
- 6.6724253419714952f, 6.6865005271832185f, 6.7004397181410917f,
- 6.7142455176661224f, 6.7279204545631988f, 6.7414669864011465f,
- 6.7548875021634691f, 6.7681843247769260f, 6.7813597135246599f,
- 6.7944158663501062f, 6.8073549220576037f, 6.8201789624151887f,
- 6.8328900141647422f, 6.8454900509443757f, 6.8579809951275719f,
- 6.8703647195834048f, 6.8826430493618416f, 6.8948177633079437f,
- 6.9068905956085187f, 6.9188632372745955f, 6.9307373375628867f,
- 6.9425145053392399f, 6.9541963103868758f, 6.9657842846620879f,
- 6.9772799234999168f, 6.9886846867721664f, 7.0000000000000000f,
- 7.0112272554232540f, 7.0223678130284544f, 7.0334230015374501f,
- 7.0443941193584534f, 7.0552824355011898f, 7.0660891904577721f,
- 7.0768155970508317f, 7.0874628412503400f, 7.0980320829605272f,
- 7.1085244567781700f, 7.1189410727235076f, 7.1292830169449664f,
- 7.1395513523987937f, 7.1497471195046822f, 7.1598713367783891f,
- 7.1699250014423130f, 7.1799090900149345f, 7.1898245588800176f,
- 7.1996723448363644f, 7.2094533656289492f, 7.2191685204621621f,
- 7.2288186904958804f, 7.2384047393250794f, 7.2479275134435861f,
- 7.2573878426926521f, 7.2667865406949019f, 7.2761244052742384f,
- 7.2854022188622487f, 7.2946207488916270f, 7.3037807481771031f,
- 7.3128829552843557f, 7.3219280948873617f, 7.3309168781146177f,
- 7.3398500028846243f, 7.3487281542310781f, 7.3575520046180847f,
- 7.3663222142458151f, 7.3750394313469254f, 7.3837042924740528f,
- 7.3923174227787607f, 7.4008794362821844f, 7.4093909361377026f,
- 7.4178525148858991f, 7.4262647547020979f, 7.4346282276367255f,
- 7.4429434958487288f, 7.4512111118323299f, 7.4594316186372973f,
- 7.4676055500829976f, 7.4757334309663976f, 7.4838157772642564f,
- 7.4918530963296748f, 7.4998458870832057f, 7.5077946401986964f,
- 7.5156998382840436f, 7.5235619560570131f, 7.5313814605163119f,
- 7.5391588111080319f, 7.5468944598876373f, 7.5545888516776376f,
- 7.5622424242210728f, 7.5698556083309478f, 7.5774288280357487f,
- 7.5849625007211561f, 7.5924570372680806f, 7.5999128421871278f,
- 7.6073303137496113f, 7.6147098441152075f, 7.6220518194563764f,
- 7.6293566200796095f, 7.6366246205436488f, 7.6438561897747244f,
- 7.6510516911789290f, 7.6582114827517955f, 7.6653359171851765f,
- 7.6724253419714952f, 7.6794800995054464f, 7.6865005271832185f,
- 7.6934869574993252f, 7.7004397181410926f, 7.7073591320808825f,
- 7.7142455176661224f, 7.7210991887071856f, 7.7279204545631996f,
- 7.7347096202258392f, 7.7414669864011465f, 7.7481928495894596f,
- 7.7548875021634691f, 7.7615512324444795f, 7.7681843247769260f,
- 7.7747870596011737f, 7.7813597135246608f, 7.7879025593914317f,
- 7.7944158663501062f, 7.8008998999203047f, 7.8073549220576037f,
- 7.8137811912170374f, 7.8201789624151887f, 7.8265484872909159f,
- 7.8328900141647422f, 7.8392037880969445f, 7.8454900509443757f,
- 7.8517490414160571f, 7.8579809951275719f, 7.8641861446542798f,
- 7.8703647195834048f, 7.8765169465650002f, 7.8826430493618425f,
- 7.8887432488982601f, 7.8948177633079446f, 7.9008668079807496f,
- 7.9068905956085187f, 7.9128893362299619f, 7.9188632372745955f,
- 7.9248125036057813f, 7.9307373375628867f, 7.9366379390025719f,
- 7.9425145053392399f, 7.9483672315846778f, 7.9541963103868758f,
- 7.9600019320680806f, 7.9657842846620870f, 7.9715435539507720f,
- 7.9772799234999168f, 7.9829935746943104f, 7.9886846867721664f,
- 7.9943534368588578f
-};
+/* Visual Studio 2012 and Android API levels < 18 do not have the log2()
+ * function defined, so we use log() and a multiplication instead. */
+#if !defined(BROTLI_HAVE_LOG2)
+#if ((defined(_MSC_VER) && _MSC_VER <= 1700) || \
+ (defined(__ANDROID_API__) && __ANDROID_API__ < 18))
+#define BROTLI_HAVE_LOG2 0
+#else
+#define BROTLI_HAVE_LOG2 1
+#endif
+#endif
#define LOG_2_INV 1.4426950408889634
/* Faster logarithm for small integers, with the property of log2(0) == 0. */
static BROTLI_INLINE double FastLog2(size_t v) {
- if (v < sizeof(kLog2Table) / sizeof(kLog2Table[0])) {
- return kLog2Table[v];
+ if (v < BROTLI_LOG2_TABLE_SIZE) {
+ return kBrotliLog2Table[v];
}
-#if (defined(_MSC_VER) && _MSC_VER <= 1700) || \
- (defined(__ANDROID_API__) && __ANDROID_API__ < 18)
- /* Visual Studio 2012 and Android API levels < 18 do not have the log2()
- * function defined, so we use log() and a multiplication instead. */
+#if !(BROTLI_HAVE_LOG2)
return log((double)v) * LOG_2_INV;
#else
return log2((double)v);
diff --git a/c/enc/find_match_length.h b/c/enc/find_match_length.h
index bc428cf..f8853a7 100644
--- a/c/enc/find_match_length.h
+++ b/c/enc/find_match_length.h
@@ -17,8 +17,7 @@ extern "C" {
#endif
/* Separate implementation for little-endian 64-bit targets, for speed. */
-#if defined(__GNUC__) && defined(_LP64) && defined(BROTLI_LITTLE_ENDIAN)
-
+#if defined(BROTLI_TZCNT64) && BROTLI_64_BITS && BROTLI_LITTLE_ENDIAN
static BROTLI_INLINE size_t FindMatchLengthWithLimit(const uint8_t* s1,
const uint8_t* s2,
size_t limit) {
@@ -32,7 +31,7 @@ static BROTLI_INLINE size_t FindMatchLengthWithLimit(const uint8_t* s1,
} else {
uint64_t x = BROTLI_UNALIGNED_LOAD64LE(s2) ^
BROTLI_UNALIGNED_LOAD64LE(s1 + matched);
- size_t matching_bits = (size_t)__builtin_ctzll(x);
+ size_t matching_bits = (size_t)BROTLI_TZCNT64(x);
matched += matching_bits >> 3;
return matched;
}
diff --git a/c/enc/hash.h b/c/enc/hash.h
index 8c5a7bb..6362f69 100644
--- a/c/enc/hash.h
+++ b/c/enc/hash.h
@@ -27,34 +27,19 @@
extern "C" {
#endif
-/* Pointer to hasher data.
- *
- * Excluding initialization and destruction, hasher can be passed as
- * HasherHandle by value.
- *
- * Typically hasher data consists of 3 sections:
- * * HasherCommon structure
- * * private structured hasher data, depending on hasher type
- * * private dynamic hasher data, depending on hasher type and parameters
- *
- * Using "define" instead of "typedef", because on MSVC __restrict does not work
- * on typedef pointer types. */
-#define HasherHandle uint8_t*
-
typedef struct {
+ /* Dynamically allocated area; first member for quickest access. */
+ void* extra;
+
+ size_t dict_num_lookups;
+ size_t dict_num_matches;
+
BrotliHasherParams params;
/* False if hasher needs to be "prepared" before use. */
BROTLI_BOOL is_prepared_;
-
- size_t dict_num_lookups;
- size_t dict_num_matches;
} HasherCommon;
-static BROTLI_INLINE HasherCommon* GetHasherCommon(HasherHandle handle) {
- return (HasherCommon*)handle;
-}
-
#define score_t size_t
static const uint32_t kCutoffTransformsCount = 10;
@@ -149,17 +134,13 @@ static BROTLI_INLINE score_t BackwardReferencePenaltyUsingLastDistance(
}
static BROTLI_INLINE BROTLI_BOOL TestStaticDictionaryItem(
- const BrotliEncoderDictionary* dictionary, size_t item,
+ const BrotliEncoderDictionary* dictionary, size_t len, size_t word_idx,
const uint8_t* data, size_t max_length, size_t max_backward,
size_t max_distance, HasherSearchResult* out) {
- size_t len;
- size_t word_idx;
size_t offset;
size_t matchlen;
size_t backward;
score_t score;
- len = item & 0x1F;
- word_idx = item >> 5;
offset = dictionary->words->offsets_by_length[len] + len * word_idx;
if (len > max_length) {
return BROTLI_FALSE;
@@ -193,25 +174,24 @@ static BROTLI_INLINE BROTLI_BOOL TestStaticDictionaryItem(
static BROTLI_INLINE void SearchInStaticDictionary(
const BrotliEncoderDictionary* dictionary,
- HasherHandle handle, const uint8_t* data, size_t max_length,
+ HasherCommon* common, const uint8_t* data, size_t max_length,
size_t max_backward, size_t max_distance,
HasherSearchResult* out, BROTLI_BOOL shallow) {
size_t key;
size_t i;
- HasherCommon* self = GetHasherCommon(handle);
- if (self->dict_num_matches < (self->dict_num_lookups >> 7)) {
+ if (common->dict_num_matches < (common->dict_num_lookups >> 7)) {
return;
}
key = Hash14(data) << 1;
for (i = 0; i < (shallow ? 1u : 2u); ++i, ++key) {
- size_t item = dictionary->hash_table[key];
- self->dict_num_lookups++;
- if (item != 0) {
+ common->dict_num_lookups++;
+ if (dictionary->hash_table_lengths[key] != 0) {
BROTLI_BOOL item_matches = TestStaticDictionaryItem(
- dictionary, item, data,
+ dictionary, dictionary->hash_table_lengths[key],
+ dictionary->hash_table_words[key], data,
max_length, max_backward, max_distance, out);
if (item_matches) {
- self->dict_num_matches++;
+ common->dict_num_matches++;
}
}
}
@@ -260,37 +240,37 @@ static BROTLI_INLINE size_t BackwardMatchLengthCode(const BackwardMatch* self) {
/* MAX_NUM_MATCHES == 64 + MAX_TREE_SEARCH_DEPTH */
#define MAX_NUM_MATCHES_H10 128
-/* For BUCKET_SWEEP == 1, enabling the dictionary lookup makes compression
+/* For BUCKET_SWEEP_BITS == 0, enabling the dictionary lookup makes compression
a little faster (0.5% - 1%) and it compresses 0.15% better on small text
and HTML inputs. */
#define HASHER() H2
#define BUCKET_BITS 16
-#define BUCKET_SWEEP 1
+#define BUCKET_SWEEP_BITS 0
#define HASH_LEN 5
#define USE_DICTIONARY 1
#include "./hash_longest_match_quickly_inc.h" /* NOLINT(build/include) */
-#undef BUCKET_SWEEP
+#undef BUCKET_SWEEP_BITS
#undef USE_DICTIONARY
#undef HASHER
#define HASHER() H3
-#define BUCKET_SWEEP 2
+#define BUCKET_SWEEP_BITS 1
#define USE_DICTIONARY 0
#include "./hash_longest_match_quickly_inc.h" /* NOLINT(build/include) */
#undef USE_DICTIONARY
-#undef BUCKET_SWEEP
+#undef BUCKET_SWEEP_BITS
#undef BUCKET_BITS
#undef HASHER
#define HASHER() H4
#define BUCKET_BITS 17
-#define BUCKET_SWEEP 4
+#define BUCKET_SWEEP_BITS 2
#define USE_DICTIONARY 1
#include "./hash_longest_match_quickly_inc.h" /* NOLINT(build/include) */
#undef USE_DICTIONARY
#undef HASH_LEN
-#undef BUCKET_SWEEP
+#undef BUCKET_SWEEP_BITS
#undef BUCKET_BITS
#undef HASHER
@@ -334,13 +314,13 @@ static BROTLI_INLINE size_t BackwardMatchLengthCode(const BackwardMatch* self) {
#define HASHER() H54
#define BUCKET_BITS 20
-#define BUCKET_SWEEP 4
+#define BUCKET_SWEEP_BITS 2
#define HASH_LEN 7
#define USE_DICTIONARY 0
#include "./hash_longest_match_quickly_inc.h" /* NOLINT(build/include) */
#undef USE_DICTIONARY
#undef HASH_LEN
-#undef BUCKET_SWEEP
+#undef BUCKET_SWEEP_BITS
#undef BUCKET_BITS
#undef HASHER
@@ -393,97 +373,107 @@ static BROTLI_INLINE size_t BackwardMatchLengthCode(const BackwardMatch* self) {
#undef CAT
#undef EXPAND_CAT
-#define FOR_GENERIC_HASHERS(H) H(2) H(3) H(4) H(5) H(6) H(40) H(41) H(42) H(54)\
- H(35) H(55) H(65)
+#define FOR_SIMPLE_HASHERS(H) H(2) H(3) H(4) H(5) H(6) H(40) H(41) H(42) H(54)
+#define FOR_COMPOSITE_HASHERS(H) H(35) H(55) H(65)
+#define FOR_GENERIC_HASHERS(H) FOR_SIMPLE_HASHERS(H) FOR_COMPOSITE_HASHERS(H)
#define FOR_ALL_HASHERS(H) FOR_GENERIC_HASHERS(H) H(10)
-static BROTLI_INLINE void DestroyHasher(
- MemoryManager* m, HasherHandle* handle) {
- if (*handle == NULL) return;
- BROTLI_FREE(m, *handle);
+typedef struct {
+ HasherCommon common;
+
+ union {
+#define MEMBER_(N) \
+ H ## N _H ## N;
+ FOR_ALL_HASHERS(MEMBER_)
+#undef MEMBER_
+ } privat;
+} Hasher;
+
+/* MUST be invoked before any other method. */
+static BROTLI_INLINE void HasherInit(Hasher* hasher) {
+ hasher->common.extra = NULL;
}
-static BROTLI_INLINE void HasherReset(HasherHandle handle) {
- if (handle == NULL) return;
- GetHasherCommon(handle)->is_prepared_ = BROTLI_FALSE;
+static BROTLI_INLINE void DestroyHasher(MemoryManager* m, Hasher* hasher) {
+ if (hasher->common.extra == NULL) return;
+ BROTLI_FREE(m, hasher->common.extra);
+}
+
+static BROTLI_INLINE void HasherReset(Hasher* hasher) {
+ hasher->common.is_prepared_ = BROTLI_FALSE;
}
static BROTLI_INLINE size_t HasherSize(const BrotliEncoderParams* params,
BROTLI_BOOL one_shot, const size_t input_size) {
- size_t result = sizeof(HasherCommon);
switch (params->hasher.type) {
-#define SIZE_(N) \
- case N: \
- result += HashMemAllocInBytesH ## N(params, one_shot, input_size); \
- break;
+#define SIZE_(N) \
+ case N: \
+ return HashMemAllocInBytesH ## N(params, one_shot, input_size);
FOR_ALL_HASHERS(SIZE_)
#undef SIZE_
default:
break;
}
- return result;
+ return 0; /* Default case. */
}
-static BROTLI_INLINE void HasherSetup(MemoryManager* m, HasherHandle* handle,
+static BROTLI_INLINE void HasherSetup(MemoryManager* m, Hasher* hasher,
BrotliEncoderParams* params, const uint8_t* data, size_t position,
size_t input_size, BROTLI_BOOL is_last) {
- HasherHandle self = NULL;
- HasherCommon* common = NULL;
BROTLI_BOOL one_shot = (position == 0 && is_last);
- if (*handle == NULL) {
+ if (hasher->common.extra == NULL) {
size_t alloc_size;
ChooseHasher(params, &params->hasher);
alloc_size = HasherSize(params, one_shot, input_size);
- self = BROTLI_ALLOC(m, uint8_t, alloc_size);
- if (BROTLI_IS_OOM(m)) return;
- *handle = self;
- common = GetHasherCommon(self);
- common->params = params->hasher;
- switch (common->params.type) {
-#define INITIALIZE_(N) \
- case N: \
- InitializeH ## N(*handle, params); \
+ hasher->common.extra = BROTLI_ALLOC(m, uint8_t, alloc_size);
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(hasher->common.extra)) return;
+ hasher->common.params = params->hasher;
+ switch (hasher->common.params.type) {
+#define INITIALIZE_(N) \
+ case N: \
+ InitializeH ## N(&hasher->common, \
+ &hasher->privat._H ## N, params); \
break;
FOR_ALL_HASHERS(INITIALIZE_);
#undef INITIALIZE_
default:
break;
}
- HasherReset(*handle);
+ HasherReset(hasher);
}
- self = *handle;
- common = GetHasherCommon(self);
- if (!common->is_prepared_) {
- switch (common->params.type) {
-#define PREPARE_(N) \
- case N: \
- PrepareH ## N(self, one_shot, input_size, data); \
+ if (!hasher->common.is_prepared_) {
+ switch (hasher->common.params.type) {
+#define PREPARE_(N) \
+ case N: \
+ PrepareH ## N( \
+ &hasher->privat._H ## N, \
+ one_shot, input_size, data); \
break;
FOR_ALL_HASHERS(PREPARE_)
#undef PREPARE_
default: break;
}
if (position == 0) {
- common->dict_num_lookups = 0;
- common->dict_num_matches = 0;
+ hasher->common.dict_num_lookups = 0;
+ hasher->common.dict_num_matches = 0;
}
- common->is_prepared_ = BROTLI_TRUE;
+ hasher->common.is_prepared_ = BROTLI_TRUE;
}
}
static BROTLI_INLINE void InitOrStitchToPreviousBlock(
- MemoryManager* m, HasherHandle* handle, const uint8_t* data, size_t mask,
+ MemoryManager* m, Hasher* hasher, const uint8_t* data, size_t mask,
BrotliEncoderParams* params, size_t position, size_t input_size,
BROTLI_BOOL is_last) {
- HasherHandle self;
- HasherSetup(m, handle, params, data, position, input_size, is_last);
+ HasherSetup(m, hasher, params, data, position, input_size, is_last);
if (BROTLI_IS_OOM(m)) return;
- self = *handle;
- switch (GetHasherCommon(self)->params.type) {
-#define INIT_(N) \
- case N: \
- StitchToPreviousBlockH ## N(self, input_size, position, data, mask); \
+ switch (hasher->common.params.type) {
+#define INIT_(N) \
+ case N: \
+ StitchToPreviousBlockH ## N( \
+ &hasher->privat._H ## N, \
+ input_size, position, data, mask); \
break;
FOR_ALL_HASHERS(INIT_)
#undef INIT_
diff --git a/c/enc/hash_composite_inc.h b/c/enc/hash_composite_inc.h
index b266aa2..cba156c 100755..100644
--- a/c/enc/hash_composite_inc.h
+++ b/c/enc/hash_composite_inc.h
@@ -28,20 +28,25 @@ static BROTLI_INLINE size_t FN(StoreLookahead)(void) {
}
typedef struct HashComposite {
- HasherHandle ha;
- HasherHandle hb;
+ HASHER_A ha;
+ HASHER_B hb;
+ HasherCommon hb_common;
+
+ /* Shortcuts. */
+ void* extra;
+ HasherCommon* common;
+
+ BROTLI_BOOL fresh;
const BrotliEncoderParams* params;
} HashComposite;
-static BROTLI_INLINE HashComposite* FN(Self)(HasherHandle handle) {
- return (HashComposite*)&(GetHasherCommon(handle)[1]);
-}
+static void FN(Initialize)(HasherCommon* common,
+ HashComposite* BROTLI_RESTRICT self, const BrotliEncoderParams* params) {
+ self->common = common;
+ self->extra = common->extra;
-static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- HashComposite* self = FN(Self)(handle);
- self->ha = 0;
- self->hb = 0;
+ self->hb_common = *self->common;
+ self->fresh = BROTLI_TRUE;
self->params = params;
/* TODO: Initialize of the hashers is defered to Prepare (and params
remembered here) because we don't get the one_shot and input_size params
@@ -49,87 +54,71 @@ static void FN(Initialize)(
those params to all hashers FN(Initialize) */
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashComposite* self = FN(Self)(handle);
- if (!self->ha) {
- HasherCommon* common_a;
- HasherCommon* common_b;
-
- self->ha = handle + sizeof(HasherCommon) + sizeof(HashComposite);
- common_a = (HasherCommon*)self->ha;
- common_a->params = self->params->hasher;
- common_a->is_prepared_ = BROTLI_FALSE;
- common_a->dict_num_lookups = 0;
- common_a->dict_num_matches = 0;
- FN_A(Initialize)(self->ha, self->params);
-
- self->hb = self->ha + sizeof(HasherCommon) + FN_A(HashMemAllocInBytes)(
- self->params, one_shot, input_size);
- common_b = (HasherCommon*)self->hb;
- common_b->params = self->params->hasher;
- common_b->is_prepared_ = BROTLI_FALSE;
- common_b->dict_num_lookups = 0;
- common_b->dict_num_matches = 0;
- FN_B(Initialize)(self->hb, self->params);
+static void FN(Prepare)(
+ HashComposite* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
+ if (self->fresh) {
+ self->fresh = BROTLI_FALSE;
+ self->hb_common.extra = (uint8_t*)self->extra +
+ FN_A(HashMemAllocInBytes)(self->params, one_shot, input_size);
+
+ FN_A(Initialize)(self->common, &self->ha, self->params);
+ FN_B(Initialize)(&self->hb_common, &self->hb, self->params);
}
- FN_A(Prepare)(self->ha, one_shot, input_size, data);
- FN_B(Prepare)(self->hb, one_shot, input_size, data);
+ FN_A(Prepare)(&self->ha, one_shot, input_size, data);
+ FN_B(Prepare)(&self->hb, one_shot, input_size, data);
}
static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
const BrotliEncoderParams* params, BROTLI_BOOL one_shot,
size_t input_size) {
- return sizeof(HashComposite) + 2 * sizeof(HasherCommon) +
- FN_A(HashMemAllocInBytes)(params, one_shot, input_size) +
+ return FN_A(HashMemAllocInBytes)(params, one_shot, input_size) +
FN_B(HashMemAllocInBytes)(params, one_shot, input_size);
}
-static BROTLI_INLINE void FN(Store)(HasherHandle BROTLI_RESTRICT handle,
+static BROTLI_INLINE void FN(Store)(HashComposite* BROTLI_RESTRICT self,
const uint8_t* BROTLI_RESTRICT data, const size_t mask, const size_t ix) {
- HashComposite* self = FN(Self)(handle);
- FN_A(Store)(self->ha, data, mask, ix);
- FN_B(Store)(self->hb, data, mask, ix);
+ FN_A(Store)(&self->ha, data, mask, ix);
+ FN_B(Store)(&self->hb, data, mask, ix);
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
+static BROTLI_INLINE void FN(StoreRange)(
+ HashComposite* BROTLI_RESTRICT self, const uint8_t* BROTLI_RESTRICT data,
+ const size_t mask, const size_t ix_start,
const size_t ix_end) {
- HashComposite* self = FN(Self)(handle);
- FN_A(StoreRange)(self->ha, data, mask, ix_start, ix_end);
- FN_B(StoreRange)(self->hb, data, mask, ix_start, ix_end);
+ FN_A(StoreRange)(&self->ha, data, mask, ix_start, ix_end);
+ FN_B(StoreRange)(&self->hb, data, mask, ix_start, ix_end);
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashComposite* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ring_buffer_mask) {
- HashComposite* self = FN(Self)(handle);
- FN_A(StitchToPreviousBlock)(self->ha, num_bytes, position, ringbuffer,
- ring_buffer_mask);
- FN_B(StitchToPreviousBlock)(self->hb, num_bytes, position, ringbuffer,
- ring_buffer_mask);
+ FN_A(StitchToPreviousBlock)(&self->ha, num_bytes, position,
+ ringbuffer, ring_buffer_mask);
+ FN_B(StitchToPreviousBlock)(&self->hb, num_bytes, position,
+ ringbuffer, ring_buffer_mask);
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- HashComposite* self = FN(Self)(handle);
- FN_A(PrepareDistanceCache)(self->ha, distance_cache);
- FN_B(PrepareDistanceCache)(self->hb, distance_cache);
+ HashComposite* BROTLI_RESTRICT self, int* BROTLI_RESTRICT distance_cache) {
+ FN_A(PrepareDistanceCache)(&self->ha, distance_cache);
+ FN_B(PrepareDistanceCache)(&self->hb, distance_cache);
}
-static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
+static BROTLI_INLINE void FN(FindLongestMatch)(
+ HashComposite* BROTLI_RESTRICT self,
const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data, const size_t ring_buffer_mask,
const int* BROTLI_RESTRICT distance_cache, const size_t cur_ix,
const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HashComposite* self = FN(Self)(handle);
- FN_A(FindLongestMatch)(self->ha, dictionary, data, ring_buffer_mask,
- distance_cache, cur_ix, max_length, max_backward, gap,
+ FN_A(FindLongestMatch)(&self->ha, dictionary, data, ring_buffer_mask,
+ distance_cache, cur_ix, max_length, max_backward, dictionary_distance,
max_distance, out);
- FN_B(FindLongestMatch)(self->hb, dictionary, data, ring_buffer_mask,
- distance_cache, cur_ix, max_length, max_backward, gap,
+ FN_B(FindLongestMatch)(&self->hb, dictionary, data, ring_buffer_mask,
+ distance_cache, cur_ix, max_length, max_backward, dictionary_distance,
max_distance, out);
}
diff --git a/c/enc/hash_forgetful_chain_inc.h b/c/enc/hash_forgetful_chain_inc.h
index 41cb3ff..bfae6ba 100644
--- a/c/enc/hash_forgetful_chain_inc.h
+++ b/c/enc/hash_forgetful_chain_inc.h
@@ -28,7 +28,7 @@ static BROTLI_INLINE size_t FN(HashTypeLength)(void) { return 4; }
static BROTLI_INLINE size_t FN(StoreLookahead)(void) { return 4; }
/* HashBytes is the function that chooses the bucket to place the address in.*/
-static BROTLI_INLINE size_t FN(HashBytes)(const uint8_t* data) {
+static BROTLI_INLINE size_t FN(HashBytes)(const uint8_t* BROTLI_RESTRICT data) {
const uint32_t h = BROTLI_UNALIGNED_LOAD32LE(data) * kHashMul32;
/* The higher bits contain more mixture from the multiplication,
so we take our results from there. */
@@ -45,28 +45,56 @@ typedef struct FN(Bank) {
} FN(Bank);
typedef struct HashForgetfulChain {
- uint32_t addr[BUCKET_SIZE];
- uint16_t head[BUCKET_SIZE];
- /* Truncated hash used for quick rejection of "distance cache" candidates. */
- uint8_t tiny_hash[65536];
- FN(Bank) banks[NUM_BANKS];
- uint16_t free_slot_idx[NUM_BANKS];
+ uint16_t free_slot_idx[NUM_BANKS]; /* Up to 1KiB. Move to dynamic? */
size_t max_hops;
+
+ /* Shortcuts. */
+ void* extra;
+ HasherCommon* common;
+
+ /* --- Dynamic size members --- */
+
+ /* uint32_t addr[BUCKET_SIZE]; */
+
+ /* uint16_t head[BUCKET_SIZE]; */
+
+ /* Truncated hash used for quick rejection of "distance cache" candidates. */
+ /* uint8_t tiny_hash[65536];*/
+
+ /* FN(Bank) banks[NUM_BANKS]; */
} HashForgetfulChain;
-static BROTLI_INLINE HashForgetfulChain* FN(Self)(HasherHandle handle) {
- return (HashForgetfulChain*)&(GetHasherCommon(handle)[1]);
+static uint32_t* FN(Addr)(void* extra) {
+ return (uint32_t*)extra;
+}
+
+static uint16_t* FN(Head)(void* extra) {
+ return (uint16_t*)(&FN(Addr)(extra)[BUCKET_SIZE]);
+}
+
+static uint8_t* FN(TinyHash)(void* extra) {
+ return (uint8_t*)(&FN(Head)(extra)[BUCKET_SIZE]);
+}
+
+static FN(Bank)* FN(Banks)(void* extra) {
+ return (FN(Bank)*)(&FN(TinyHash)(extra)[65536]);
}
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- FN(Self)(handle)->max_hops =
- (params->quality > 6 ? 7u : 8u) << (params->quality - 4);
+ HasherCommon* common, HashForgetfulChain* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
+ self->common = common;
+ self->extra = common->extra;
+
+ self->max_hops = (params->quality > 6 ? 7u : 8u) << (params->quality - 4);
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashForgetfulChain* self = FN(Self)(handle);
+static void FN(Prepare)(
+ HashForgetfulChain* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
+ uint32_t* BROTLI_RESTRICT addr = FN(Addr)(self->extra);
+ uint16_t* BROTLI_RESTRICT head = FN(Head)(self->extra);
+ uint8_t* BROTLI_RESTRICT tiny_hash = FN(TinyHash)(self->extra);
/* Partial preparation is 100 times slower (per socket). */
size_t partial_prepare_threshold = BUCKET_SIZE >> 6;
if (one_shot && input_size <= partial_prepare_threshold) {
@@ -74,17 +102,17 @@ static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
for (i = 0; i < input_size; ++i) {
size_t bucket = FN(HashBytes)(&data[i]);
/* See InitEmpty comment. */
- self->addr[bucket] = 0xCCCCCCCC;
- self->head[bucket] = 0xCCCC;
+ addr[bucket] = 0xCCCCCCCC;
+ head[bucket] = 0xCCCC;
}
} else {
/* Fill |addr| array with 0xCCCCCCCC value. Because of wrapping, position
processed by hasher never reaches 3GB + 64M; this makes all new chains
to be terminated after the first node. */
- memset(self->addr, 0xCC, sizeof(self->addr));
- memset(self->head, 0, sizeof(self->head));
+ memset(addr, 0xCC, sizeof(uint32_t) * BUCKET_SIZE);
+ memset(head, 0, sizeof(uint16_t) * BUCKET_SIZE);
}
- memset(self->tiny_hash, 0, sizeof(self->tiny_hash));
+ memset(tiny_hash, 0, sizeof(uint8_t) * 65536);
memset(self->free_slot_idx, 0, sizeof(self->free_slot_idx));
}
@@ -94,51 +122,58 @@ static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
BROTLI_UNUSED(params);
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
- return sizeof(HashForgetfulChain);
+ return sizeof(uint32_t) * BUCKET_SIZE + sizeof(uint16_t) * BUCKET_SIZE +
+ sizeof(uint8_t) * 65536 + sizeof(FN(Bank)) * NUM_BANKS;
}
/* Look at 4 bytes at &data[ix & mask]. Compute a hash from these, and prepend
node to corresponding chain; also update tiny_hash for current position. */
-static BROTLI_INLINE void FN(Store)(HasherHandle BROTLI_RESTRICT handle,
+static BROTLI_INLINE void FN(Store)(HashForgetfulChain* BROTLI_RESTRICT self,
const uint8_t* BROTLI_RESTRICT data, const size_t mask, const size_t ix) {
- HashForgetfulChain* self = FN(Self)(handle);
+ uint32_t* BROTLI_RESTRICT addr = FN(Addr)(self->extra);
+ uint16_t* BROTLI_RESTRICT head = FN(Head)(self->extra);
+ uint8_t* BROTLI_RESTRICT tiny_hash = FN(TinyHash)(self->extra);
+ FN(Bank)* BROTLI_RESTRICT banks = FN(Banks)(self->extra);
const size_t key = FN(HashBytes)(&data[ix & mask]);
const size_t bank = key & (NUM_BANKS - 1);
const size_t idx = self->free_slot_idx[bank]++ & (BANK_SIZE - 1);
- size_t delta = ix - self->addr[key];
- self->tiny_hash[(uint16_t)ix] = (uint8_t)key;
+ size_t delta = ix - addr[key];
+ tiny_hash[(uint16_t)ix] = (uint8_t)key;
if (delta > 0xFFFF) delta = CAPPED_CHAINS ? 0 : 0xFFFF;
- self->banks[bank].slots[idx].delta = (uint16_t)delta;
- self->banks[bank].slots[idx].next = self->head[key];
- self->addr[key] = (uint32_t)ix;
- self->head[key] = (uint16_t)idx;
+ banks[bank].slots[idx].delta = (uint16_t)delta;
+ banks[bank].slots[idx].next = head[key];
+ addr[key] = (uint32_t)ix;
+ head[key] = (uint16_t)idx;
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
+static BROTLI_INLINE void FN(StoreRange)(
+ HashForgetfulChain* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
size_t i;
for (i = ix_start; i < ix_end; ++i) {
- FN(Store)(handle, data, mask, i);
+ FN(Store)(self, data, mask, i);
}
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashForgetfulChain* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ring_buffer_mask) {
if (num_bytes >= FN(HashTypeLength)() - 1 && position >= 3) {
/* Prepare the hashes for three last bytes of the last write.
These could not be calculated before, since they require knowledge
of both the previous and the current block. */
- FN(Store)(handle, ringbuffer, ring_buffer_mask, position - 3);
- FN(Store)(handle, ringbuffer, ring_buffer_mask, position - 2);
- FN(Store)(handle, ringbuffer, ring_buffer_mask, position - 1);
+ FN(Store)(self, ringbuffer, ring_buffer_mask, position - 3);
+ FN(Store)(self, ringbuffer, ring_buffer_mask, position - 2);
+ FN(Store)(self, ringbuffer, ring_buffer_mask, position - 1);
}
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- BROTLI_UNUSED(handle);
+ HashForgetfulChain* BROTLI_RESTRICT self,
+ int* BROTLI_RESTRICT distance_cache) {
+ BROTLI_UNUSED(self);
PrepareDistanceCache(distance_cache, NUM_LAST_DISTANCES_TO_CHECK);
}
@@ -153,14 +188,18 @@ static BROTLI_INLINE void FN(PrepareDistanceCache)(
Does not look for matches further away than max_backward.
Writes the best match into |out|.
|out|->score is updated only if a better match is found. */
-static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
+static BROTLI_INLINE void FN(FindLongestMatch)(
+ HashForgetfulChain* BROTLI_RESTRICT self,
const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data, const size_t ring_buffer_mask,
const int* BROTLI_RESTRICT distance_cache,
const size_t cur_ix, const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HashForgetfulChain* self = FN(Self)(handle);
+ uint32_t* BROTLI_RESTRICT addr = FN(Addr)(self->extra);
+ uint16_t* BROTLI_RESTRICT head = FN(Head)(self->extra);
+ uint8_t* BROTLI_RESTRICT tiny_hashes = FN(TinyHash)(self->extra);
+ FN(Bank)* BROTLI_RESTRICT banks = FN(Banks)(self->extra);
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
/* Don't accept a short copy from far away. */
score_t min_score = out->score;
@@ -176,7 +215,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
const size_t backward = (size_t)distance_cache[i];
size_t prev_ix = (cur_ix - backward);
/* For distance code 0 we want to consider 2-byte matches. */
- if (i > 0 && self->tiny_hash[(uint16_t)prev_ix] != tiny_hash) continue;
+ if (i > 0 && tiny_hashes[(uint16_t)prev_ix] != tiny_hash) continue;
if (prev_ix >= cur_ix || backward > max_backward) {
continue;
}
@@ -204,16 +243,16 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
const size_t bank = key & (NUM_BANKS - 1);
size_t backward = 0;
size_t hops = self->max_hops;
- size_t delta = cur_ix - self->addr[key];
- size_t slot = self->head[key];
+ size_t delta = cur_ix - addr[key];
+ size_t slot = head[key];
while (hops--) {
size_t prev_ix;
size_t last = slot;
backward += delta;
if (backward > max_backward || (CAPPED_CHAINS && !delta)) break;
prev_ix = (cur_ix - backward) & ring_buffer_mask;
- slot = self->banks[bank].slots[last].next;
- delta = self->banks[bank].slots[last].delta;
+ slot = banks[bank].slots[last].next;
+ delta = banks[bank].slots[last].delta;
if (cur_ix_masked + best_len > ring_buffer_mask ||
prev_ix + best_len > ring_buffer_mask ||
data[cur_ix_masked + best_len] != data[prev_ix + best_len]) {
@@ -238,11 +277,11 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
}
}
}
- FN(Store)(handle, data, ring_buffer_mask, cur_ix);
+ FN(Store)(self, data, ring_buffer_mask, cur_ix);
}
if (out->score == min_score) {
SearchInStaticDictionary(dictionary,
- handle, &data[cur_ix_masked], max_length, max_backward + gap,
+ self->common, &data[cur_ix_masked], max_length, dictionary_distance,
max_distance, out, BROTLI_FALSE);
}
}
diff --git a/c/enc/hash_longest_match64_inc.h b/c/enc/hash_longest_match64_inc.h
index cb953a6..956fb30 100644
--- a/c/enc/hash_longest_match64_inc.h
+++ b/c/enc/hash_longest_match64_inc.h
@@ -20,7 +20,7 @@ static BROTLI_INLINE size_t FN(HashTypeLength)(void) { return 8; }
static BROTLI_INLINE size_t FN(StoreLookahead)(void) { return 8; }
/* HashBytes is the function that chooses the bucket to place the address in. */
-static BROTLI_INLINE uint32_t FN(HashBytes)(const uint8_t* data,
+static BROTLI_INLINE uint32_t FN(HashBytes)(const uint8_t* BROTLI_RESTRICT data,
const uint64_t mask,
const int shift) {
const uint64_t h = (BROTLI_UNALIGNED_LOAD64LE(data) & mask) * kHashMul64Long;
@@ -42,43 +42,43 @@ typedef struct HashLongestMatch {
/* Mask for accessing entries in a block (in a ring-buffer manner). */
uint32_t block_mask_;
+ int block_bits_;
+ int num_last_distances_to_check_;
+
+ /* Shortcuts. */
+ HasherCommon* common_;
+
/* --- Dynamic size members --- */
/* Number of entries in a particular bucket. */
- /* uint16_t num[bucket_size]; */
+ uint16_t* num_; /* uint16_t[bucket_size]; */
/* Buckets containing block_size_ of backward references. */
- /* uint32_t* buckets[bucket_size * block_size]; */
+ uint32_t* buckets_; /* uint32_t[bucket_size * block_size]; */
} HashLongestMatch;
-static BROTLI_INLINE HashLongestMatch* FN(Self)(HasherHandle handle) {
- return (HashLongestMatch*)&(GetHasherCommon(handle)[1]);
-}
-
-static BROTLI_INLINE uint16_t* FN(Num)(HashLongestMatch* self) {
- return (uint16_t*)(&self[1]);
-}
-
-static BROTLI_INLINE uint32_t* FN(Buckets)(HashLongestMatch* self) {
- return (uint32_t*)(&FN(Num)(self)[self->bucket_size_]);
-}
-
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- HasherCommon* common = GetHasherCommon(handle);
- HashLongestMatch* self = FN(Self)(handle);
+ HasherCommon* common, HashLongestMatch* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
+ self->common_ = common;
+
BROTLI_UNUSED(params);
self->hash_shift_ = 64 - common->params.bucket_bits;
self->hash_mask_ = (~((uint64_t)0U)) >> (64 - 8 * common->params.hash_len);
self->bucket_size_ = (size_t)1 << common->params.bucket_bits;
+ self->block_bits_ = common->params.block_bits;
self->block_size_ = (size_t)1 << common->params.block_bits;
self->block_mask_ = (uint32_t)(self->block_size_ - 1);
+ self->num_last_distances_to_check_ =
+ common->params.num_last_distances_to_check;
+ self->num_ = (uint16_t*)common->extra;
+ self->buckets_ = (uint32_t*)&self->num_[self->bucket_size_];
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
+static void FN(Prepare)(
+ HashLongestMatch* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
+ uint16_t* BROTLI_RESTRICT num = self->num_;
/* Partial preparation is 100 times slower (per socket). */
size_t partial_prepare_threshold = self->bucket_size_ >> 6;
if (one_shot && input_size <= partial_prepare_threshold) {
@@ -100,50 +100,52 @@ static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
size_t block_size = (size_t)1 << params->hasher.block_bits;
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
- return sizeof(HashLongestMatch) + bucket_size * (2 + 4 * block_size);
+ return sizeof(uint16_t) * bucket_size +
+ sizeof(uint32_t) * bucket_size * block_size;
}
/* Look at 4 bytes at &data[ix & mask].
Compute a hash from these, and store the value of ix at that position. */
-static BROTLI_INLINE void FN(Store)(HasherHandle handle, const uint8_t* data,
+static BROTLI_INLINE void FN(Store)(
+ HashLongestMatch* BROTLI_RESTRICT self, const uint8_t* BROTLI_RESTRICT data,
const size_t mask, const size_t ix) {
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
+ uint16_t* BROTLI_RESTRICT num = self->num_;
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
const uint32_t key = FN(HashBytes)(&data[ix & mask], self->hash_mask_,
self->hash_shift_);
const size_t minor_ix = num[key] & self->block_mask_;
- const size_t offset =
- minor_ix + (key << GetHasherCommon(handle)->params.block_bits);
- FN(Buckets)(self)[offset] = (uint32_t)ix;
+ const size_t offset = minor_ix + (key << self->block_bits_);
++num[key];
+ buckets[offset] = (uint32_t)ix;
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
+static BROTLI_INLINE void FN(StoreRange)(HashLongestMatch* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
size_t i;
for (i = ix_start; i < ix_end; ++i) {
- FN(Store)(handle, data, mask, i);
+ FN(Store)(self, data, mask, i);
}
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashLongestMatch* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ringbuffer_mask) {
if (num_bytes >= FN(HashTypeLength)() - 1 && position >= 3) {
/* Prepare the hashes for three last bytes of the last write.
These could not be calculated before, since they require knowledge
of both the previous and the current block. */
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 3);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 2);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 1);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 3);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 2);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 1);
}
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- PrepareDistanceCache(distance_cache,
- GetHasherCommon(handle)->params.num_last_distances_to_check);
+ HashLongestMatch* BROTLI_RESTRICT self,
+ int* BROTLI_RESTRICT distance_cache) {
+ PrepareDistanceCache(distance_cache, self->num_last_distances_to_check_);
}
/* Find a longest backward match of &data[cur_ix] up to the length of
@@ -157,17 +159,16 @@ static BROTLI_INLINE void FN(PrepareDistanceCache)(
Does not look for matches further away than max_backward.
Writes the best match into |out|.
|out|->score is updated only if a better match is found. */
-static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
+static BROTLI_INLINE void FN(FindLongestMatch)(
+ HashLongestMatch* BROTLI_RESTRICT self,
const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data, const size_t ring_buffer_mask,
const int* BROTLI_RESTRICT distance_cache, const size_t cur_ix,
const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HasherCommon* common = GetHasherCommon(handle);
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
- uint32_t* buckets = FN(Buckets)(self);
+ uint16_t* BROTLI_RESTRICT num = self->num_;
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
/* Don't accept a short copy from far away. */
score_t min_score = out->score;
@@ -177,7 +178,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
out->len = 0;
out->len_code_delta = 0;
/* Try last distance first. */
- for (i = 0; i < (size_t)common->params.num_last_distances_to_check; ++i) {
+ for (i = 0; i < (size_t)self->num_last_distances_to_check_; ++i) {
const size_t backward = (size_t)distance_cache[i];
size_t prev_ix = (size_t)(cur_ix - backward);
if (prev_ix >= cur_ix) {
@@ -218,8 +219,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
{
const uint32_t key = FN(HashBytes)(
&data[cur_ix_masked], self->hash_mask_, self->hash_shift_);
- uint32_t* BROTLI_RESTRICT bucket =
- &buckets[key << common->params.block_bits];
+ uint32_t* BROTLI_RESTRICT bucket = &buckets[key << self->block_bits_];
const size_t down =
(num[key] > self->block_size_) ?
(num[key] - self->block_size_) : 0u;
@@ -259,7 +259,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
}
if (min_score == out->score) {
SearchInStaticDictionary(dictionary,
- handle, &data[cur_ix_masked], max_length, max_backward + gap,
+ self->common_, &data[cur_ix_masked], max_length, dictionary_distance,
max_distance, out, BROTLI_FALSE);
}
}
diff --git a/c/enc/hash_longest_match_inc.h b/c/enc/hash_longest_match_inc.h
index 457f5a9..27f4463 100644
--- a/c/enc/hash_longest_match_inc.h
+++ b/c/enc/hash_longest_match_inc.h
@@ -20,7 +20,8 @@ static BROTLI_INLINE size_t FN(HashTypeLength)(void) { return 4; }
static BROTLI_INLINE size_t FN(StoreLookahead)(void) { return 4; }
/* HashBytes is the function that chooses the bucket to place the address in. */
-static uint32_t FN(HashBytes)(const uint8_t* data, const int shift) {
+static uint32_t FN(HashBytes)(
+ const uint8_t* BROTLI_RESTRICT data, const int shift) {
uint32_t h = BROTLI_UNALIGNED_LOAD32LE(data) * kHashMul32;
/* The higher bits contain more mixture from the multiplication,
so we take our results from there. */
@@ -38,42 +39,46 @@ typedef struct HashLongestMatch {
/* Mask for accessing entries in a block (in a ring-buffer manner). */
uint32_t block_mask_;
+ int block_bits_;
+ int num_last_distances_to_check_;
+
+ /* Shortcuts. */
+ HasherCommon* common_;
+
/* --- Dynamic size members --- */
/* Number of entries in a particular bucket. */
- /* uint16_t num[bucket_size]; */
+ uint16_t* num_; /* uint16_t[bucket_size]; */
/* Buckets containing block_size_ of backward references. */
- /* uint32_t* buckets[bucket_size * block_size]; */
+ uint32_t* buckets_; /* uint32_t[bucket_size * block_size]; */
} HashLongestMatch;
-static BROTLI_INLINE HashLongestMatch* FN(Self)(HasherHandle handle) {
- return (HashLongestMatch*)&(GetHasherCommon(handle)[1]);
-}
-
-static BROTLI_INLINE uint16_t* FN(Num)(HashLongestMatch* self) {
- return (uint16_t*)(&self[1]);
-}
-
-static BROTLI_INLINE uint32_t* FN(Buckets)(HashLongestMatch* self) {
- return (uint32_t*)(&FN(Num)(self)[self->bucket_size_]);
+static BROTLI_INLINE uint16_t* FN(Num)(void* extra) {
+ return (uint16_t*)extra;
}
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- HasherCommon* common = GetHasherCommon(handle);
- HashLongestMatch* self = FN(Self)(handle);
+ HasherCommon* common, HashLongestMatch* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
+ self->common_ = common;
+
BROTLI_UNUSED(params);
self->hash_shift_ = 32 - common->params.bucket_bits;
self->bucket_size_ = (size_t)1 << common->params.bucket_bits;
self->block_size_ = (size_t)1 << common->params.block_bits;
self->block_mask_ = (uint32_t)(self->block_size_ - 1);
+ self->num_ = (uint16_t*)common->extra;
+ self->buckets_ = (uint32_t*)(&self->num_[self->bucket_size_]);
+ self->block_bits_ = common->params.block_bits;
+ self->num_last_distances_to_check_ =
+ common->params.num_last_distances_to_check;
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
+static void FN(Prepare)(
+ HashLongestMatch* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
+ uint16_t* BROTLI_RESTRICT num = self->num_;
/* Partial preparation is 100 times slower (per socket). */
size_t partial_prepare_threshold = self->bucket_size_ >> 6;
if (one_shot && input_size <= partial_prepare_threshold) {
@@ -94,49 +99,49 @@ static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
size_t block_size = (size_t)1 << params->hasher.block_bits;
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
- return sizeof(HashLongestMatch) + bucket_size * (2 + 4 * block_size);
+ return sizeof(uint16_t) * bucket_size +
+ sizeof(uint32_t) * bucket_size * block_size;
}
/* Look at 4 bytes at &data[ix & mask].
Compute a hash from these, and store the value of ix at that position. */
-static BROTLI_INLINE void FN(Store)(HasherHandle handle, const uint8_t* data,
+static BROTLI_INLINE void FN(Store)(
+ HashLongestMatch* BROTLI_RESTRICT self, const uint8_t* BROTLI_RESTRICT data,
const size_t mask, const size_t ix) {
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
const uint32_t key = FN(HashBytes)(&data[ix & mask], self->hash_shift_);
- const size_t minor_ix = num[key] & self->block_mask_;
- const size_t offset =
- minor_ix + (key << GetHasherCommon(handle)->params.block_bits);
- FN(Buckets)(self)[offset] = (uint32_t)ix;
- ++num[key];
+ const size_t minor_ix = self->num_[key] & self->block_mask_;
+ const size_t offset = minor_ix + (key << self->block_bits_);
+ self->buckets_[offset] = (uint32_t)ix;
+ ++self->num_[key];
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
+static BROTLI_INLINE void FN(StoreRange)(HashLongestMatch* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
size_t i;
for (i = ix_start; i < ix_end; ++i) {
- FN(Store)(handle, data, mask, i);
+ FN(Store)(self, data, mask, i);
}
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashLongestMatch* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ringbuffer_mask) {
if (num_bytes >= FN(HashTypeLength)() - 1 && position >= 3) {
/* Prepare the hashes for three last bytes of the last write.
These could not be calculated before, since they require knowledge
of both the previous and the current block. */
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 3);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 2);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 1);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 3);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 2);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 1);
}
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- PrepareDistanceCache(distance_cache,
- GetHasherCommon(handle)->params.num_last_distances_to_check);
+ HashLongestMatch* BROTLI_RESTRICT self,
+ int* BROTLI_RESTRICT distance_cache) {
+ PrepareDistanceCache(distance_cache, self->num_last_distances_to_check_);
}
/* Find a longest backward match of &data[cur_ix] up to the length of
@@ -150,17 +155,16 @@ static BROTLI_INLINE void FN(PrepareDistanceCache)(
Does not look for matches further away than max_backward.
Writes the best match into |out|.
|out|->score is updated only if a better match is found. */
-static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
+static BROTLI_INLINE void FN(FindLongestMatch)(
+ HashLongestMatch* BROTLI_RESTRICT self,
const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data, const size_t ring_buffer_mask,
const int* BROTLI_RESTRICT distance_cache, const size_t cur_ix,
const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HasherCommon* common = GetHasherCommon(handle);
- HashLongestMatch* self = FN(Self)(handle);
- uint16_t* num = FN(Num)(self);
- uint32_t* buckets = FN(Buckets)(self);
+ uint16_t* BROTLI_RESTRICT num = self->num_;
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
/* Don't accept a short copy from far away. */
score_t min_score = out->score;
@@ -170,7 +174,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
out->len = 0;
out->len_code_delta = 0;
/* Try last distance first. */
- for (i = 0; i < (size_t)common->params.num_last_distances_to_check; ++i) {
+ for (i = 0; i < (size_t)self->num_last_distances_to_check_; ++i) {
const size_t backward = (size_t)distance_cache[i];
size_t prev_ix = (size_t)(cur_ix - backward);
if (prev_ix >= cur_ix) {
@@ -211,8 +215,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
{
const uint32_t key =
FN(HashBytes)(&data[cur_ix_masked], self->hash_shift_);
- uint32_t* BROTLI_RESTRICT bucket =
- &buckets[key << common->params.block_bits];
+ uint32_t* BROTLI_RESTRICT bucket = &buckets[key << self->block_bits_];
const size_t down =
(num[key] > self->block_size_) ? (num[key] - self->block_size_) : 0u;
for (i = num[key]; i > down;) {
@@ -251,7 +254,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
}
if (min_score == out->score) {
SearchInStaticDictionary(dictionary,
- handle, &data[cur_ix_masked], max_length, max_backward + gap,
+ self->common_, &data[cur_ix_masked], max_length, dictionary_distance,
max_distance, out, BROTLI_FALSE);
}
}
diff --git a/c/enc/hash_longest_match_quickly_inc.h b/c/enc/hash_longest_match_quickly_inc.h
index a7b9639..e5ba840 100644
--- a/c/enc/hash_longest_match_quickly_inc.h
+++ b/c/enc/hash_longest_match_quickly_inc.h
@@ -5,15 +5,16 @@
See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
*/
-/* template parameters: FN, BUCKET_BITS, BUCKET_SWEEP, HASH_LEN,
+/* template parameters: FN, BUCKET_BITS, BUCKET_SWEEP_BITS, HASH_LEN,
USE_DICTIONARY
*/
#define HashLongestMatchQuickly HASHER()
#define BUCKET_SIZE (1 << BUCKET_BITS)
-
-#define HASH_MAP_SIZE (4 << BUCKET_BITS)
+#define BUCKET_MASK (BUCKET_SIZE - 1)
+#define BUCKET_SWEEP (1 << BUCKET_SWEEP_BITS)
+#define BUCKET_SWEEP_MASK ((BUCKET_SWEEP - 1) << 3)
static BROTLI_INLINE size_t FN(HashTypeLength)(void) { return 8; }
static BROTLI_INLINE size_t FN(StoreLookahead)(void) { return 8; }
@@ -32,39 +33,50 @@ static uint32_t FN(HashBytes)(const uint8_t* data) {
/* A (forgetful) hash table to the data seen by the compressor, to
help create backward references to previous data.
- This is a hash map of fixed size (BUCKET_SIZE). Starting from the
- given index, BUCKET_SWEEP buckets are used to store values of a key. */
+ This is a hash map of fixed size (BUCKET_SIZE). */
typedef struct HashLongestMatchQuickly {
- uint32_t buckets_[BUCKET_SIZE + BUCKET_SWEEP];
-} HashLongestMatchQuickly;
+ /* Shortcuts. */
+ HasherCommon* common;
-static BROTLI_INLINE HashLongestMatchQuickly* FN(Self)(HasherHandle handle) {
- return (HashLongestMatchQuickly*)&(GetHasherCommon(handle)[1]);
-}
+ /* --- Dynamic size members --- */
+
+ uint32_t* buckets_; /* uint32_t[BUCKET_SIZE]; */
+} HashLongestMatchQuickly;
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- BROTLI_UNUSED(handle);
+ HasherCommon* common, HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
+ self->common = common;
+
BROTLI_UNUSED(params);
+ self->buckets_ = (uint32_t*)common->extra;
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashLongestMatchQuickly* self = FN(Self)(handle);
+static void FN(Prepare)(
+ HashLongestMatchQuickly* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
/* Partial preparation is 100 times slower (per socket). */
- size_t partial_prepare_threshold = HASH_MAP_SIZE >> 7;
+ size_t partial_prepare_threshold = BUCKET_SIZE >> 5;
if (one_shot && input_size <= partial_prepare_threshold) {
size_t i;
for (i = 0; i < input_size; ++i) {
const uint32_t key = FN(HashBytes)(&data[i]);
- memset(&self->buckets_[key], 0, BUCKET_SWEEP * sizeof(self->buckets_[0]));
+ if (BUCKET_SWEEP == 1) {
+ buckets[key] = 0;
+ } else {
+ uint32_t j;
+ for (j = 0; j < BUCKET_SWEEP; ++j) {
+ buckets[(key + (j << 3)) & BUCKET_MASK] = 0;
+ }
+ }
}
} else {
/* It is not strictly necessary to fill this buffer here, but
not filling will make the results of the compression stochastic
(but correct). This is because random data would cause the
system to find accidentally good backward references here and there. */
- memset(&self->buckets_[0], 0, sizeof(self->buckets_));
+ memset(buckets, 0, sizeof(uint32_t) * BUCKET_SIZE);
}
}
@@ -74,45 +86,53 @@ static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
BROTLI_UNUSED(params);
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
- return sizeof(HashLongestMatchQuickly);
+ return sizeof(uint32_t) * BUCKET_SIZE;
}
/* Look at 5 bytes at &data[ix & mask].
Compute a hash from these, and store the value somewhere within
[ix .. ix+3]. */
-static BROTLI_INLINE void FN(Store)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix) {
+static BROTLI_INLINE void FN(Store)(
+ HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask, const size_t ix) {
const uint32_t key = FN(HashBytes)(&data[ix & mask]);
- /* Wiggle the value with the bucket sweep range. */
- const uint32_t off = (ix >> 3) % BUCKET_SWEEP;
- FN(Self)(handle)->buckets_[key + off] = (uint32_t)ix;
+ if (BUCKET_SWEEP == 1) {
+ self->buckets_[key] = (uint32_t)ix;
+ } else {
+ /* Wiggle the value with the bucket sweep range. */
+ const uint32_t off = ix & BUCKET_SWEEP_MASK;
+ self->buckets_[(key + off) & BUCKET_MASK] = (uint32_t)ix;
+ }
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
+static BROTLI_INLINE void FN(StoreRange)(
+ HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
size_t i;
for (i = ix_start; i < ix_end; ++i) {
- FN(Store)(handle, data, mask, i);
+ FN(Store)(self, data, mask, i);
}
}
static BROTLI_INLINE void FN(StitchToPreviousBlock)(
- HasherHandle handle, size_t num_bytes, size_t position,
+ HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ size_t num_bytes, size_t position,
const uint8_t* ringbuffer, size_t ringbuffer_mask) {
if (num_bytes >= FN(HashTypeLength)() - 1 && position >= 3) {
/* Prepare the hashes for three last bytes of the last write.
These could not be calculated before, since they require knowledge
of both the previous and the current block. */
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 3);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 2);
- FN(Store)(handle, ringbuffer, ringbuffer_mask, position - 1);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 3);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 2);
+ FN(Store)(self, ringbuffer, ringbuffer_mask, position - 1);
}
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- BROTLI_UNUSED(handle);
+ HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ int* BROTLI_RESTRICT distance_cache) {
+ BROTLI_UNUSED(self);
BROTLI_UNUSED(distance_cache);
}
@@ -125,17 +145,19 @@ static BROTLI_INLINE void FN(PrepareDistanceCache)(
Writes the best match into |out|.
|out|->score is updated only if a better match is found. */
static BROTLI_INLINE void FN(FindLongestMatch)(
- HasherHandle handle, const BrotliEncoderDictionary* dictionary,
+ HashLongestMatchQuickly* BROTLI_RESTRICT self,
+ const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data,
const size_t ring_buffer_mask, const int* BROTLI_RESTRICT distance_cache,
const size_t cur_ix, const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HashLongestMatchQuickly* self = FN(Self)(handle);
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
const size_t best_len_in = out->len;
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
- const uint32_t key = FN(HashBytes)(&data[cur_ix_masked]);
int compare_char = data[cur_ix_masked + best_len_in];
+ size_t key = FN(HashBytes)(&data[cur_ix_masked]);
+ size_t key_out;
score_t min_score = out->score;
score_t best_score = out->score;
size_t best_len = best_len_in;
@@ -145,21 +167,21 @@ static BROTLI_INLINE void FN(FindLongestMatch)(
if (prev_ix < cur_ix) {
prev_ix &= (uint32_t)ring_buffer_mask;
if (compare_char == data[prev_ix + best_len]) {
- size_t len = FindMatchLengthWithLimit(&data[prev_ix],
- &data[cur_ix_masked],
- max_length);
+ const size_t len = FindMatchLengthWithLimit(
+ &data[prev_ix], &data[cur_ix_masked], max_length);
if (len >= 4) {
const score_t score = BackwardReferenceScoreUsingLastDistance(len);
if (best_score < score) {
- best_score = score;
- best_len = len;
out->len = len;
out->distance = cached_backward;
- out->score = best_score;
- compare_char = data[cur_ix_masked + best_len];
+ out->score = score;
if (BUCKET_SWEEP == 1) {
- self->buckets_[key] = (uint32_t)cur_ix;
+ buckets[key] = (uint32_t)cur_ix;
return;
+ } else {
+ best_len = len;
+ best_score = score;
+ compare_char = data[cur_ix_masked + len];
}
}
}
@@ -169,8 +191,8 @@ static BROTLI_INLINE void FN(FindLongestMatch)(
size_t backward;
size_t len;
/* Only one to look for, don't bother to prepare for a loop. */
- prev_ix = self->buckets_[key];
- self->buckets_[key] = (uint32_t)cur_ix;
+ prev_ix = buckets[key];
+ buckets[key] = (uint32_t)cur_ix;
backward = cur_ix - prev_ix;
prev_ix &= (uint32_t)ring_buffer_mask;
if (compare_char != data[prev_ix + best_len_in]) {
@@ -192,12 +214,17 @@ static BROTLI_INLINE void FN(FindLongestMatch)(
}
}
} else {
- uint32_t* bucket = self->buckets_ + key;
- int i;
- prev_ix = *bucket++;
- for (i = 0; i < BUCKET_SWEEP; ++i, prev_ix = *bucket++) {
- const size_t backward = cur_ix - prev_ix;
+ size_t keys[BUCKET_SWEEP];
+ size_t i;
+ for (i = 0; i < BUCKET_SWEEP; ++i) {
+ keys[i] = (key + (i << 3)) & BUCKET_MASK;
+ }
+ key_out = keys[(cur_ix & BUCKET_SWEEP_MASK) >> 3];
+ for (i = 0; i < BUCKET_SWEEP; ++i) {
size_t len;
+ size_t backward;
+ prev_ix = buckets[keys[i]];
+ backward = cur_ix - prev_ix;
prev_ix &= (uint32_t)ring_buffer_mask;
if (compare_char != data[prev_ix + best_len]) {
continue;
@@ -211,25 +238,29 @@ static BROTLI_INLINE void FN(FindLongestMatch)(
if (len >= 4) {
const score_t score = BackwardReferenceScore(len, backward);
if (best_score < score) {
- best_score = score;
best_len = len;
- out->len = best_len;
- out->distance = backward;
+ out->len = len;
+ compare_char = data[cur_ix_masked + len];
+ best_score = score;
out->score = score;
- compare_char = data[cur_ix_masked + best_len];
+ out->distance = backward;
}
}
}
}
if (USE_DICTIONARY && min_score == out->score) {
SearchInStaticDictionary(dictionary,
- handle, &data[cur_ix_masked], max_length, max_backward + gap,
+ self->common, &data[cur_ix_masked], max_length, dictionary_distance,
max_distance, out, BROTLI_TRUE);
}
- self->buckets_[key + ((cur_ix >> 3) % BUCKET_SWEEP)] = (uint32_t)cur_ix;
+ if (BUCKET_SWEEP != 1) {
+ buckets[key_out] = (uint32_t)cur_ix;
+ }
}
-#undef HASH_MAP_SIZE
+#undef BUCKET_SWEEP_MASK
+#undef BUCKET_SWEEP
+#undef BUCKET_MASK
#undef BUCKET_SIZE
#undef HashLongestMatchQuickly
diff --git a/c/enc/hash_rolling_inc.h b/c/enc/hash_rolling_inc.h
index 17f8a40..586ae73 100755..100644
--- a/c/enc/hash_rolling_inc.h
+++ b/c/enc/hash_rolling_inc.h
@@ -51,13 +51,9 @@ typedef struct HashRolling {
uint32_t factor_remove;
} HashRolling;
-static BROTLI_INLINE HashRolling* FN(Self)(HasherHandle handle) {
- return (HashRolling*)&(GetHasherCommon(handle)[1]);
-}
-
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- HashRolling* self = FN(Self)(handle);
+ HasherCommon* common, HashRolling* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
size_t i;
self->state = 0;
self->next_ix = 0;
@@ -71,7 +67,7 @@ static void FN(Initialize)(
self->factor_remove *= self->factor;
}
- self->table = (uint32_t*)((HasherHandle)self + sizeof(HashRolling));
+ self->table = (uint32_t*)common->extra;
for (i = 0; i < NUMBUCKETS; i++) {
self->table[i] = FN(kInvalidPos);
}
@@ -79,9 +75,8 @@ static void FN(Initialize)(
BROTLI_UNUSED(params);
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashRolling* self = FN(Self)(handle);
+static void FN(Prepare)(HashRolling* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
size_t i;
/* Too small size, cannot use this hasher. */
if (input_size < CHUNKLEN) return;
@@ -96,36 +91,36 @@ static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
const BrotliEncoderParams* params, BROTLI_BOOL one_shot,
size_t input_size) {
- return sizeof(HashRolling) + NUMBUCKETS * sizeof(uint32_t);
+ return NUMBUCKETS * sizeof(uint32_t);
BROTLI_UNUSED(params);
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
}
-static BROTLI_INLINE void FN(Store)(HasherHandle BROTLI_RESTRICT handle,
+static BROTLI_INLINE void FN(Store)(HashRolling* BROTLI_RESTRICT self,
const uint8_t* BROTLI_RESTRICT data, const size_t mask, const size_t ix) {
- BROTLI_UNUSED(handle);
+ BROTLI_UNUSED(self);
BROTLI_UNUSED(data);
BROTLI_UNUSED(mask);
BROTLI_UNUSED(ix);
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
- BROTLI_UNUSED(handle);
+static BROTLI_INLINE void FN(StoreRange)(HashRolling* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
+ BROTLI_UNUSED(self);
BROTLI_UNUSED(data);
BROTLI_UNUSED(mask);
BROTLI_UNUSED(ix_start);
BROTLI_UNUSED(ix_end);
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashRolling* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ring_buffer_mask) {
/* In this case we must re-initialize the hasher from scratch from the
current position. */
- HashRolling* self = FN(Self)(handle);
size_t position_masked;
size_t available = num_bytes;
if ((position & (JUMP - 1)) != 0) {
@@ -139,28 +134,29 @@ static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
available = ring_buffer_mask - position_masked;
}
- FN(Prepare)(handle, BROTLI_FALSE, available,
+ FN(Prepare)(self, BROTLI_FALSE, available,
ringbuffer + (position & ring_buffer_mask));
self->next_ix = position;
BROTLI_UNUSED(num_bytes);
}
static BROTLI_INLINE void FN(PrepareDistanceCache)(
- HasherHandle handle, int* BROTLI_RESTRICT distance_cache) {
- BROTLI_UNUSED(handle);
+ HashRolling* BROTLI_RESTRICT self,
+ int* BROTLI_RESTRICT distance_cache) {
+ BROTLI_UNUSED(self);
BROTLI_UNUSED(distance_cache);
}
-static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
+static BROTLI_INLINE void FN(FindLongestMatch)(
+ HashRolling* BROTLI_RESTRICT self,
const BrotliEncoderDictionary* dictionary,
const uint8_t* BROTLI_RESTRICT data, const size_t ring_buffer_mask,
const int* BROTLI_RESTRICT distance_cache, const size_t cur_ix,
const size_t max_length, const size_t max_backward,
- const size_t gap, const size_t max_distance,
+ const size_t dictionary_distance, const size_t max_distance,
HasherSearchResult* BROTLI_RESTRICT out) {
- HashRolling* self = FN(Self)(handle);
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
- size_t pos = self->next_ix;
+ size_t pos;
if ((cur_ix & (JUMP - 1)) != 0) return;
@@ -209,7 +205,7 @@ static BROTLI_INLINE void FN(FindLongestMatch)(HasherHandle handle,
backup-hasher, the main hasher already searches in it. */
BROTLI_UNUSED(dictionary);
BROTLI_UNUSED(distance_cache);
- BROTLI_UNUSED(gap);
+ BROTLI_UNUSED(dictionary_distance);
BROTLI_UNUSED(max_distance);
}
diff --git a/c/enc/hash_to_binary_tree_inc.h b/c/enc/hash_to_binary_tree_inc.h
index 7fb0356..9880e0a 100644
--- a/c/enc/hash_to_binary_tree_inc.h
+++ b/c/enc/hash_to_binary_tree_inc.h
@@ -24,7 +24,7 @@ static BROTLI_INLINE size_t FN(StoreLookahead)(void) {
return MAX_TREE_COMP_LENGTH;
}
-static uint32_t FN(HashBytes)(const uint8_t* data) {
+static uint32_t FN(HashBytes)(const uint8_t* BROTLI_RESTRICT data) {
uint32_t h = BROTLI_UNALIGNED_LOAD32LE(data) * kHashMul32;
/* The higher bits contain more mixture from the multiplication,
so we take our results from there. */
@@ -38,7 +38,7 @@ typedef struct HashToBinaryTree {
/* Hash table that maps the 4-byte hashes of the sequence to the last
position where this hash was found, which is the root of the binary
tree of sequences that share this hash bucket. */
- uint32_t buckets_[BUCKET_SIZE];
+ uint32_t* buckets_; /* uint32_t[BUCKET_SIZE]; */
/* A position used to mark a non-existent sequence, i.e. a tree is empty if
its root is at invalid_pos_ and a node is a leaf if both its children
@@ -51,34 +51,30 @@ typedef struct HashToBinaryTree {
corresponding to a hash is a sequence starting at buckets_[hash] and
the left and right children of a sequence starting at pos are
forest_[2 * pos] and forest_[2 * pos + 1]. */
- /* uint32_t forest[2 * num_nodes] */
+ uint32_t* forest_; /* uint32_t[2 * num_nodes] */
} HashToBinaryTree;
-static BROTLI_INLINE HashToBinaryTree* FN(Self)(HasherHandle handle) {
- return (HashToBinaryTree*)&(GetHasherCommon(handle)[1]);
-}
-
-static BROTLI_INLINE uint32_t* FN(Forest)(HashToBinaryTree* self) {
- return (uint32_t*)(&self[1]);
-}
-
static void FN(Initialize)(
- HasherHandle handle, const BrotliEncoderParams* params) {
- HashToBinaryTree* self = FN(Self)(handle);
+ HasherCommon* common, HashToBinaryTree* BROTLI_RESTRICT self,
+ const BrotliEncoderParams* params) {
+ self->buckets_ = (uint32_t*)common->extra;
+ self->forest_ = &self->buckets_[BUCKET_SIZE];
+
self->window_mask_ = (1u << params->lgwin) - 1u;
self->invalid_pos_ = (uint32_t)(0 - self->window_mask_);
}
-static void FN(Prepare)(HasherHandle handle, BROTLI_BOOL one_shot,
- size_t input_size, const uint8_t* data) {
- HashToBinaryTree* self = FN(Self)(handle);
+static void FN(Prepare)
+ (HashToBinaryTree* BROTLI_RESTRICT self, BROTLI_BOOL one_shot,
+ size_t input_size, const uint8_t* BROTLI_RESTRICT data) {
uint32_t invalid_pos = self->invalid_pos_;
uint32_t i;
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
BROTLI_UNUSED(data);
BROTLI_UNUSED(one_shot);
BROTLI_UNUSED(input_size);
for (i = 0; i < BUCKET_SIZE; i++) {
- self->buckets_[i] = invalid_pos;
+ buckets[i] = invalid_pos;
}
}
@@ -89,15 +85,17 @@ static BROTLI_INLINE size_t FN(HashMemAllocInBytes)(
if (one_shot && input_size < num_nodes) {
num_nodes = input_size;
}
- return sizeof(HashToBinaryTree) + 2 * sizeof(uint32_t) * num_nodes;
+ return sizeof(uint32_t) * BUCKET_SIZE + 2 * sizeof(uint32_t) * num_nodes;
}
-static BROTLI_INLINE size_t FN(LeftChildIndex)(HashToBinaryTree* self,
+static BROTLI_INLINE size_t FN(LeftChildIndex)(
+ HashToBinaryTree* BROTLI_RESTRICT self,
const size_t pos) {
return 2 * (pos & self->window_mask_);
}
-static BROTLI_INLINE size_t FN(RightChildIndex)(HashToBinaryTree* self,
+static BROTLI_INLINE size_t FN(RightChildIndex)(
+ HashToBinaryTree* BROTLI_RESTRICT self,
const size_t pos) {
return 2 * (pos & self->window_mask_) + 1;
}
@@ -113,7 +111,7 @@ static BROTLI_INLINE size_t FN(RightChildIndex)(HashToBinaryTree* self,
This function must be called with increasing cur_ix positions. */
static BROTLI_INLINE BackwardMatch* FN(StoreAndFindMatches)(
- HashToBinaryTree* self, const uint8_t* const BROTLI_RESTRICT data,
+ HashToBinaryTree* BROTLI_RESTRICT self, const uint8_t* BROTLI_RESTRICT data,
const size_t cur_ix, const size_t ring_buffer_mask, const size_t max_length,
const size_t max_backward, size_t* const BROTLI_RESTRICT best_len,
BackwardMatch* BROTLI_RESTRICT matches) {
@@ -123,8 +121,9 @@ static BROTLI_INLINE BackwardMatch* FN(StoreAndFindMatches)(
const BROTLI_BOOL should_reroot_tree =
TO_BROTLI_BOOL(max_length >= MAX_TREE_COMP_LENGTH);
const uint32_t key = FN(HashBytes)(&data[cur_ix_masked]);
- uint32_t* forest = FN(Forest)(self);
- size_t prev_ix = self->buckets_[key];
+ uint32_t* BROTLI_RESTRICT buckets = self->buckets_;
+ uint32_t* BROTLI_RESTRICT forest = self->forest_;
+ size_t prev_ix = buckets[key];
/* The forest index of the rightmost node of the left subtree of the new
root, updated as we traverse and re-root the tree of the hash bucket. */
size_t node_left = FN(LeftChildIndex)(self, cur_ix);
@@ -139,7 +138,7 @@ static BROTLI_INLINE BackwardMatch* FN(StoreAndFindMatches)(
size_t best_len_right = 0;
size_t depth_remaining;
if (should_reroot_tree) {
- self->buckets_[key] = (uint32_t)cur_ix;
+ buckets[key] = (uint32_t)cur_ix;
}
for (depth_remaining = MAX_TREE_SEARCH_DEPTH; ; --depth_remaining) {
const size_t backward = cur_ix - prev_ix;
@@ -199,11 +198,13 @@ static BROTLI_INLINE BackwardMatch* FN(StoreAndFindMatches)(
matches in matches[0] to matches[*num_matches - 1]. The matches will be
sorted by strictly increasing length and (non-strictly) increasing
distance. */
-static BROTLI_INLINE size_t FN(FindAllMatches)(HasherHandle handle,
- const BrotliEncoderDictionary* dictionary, const uint8_t* data,
+static BROTLI_INLINE size_t FN(FindAllMatches)(
+ HashToBinaryTree* BROTLI_RESTRICT self,
+ const BrotliEncoderDictionary* dictionary,
+ const uint8_t* BROTLI_RESTRICT data,
const size_t ring_buffer_mask, const size_t cur_ix,
const size_t max_length, const size_t max_backward,
- const size_t gap, const BrotliEncoderParams* params,
+ const size_t dictionary_distance, const BrotliEncoderParams* params,
BackwardMatch* matches) {
BackwardMatch* const orig_matches = matches;
const size_t cur_ix_masked = cur_ix & ring_buffer_mask;
@@ -236,7 +237,7 @@ static BROTLI_INLINE size_t FN(FindAllMatches)(HasherHandle handle,
}
}
if (best_len < max_length) {
- matches = FN(StoreAndFindMatches)(FN(Self)(handle), data, cur_ix,
+ matches = FN(StoreAndFindMatches)(self, data, cur_ix,
ring_buffer_mask, max_length, max_backward, &best_len, matches);
}
for (i = 0; i <= BROTLI_MAX_STATIC_DICTIONARY_MATCH_LEN; ++i) {
@@ -252,7 +253,7 @@ static BROTLI_INLINE size_t FN(FindAllMatches)(HasherHandle handle,
for (l = minlen; l <= maxlen; ++l) {
uint32_t dict_id = dict_matches[l];
if (dict_id < kInvalidMatch) {
- size_t distance = max_backward + gap + (dict_id >> 5) + 1;
+ size_t distance = dictionary_distance + (dict_id >> 5) + 1;
if (distance <= params->dist.max_distance) {
InitDictionaryBackwardMatch(matches++, distance, l, dict_id & 31);
}
@@ -266,18 +267,18 @@ static BROTLI_INLINE size_t FN(FindAllMatches)(HasherHandle handle,
/* Stores the hash of the next 4 bytes and re-roots the binary tree at the
current sequence, without returning any matches.
REQUIRES: ix + MAX_TREE_COMP_LENGTH <= end-of-current-block */
-static BROTLI_INLINE void FN(Store)(HasherHandle handle, const uint8_t* data,
+static BROTLI_INLINE void FN(Store)(HashToBinaryTree* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data,
const size_t mask, const size_t ix) {
- HashToBinaryTree* self = FN(Self)(handle);
/* Maximum distance is window size - 16, see section 9.1. of the spec. */
const size_t max_backward = self->window_mask_ - BROTLI_WINDOW_GAP + 1;
FN(StoreAndFindMatches)(self, data, ix, mask, MAX_TREE_COMP_LENGTH,
max_backward, NULL, NULL);
}
-static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
- const uint8_t* data, const size_t mask, const size_t ix_start,
- const size_t ix_end) {
+static BROTLI_INLINE void FN(StoreRange)(HashToBinaryTree* BROTLI_RESTRICT self,
+ const uint8_t* BROTLI_RESTRICT data, const size_t mask,
+ const size_t ix_start, const size_t ix_end) {
size_t i = ix_start;
size_t j = ix_start;
if (ix_start + 63 <= ix_end) {
@@ -285,18 +286,18 @@ static BROTLI_INLINE void FN(StoreRange)(HasherHandle handle,
}
if (ix_start + 512 <= i) {
for (; j < i; j += 8) {
- FN(Store)(handle, data, mask, j);
+ FN(Store)(self, data, mask, j);
}
}
for (; i < ix_end; ++i) {
- FN(Store)(handle, data, mask, i);
+ FN(Store)(self, data, mask, i);
}
}
-static BROTLI_INLINE void FN(StitchToPreviousBlock)(HasherHandle handle,
+static BROTLI_INLINE void FN(StitchToPreviousBlock)(
+ HashToBinaryTree* BROTLI_RESTRICT self,
size_t num_bytes, size_t position, const uint8_t* ringbuffer,
size_t ringbuffer_mask) {
- HashToBinaryTree* self = FN(Self)(handle);
if (num_bytes >= FN(HashTypeLength)() - 1 &&
position >= MAX_TREE_COMP_LENGTH) {
/* Store the last `MAX_TREE_COMP_LENGTH - 1` positions in the hasher.
diff --git a/c/enc/memory.h b/c/enc/memory.h
index ab928d0..832e7b2 100644
--- a/c/enc/memory.h
+++ b/c/enc/memory.h
@@ -56,6 +56,18 @@ BROTLI_INTERNAL void BrotliFree(MemoryManager* m, void* p);
#define BROTLI_IS_OOM(M) (!!(M)->is_oom)
#endif /* BROTLI_ENCODER_EXIT_ON_OOM */
+/*
+BROTLI_IS_NULL is a fake check, BROTLI_IS_OOM does the heavy lifting.
+The only purpose of it is to explain static analyzers the state of things.
+NB: use ONLY together with BROTLI_IS_OOM
+ AND ONLY for allocations in the current scope.
+ */
+#if defined(__clang_analyzer__) && !defined(BROTLI_ENCODER_EXIT_ON_OOM)
+#define BROTLI_IS_NULL(A) ((A) == nullptr)
+#else /* defined(__clang_analyzer__) */
+#define BROTLI_IS_NULL(A) (!!0)
+#endif /* defined(__clang_analyzer__) */
+
BROTLI_INTERNAL void BrotliWipeOutMemoryManager(MemoryManager* m);
/*
@@ -66,18 +78,18 @@ A: array
C: capacity
R: requested size
*/
-#define BROTLI_ENSURE_CAPACITY(M, T, A, C, R) { \
- if (C < (R)) { \
- size_t _new_size = (C == 0) ? (R) : C; \
- T* new_array; \
- while (_new_size < (R)) _new_size *= 2; \
- new_array = BROTLI_ALLOC((M), T, _new_size); \
- if (!BROTLI_IS_OOM(M) && C != 0) \
- memcpy(new_array, A, C * sizeof(T)); \
- BROTLI_FREE((M), A); \
- A = new_array; \
- C = _new_size; \
- } \
+#define BROTLI_ENSURE_CAPACITY(M, T, A, C, R) { \
+ if (C < (R)) { \
+ size_t _new_size = (C == 0) ? (R) : C; \
+ T* new_array; \
+ while (_new_size < (R)) _new_size *= 2; \
+ new_array = BROTLI_ALLOC((M), T, _new_size); \
+ if (!BROTLI_IS_OOM(M) && !BROTLI_IS_NULL(new_array) && C != 0) \
+ memcpy(new_array, A, C * sizeof(T)); \
+ BROTLI_FREE((M), A); \
+ A = new_array; \
+ C = _new_size; \
+ } \
}
/*
diff --git a/c/enc/metablock.c b/c/enc/metablock.c
index 4e80044..5aa4d4f 100644
--- a/c/enc/metablock.c
+++ b/c/enc/metablock.c
@@ -28,34 +28,30 @@ extern "C" {
void BrotliInitDistanceParams(BrotliEncoderParams* params,
uint32_t npostfix, uint32_t ndirect) {
BrotliDistanceParams* dist_params = &params->dist;
- uint32_t alphabet_size, max_distance;
+ uint32_t alphabet_size_max;
+ uint32_t alphabet_size_limit;
+ uint32_t max_distance;
dist_params->distance_postfix_bits = npostfix;
dist_params->num_direct_distance_codes = ndirect;
- alphabet_size = BROTLI_DISTANCE_ALPHABET_SIZE(
+ alphabet_size_max = BROTLI_DISTANCE_ALPHABET_SIZE(
npostfix, ndirect, BROTLI_MAX_DISTANCE_BITS);
+ alphabet_size_limit = alphabet_size_max;
max_distance = ndirect + (1U << (BROTLI_MAX_DISTANCE_BITS + npostfix + 2)) -
(1U << (npostfix + 2));
if (params->large_window) {
- static const uint32_t bound[BROTLI_MAX_NPOSTFIX + 1] = {0, 4, 12, 28};
- uint32_t postfix = 1U << npostfix;
- alphabet_size = BROTLI_DISTANCE_ALPHABET_SIZE(
+ BrotliDistanceCodeLimit limit = BrotliCalculateDistanceCodeLimit(
+ BROTLI_MAX_ALLOWED_DISTANCE, npostfix, ndirect);
+ alphabet_size_max = BROTLI_DISTANCE_ALPHABET_SIZE(
npostfix, ndirect, BROTLI_LARGE_MAX_DISTANCE_BITS);
- /* The maximum distance is set so that no distance symbol used can encode
- a distance larger than BROTLI_MAX_ALLOWED_DISTANCE with all
- its extra bits set. */
- if (ndirect < bound[npostfix]) {
- max_distance = BROTLI_MAX_ALLOWED_DISTANCE - (bound[npostfix] - ndirect);
- } else if (ndirect >= bound[npostfix] + postfix) {
- max_distance = (3U << 29) - 4 + (ndirect - bound[npostfix]);
- } else {
- max_distance = BROTLI_MAX_ALLOWED_DISTANCE;
- }
+ alphabet_size_limit = limit.max_alphabet_size;
+ max_distance = limit.max_distance;
}
- dist_params->alphabet_size = alphabet_size;
+ dist_params->alphabet_size_max = alphabet_size_max;
+ dist_params->alphabet_size_limit = alphabet_size_limit;
dist_params->max_distance = max_distance;
}
@@ -200,7 +196,7 @@ void BrotliBuildMetaBlock(MemoryManager* m,
literal_context_multiplier = 1 << BROTLI_LITERAL_CONTEXT_BITS;
literal_context_modes =
BROTLI_ALLOC(m, ContextType, mb->literal_split.num_types);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(literal_context_modes)) return;
for (i = 0; i < mb->literal_split.num_types; ++i) {
literal_context_modes[i] = literal_context_mode;
}
@@ -210,21 +206,21 @@ void BrotliBuildMetaBlock(MemoryManager* m,
mb->literal_split.num_types * literal_context_multiplier;
literal_histograms =
BROTLI_ALLOC(m, HistogramLiteral, literal_histograms_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(literal_histograms)) return;
ClearHistogramsLiteral(literal_histograms, literal_histograms_size);
distance_histograms_size =
mb->distance_split.num_types << BROTLI_DISTANCE_CONTEXT_BITS;
distance_histograms =
BROTLI_ALLOC(m, HistogramDistance, distance_histograms_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(distance_histograms)) return;
ClearHistogramsDistance(distance_histograms, distance_histograms_size);
BROTLI_DCHECK(mb->command_histograms == 0);
mb->command_histograms_size = mb->command_split.num_types;
mb->command_histograms =
BROTLI_ALLOC(m, HistogramCommand, mb->command_histograms_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->command_histograms)) return;
ClearHistogramsCommand(mb->command_histograms, mb->command_histograms_size);
BrotliBuildHistogramsWithContext(cmds, num_commands,
@@ -238,13 +234,13 @@ void BrotliBuildMetaBlock(MemoryManager* m,
mb->literal_split.num_types << BROTLI_LITERAL_CONTEXT_BITS;
mb->literal_context_map =
BROTLI_ALLOC(m, uint32_t, mb->literal_context_map_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->literal_context_map)) return;
BROTLI_DCHECK(mb->literal_histograms == 0);
mb->literal_histograms_size = mb->literal_context_map_size;
mb->literal_histograms =
BROTLI_ALLOC(m, HistogramLiteral, mb->literal_histograms_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->literal_histograms)) return;
BrotliClusterHistogramsLiteral(m, literal_histograms, literal_histograms_size,
kMaxNumberOfHistograms, mb->literal_histograms,
@@ -269,13 +265,13 @@ void BrotliBuildMetaBlock(MemoryManager* m,
mb->distance_split.num_types << BROTLI_DISTANCE_CONTEXT_BITS;
mb->distance_context_map =
BROTLI_ALLOC(m, uint32_t, mb->distance_context_map_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->distance_context_map)) return;
BROTLI_DCHECK(mb->distance_histograms == 0);
mb->distance_histograms_size = mb->distance_context_map_size;
mb->distance_histograms =
BROTLI_ALLOC(m, HistogramDistance, mb->distance_histograms_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->distance_histograms)) return;
BrotliClusterHistogramsDistance(m, distance_histograms,
mb->distance_context_map_size,
@@ -373,7 +369,7 @@ static void InitContextBlockSplitter(
*histograms_size = max_num_types * num_contexts;
*histograms = BROTLI_ALLOC(m, HistogramLiteral, *histograms_size);
self->histograms_ = *histograms;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(*histograms)) return;
/* Clear only current histogram. */
ClearHistogramsLiteral(&self->histograms_[0], num_contexts);
self->last_histogram_ix_[0] = self->last_histogram_ix_[1] = 0;
@@ -423,7 +419,7 @@ static void ContextBlockSplitterFinishBlock(
double combined_entropy[2 * BROTLI_MAX_STATIC_CONTEXTS];
double diff[2] = { 0.0 };
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(combined_histo)) return;
for (i = 0; i < num_contexts; ++i) {
size_t curr_histo_ix = self->curr_histogram_ix_ + i;
size_t j;
@@ -527,7 +523,7 @@ static void MapStaticContexts(MemoryManager* m,
mb->literal_split.num_types << BROTLI_LITERAL_CONTEXT_BITS;
mb->literal_context_map =
BROTLI_ALLOC(m, uint32_t, mb->literal_context_map_size);
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(mb->literal_context_map)) return;
for (i = 0; i < mb->literal_split.num_types; ++i) {
uint32_t offset = (uint32_t)(i * num_contexts);
diff --git a/c/enc/metablock_inc.h b/c/enc/metablock_inc.h
index dcc9d3c..ed507ef 100644
--- a/c/enc/metablock_inc.h
+++ b/c/enc/metablock_inc.h
@@ -71,7 +71,7 @@ static void FN(InitBlockSplitter)(
*histograms_size = max_num_types;
*histograms = BROTLI_ALLOC(m, HistogramType, *histograms_size);
self->histograms_ = *histograms;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(*histograms)) return;
/* Clear only current histogram. */
FN(HistogramClear)(&self->histograms_[0]);
self->last_histogram_ix_[0] = self->last_histogram_ix_[1] = 0;
diff --git a/c/enc/params.h b/c/enc/params.h
index 6ecf1d3..54a7f00 100755..100644
--- a/c/enc/params.h
+++ b/c/enc/params.h
@@ -23,7 +23,8 @@ typedef struct BrotliHasherParams {
typedef struct BrotliDistanceParams {
uint32_t distance_postfix_bits;
uint32_t num_direct_distance_codes;
- uint32_t alphabet_size;
+ uint32_t alphabet_size_max;
+ uint32_t alphabet_size_limit;
size_t max_distance;
} BrotliDistanceParams;
@@ -33,6 +34,7 @@ typedef struct BrotliEncoderParams {
int quality;
int lgwin;
int lgblock;
+ size_t stream_offset;
size_t size_hint;
BROTLI_BOOL disable_literal_context_modeling;
BROTLI_BOOL large_window;
diff --git a/c/enc/ringbuffer.h b/c/enc/ringbuffer.h
index 86079a8..8dce148 100644
--- a/c/enc/ringbuffer.h
+++ b/c/enc/ringbuffer.h
@@ -75,7 +75,7 @@ static BROTLI_INLINE void RingBufferInitBuffer(
uint8_t* new_data = BROTLI_ALLOC(
m, uint8_t, 2 + buflen + kSlackForEightByteHashingEverywhere);
size_t i;
- if (BROTLI_IS_OOM(m)) return;
+ if (BROTLI_IS_OOM(m) || BROTLI_IS_NULL(new_data)) return;
if (rb->data_) {
memcpy(new_data, rb->data_,
2 + rb->cur_size_ + kSlackForEightByteHashingEverywhere);
@@ -125,6 +125,9 @@ static BROTLI_INLINE void RingBufferWrite(
later when we copy the last two bytes to the first two positions. */
rb->buffer_[rb->size_ - 2] = 0;
rb->buffer_[rb->size_ - 1] = 0;
+ /* Initialize tail; might be touched by "best_len++" optimization when
+ ring buffer is "full". */
+ rb->buffer_[rb->size_] = 241;
}
{
const size_t masked_pos = rb->pos_ & rb->mask_;
diff --git a/c/enc/utf8_util.c b/c/enc/utf8_util.c
index 04a7805..e802b6a 100644
--- a/c/enc/utf8_util.c
+++ b/c/enc/utf8_util.c
@@ -77,7 +77,7 @@ BROTLI_BOOL BrotliIsMostlyUTF8(
i += bytes_read;
if (symbol < 0x110000) size_utf8 += bytes_read;
}
- return TO_BROTLI_BOOL(size_utf8 > min_fraction * (double)length);
+ return TO_BROTLI_BOOL((double)size_utf8 > min_fraction * (double)length);
}
#if defined(__cplusplus) || defined(c_plusplus)
diff --git a/c/enc/write_bits.h b/c/enc/write_bits.h
index 36515a6..f6f88b4 100644
--- a/c/enc/write_bits.h
+++ b/c/enc/write_bits.h
@@ -16,8 +16,6 @@
extern "C" {
#endif
-/*#define BIT_WRITER_DEBUG */
-
/* This function writes bits into bytes in increasing addresses, and within
a byte least-significant-bit first.
@@ -28,7 +26,7 @@ extern "C" {
0000 0RRR 0000 0000 0000 0000
- Now, we could write 5 or less bits in MSB by just sifting by 3
+ Now, we could write 5 or less bits in MSB by just shifting by 3
and OR'ing to BYTE-0.
For n bits, we take the last 5 bits, OR that with high bits in BYTE-0,
@@ -37,37 +35,41 @@ static BROTLI_INLINE void BrotliWriteBits(size_t n_bits,
uint64_t bits,
size_t* BROTLI_RESTRICT pos,
uint8_t* BROTLI_RESTRICT array) {
+ BROTLI_LOG(("WriteBits %2d 0x%08x%08x %10d\n", (int)n_bits,
+ (uint32_t)(bits >> 32), (uint32_t)(bits & 0xFFFFFFFF),
+ (int)*pos));
+ BROTLI_DCHECK((bits >> n_bits) == 0);
+ BROTLI_DCHECK(n_bits <= 56);
#if defined(BROTLI_LITTLE_ENDIAN)
/* This branch of the code can write up to 56 bits at a time,
7 bits are lost by being perhaps already in *p and at least
1 bit is needed to initialize the bit-stream ahead (i.e. if 7
bits are in *p and we write 57 bits, then the next write will
access a byte that was never initialized). */
- uint8_t* p = &array[*pos >> 3];
- uint64_t v = (uint64_t)(*p); /* Zero-extend 8 to 64 bits. */
- BROTLI_LOG(("WriteBits %2d 0x%08x%08x %10d\n", (int)n_bits,
- (uint32_t)(bits >> 32), (uint32_t)(bits & 0xFFFFFFFF),
- (int)*pos));
- BROTLI_DCHECK((bits >> n_bits) == 0);
- BROTLI_DCHECK(n_bits <= 56);
- v |= bits << (*pos & 7);
- BROTLI_UNALIGNED_STORE64LE(p, v); /* Set some bits. */
- *pos += n_bits;
+ {
+ uint8_t* p = &array[*pos >> 3];
+ uint64_t v = (uint64_t)(*p); /* Zero-extend 8 to 64 bits. */
+ v |= bits << (*pos & 7);
+ BROTLI_UNALIGNED_STORE64LE(p, v); /* Set some bits. */
+ *pos += n_bits;
+ }
#else
/* implicit & 0xFF is assumed for uint8_t arithmetics */
- uint8_t* array_pos = &array[*pos >> 3];
- const size_t bits_reserved_in_first_byte = (*pos & 7);
- size_t bits_left_to_write;
- bits <<= bits_reserved_in_first_byte;
- *array_pos++ |= (uint8_t)bits;
- for (bits_left_to_write = n_bits + bits_reserved_in_first_byte;
- bits_left_to_write >= 9;
- bits_left_to_write -= 8) {
- bits >>= 8;
- *array_pos++ = (uint8_t)bits;
+ {
+ uint8_t* array_pos = &array[*pos >> 3];
+ const size_t bits_reserved_in_first_byte = (*pos & 7);
+ size_t bits_left_to_write;
+ bits <<= bits_reserved_in_first_byte;
+ *array_pos++ |= (uint8_t)bits;
+ for (bits_left_to_write = n_bits + bits_reserved_in_first_byte;
+ bits_left_to_write >= 9;
+ bits_left_to_write -= 8) {
+ bits >>= 8;
+ *array_pos++ = (uint8_t)bits;
+ }
+ *array_pos = 0;
+ *pos += n_bits;
}
- *array_pos = 0;
- *pos += n_bits;
#endif
}
diff --git a/c/include/brotli/encode.h b/c/include/brotli/encode.h
index 0ced7e5..b2774cb 100644
--- a/c/include/brotli/encode.h
+++ b/c/include/brotli/encode.h
@@ -201,7 +201,23 @@ typedef enum BrotliEncoderParameter {
*
* Range is from 0 to (15 << NPOSTFIX) in steps of (1 << NPOSTFIX).
*/
- BROTLI_PARAM_NDIRECT = 8
+ BROTLI_PARAM_NDIRECT = 8,
+ /**
+ * Number of bytes of input stream already processed by a different instance.
+ *
+ * @note It is important to configure all the encoder instances with same
+ * parameters (except this one) in order to allow all the encoded parts
+ * obey the same restrictions implied by header.
+ *
+ * If offset is not 0, then stream header is omitted.
+ * In any case output start is byte aligned, so for proper streams stitching
+ * "predecessor" stream must be flushed.
+ *
+ * Range is not artificially limited, but all the values greater or equal to
+ * maximal window size have the same effect. Values greater than 2**30 are not
+ * allowed.
+ */
+ BROTLI_PARAM_STREAM_OFFSET = 9
} BrotliEncoderParameter;
/**
@@ -274,6 +290,11 @@ BROTLI_ENC_API size_t BrotliEncoderMaxCompressedSize(size_t input_size);
* @note If ::BrotliEncoderMaxCompressedSize(@p input_size) returns non-zero
* value, then output is guaranteed to be no longer than that.
*
+ * @note If @p lgwin is greater than ::BROTLI_MAX_WINDOW_BITS then resulting
+ * stream might be incompatible with RFC 7932; to decode such streams,
+ * decoder should be configured with
+ * ::BROTLI_DECODER_PARAM_LARGE_WINDOW = @c 1
+ *
* @param quality quality parameter value, e.g. ::BROTLI_DEFAULT_QUALITY
* @param lgwin lgwin parameter value, e.g. ::BROTLI_DEFAULT_WINDOW
* @param mode mode parameter value, e.g. ::BROTLI_DEFAULT_MODE
diff --git a/c/include/brotli/port.h b/c/include/brotli/port.h
index 20dc231..825237a 100644
--- a/c/include/brotli/port.h
+++ b/c/include/brotli/port.h
@@ -218,6 +218,20 @@
BROTLI_GNUC_VERSION_CHECK(major, minor, patch)
#endif
+#if defined(__has_feature)
+#define BROTLI_HAS_FEATURE(feature) __has_feature(feature)
+#else
+#define BROTLI_HAS_FEATURE(feature) (0)
+#endif
+
+#if defined(ADDRESS_SANITIZER) || BROTLI_HAS_FEATURE(address_sanitizer) || \
+ defined(THREAD_SANITIZER) || BROTLI_HAS_FEATURE(thread_sanitizer) || \
+ defined(MEMORY_SANITIZER) || BROTLI_HAS_FEATURE(memory_sanitizer)
+#define BROTLI_SANITIZED 1
+#else
+#define BROTLI_SANITIZED 0
+#endif
+
#if defined(_WIN32) || defined(__CYGWIN__)
#define BROTLI_PUBLIC
#elif BROTLI_GNUC_VERSION_CHECK(3, 3, 0) || \
diff --git a/c/tools/brotli.c b/c/tools/brotli.c
index ce05b64..7c678d3 100644
--- a/c/tools/brotli.c
+++ b/c/tools/brotli.c
@@ -6,6 +6,11 @@
/* Command line interface for Brotli library. */
+/* Mute strerror/strcpy warnings. */
+#if !defined(_CRT_SECURE_NO_WARNINGS)
+#define _CRT_SECURE_NO_WARNINGS
+#endif
+
#include <errno.h>
#include <fcntl.h>
#include <stdio.h>
@@ -86,10 +91,10 @@ typedef struct {
/* Parameters */
int quality;
int lgwin;
+ int verbosity;
BROTLI_BOOL force_overwrite;
BROTLI_BOOL junk_source;
BROTLI_BOOL copy_stat;
- BROTLI_BOOL verbose;
BROTLI_BOOL write_to_stdout;
BROTLI_BOOL test_integrity;
BROTLI_BOOL decompress;
@@ -121,6 +126,12 @@ typedef struct {
const uint8_t* next_in;
size_t available_out;
uint8_t* next_out;
+
+ /* Reporting */
+ /* size_t would be large enough,
+ until 4GiB+ files are compressed / decompressed on 32-bit CPUs. */
+ size_t total_in;
+ size_t total_out;
} Context;
/* Parse up to 5 decimal digits. */
@@ -257,7 +268,7 @@ static Command ParseParams(Context* params) {
return COMMAND_HELP;
} else if (c == 'j' || c == 'k') {
if (keep_set) {
- fprintf(stderr, "argument --rm / -j or --keep / -n already set\n");
+ fprintf(stderr, "argument --rm / -j or --keep / -k already set\n");
return COMMAND_INVALID;
}
keep_set = BROTLI_TRUE;
@@ -279,11 +290,11 @@ static Command ParseParams(Context* params) {
command = COMMAND_TEST_INTEGRITY;
continue;
} else if (c == 'v') {
- if (params->verbose) {
+ if (params->verbosity > 0) {
fprintf(stderr, "argument --verbose / -v already set\n");
return COMMAND_INVALID;
}
- params->verbose = BROTLI_TRUE;
+ params->verbosity = 1;
continue;
} else if (c == 'V') {
/* Don't parse further. */
@@ -382,7 +393,7 @@ static Command ParseParams(Context* params) {
return COMMAND_HELP;
} else if (strcmp("keep", arg) == 0) {
if (keep_set) {
- fprintf(stderr, "argument --rm / -j or --keep / -n already set\n");
+ fprintf(stderr, "argument --rm / -j or --keep / -k already set\n");
return COMMAND_INVALID;
}
keep_set = BROTLI_TRUE;
@@ -395,7 +406,7 @@ static Command ParseParams(Context* params) {
params->copy_stat = BROTLI_FALSE;
} else if (strcmp("rm", arg) == 0) {
if (keep_set) {
- fprintf(stderr, "argument --rm / -j or --keep / -n already set\n");
+ fprintf(stderr, "argument --rm / -j or --keep / -k already set\n");
return COMMAND_INVALID;
}
keep_set = BROTLI_TRUE;
@@ -415,11 +426,11 @@ static Command ParseParams(Context* params) {
command_set = BROTLI_TRUE;
command = COMMAND_TEST_INTEGRITY;
} else if (strcmp("verbose", arg) == 0) {
- if (params->verbose) {
+ if (params->verbosity > 0) {
fprintf(stderr, "argument --verbose / -v already set\n");
return COMMAND_INVALID;
}
- params->verbose = BROTLI_TRUE;
+ params->verbosity = 1;
} else if (strcmp("version", arg) == 0) {
/* Don't parse further. */
return COMMAND_VERSION;
@@ -550,11 +561,17 @@ static void PrintHelp(const char* name, BROTLI_BOOL error) {
" -t, --test test compressed file integrity\n"
" -v, --verbose verbose mode\n");
fprintf(media,
-" -w NUM, --lgwin=NUM set LZ77 window size (0, %d-%d)\n",
+" -w NUM, --lgwin=NUM set LZ77 window size (0, %d-%d)\n"
+" window size = 2**NUM - 16\n"
+" 0 lets compressor choose the optimal value\n",
BROTLI_MIN_WINDOW_BITS, BROTLI_MAX_WINDOW_BITS);
fprintf(media,
-" window size = 2**NUM - 16\n"
-" 0 lets compressor choose the optimal value\n");
+" --large_window=NUM use incompatible large-window brotli\n"
+" bitstream with window size (0, %d-%d)\n"
+" WARNING: this format is not compatible\n"
+" with brotli RFC 7932 and may not be\n"
+" decodable with regular brotli decoders\n",
+ BROTLI_MIN_WINDOW_BITS, BROTLI_LARGE_MAX_WINDOW_BITS);
fprintf(media,
" -S SUF, --suffix=SUF output file suffix (default:'%s')\n",
DEFAULT_SUFFIX);
@@ -787,8 +804,12 @@ static void InitializeBuffers(Context* context) {
context->next_in = NULL;
context->available_out = kFileBufferSize;
context->next_out = context->output;
+ context->total_in = 0;
+ context->total_out = 0;
}
+/* This method might give the false-negative result.
+ However, after an empty / incomplete read it should tell the truth. */
static BROTLI_BOOL HasMoreInput(Context* context) {
return feof(context->fin) ? BROTLI_FALSE : BROTLI_TRUE;
}
@@ -796,6 +817,7 @@ static BROTLI_BOOL HasMoreInput(Context* context) {
static BROTLI_BOOL ProvideInput(Context* context) {
context->available_in =
fread(context->input, 1, kFileBufferSize, context->fin);
+ context->total_in += context->available_in;
context->next_in = context->input;
if (ferror(context->fin)) {
fprintf(stderr, "failed to read input [%s]: %s\n",
@@ -808,6 +830,7 @@ static BROTLI_BOOL ProvideInput(Context* context) {
/* Internal: should be used only in Provide-/Flush-Output. */
static BROTLI_BOOL WriteOutput(Context* context) {
size_t out_size = (size_t)(context->next_out - context->output);
+ context->total_out += out_size;
if (out_size == 0) return BROTLI_TRUE;
if (context->test_integrity) return BROTLI_TRUE;
@@ -833,6 +856,25 @@ static BROTLI_BOOL FlushOutput(Context* context) {
return BROTLI_TRUE;
}
+static void PrintBytes(size_t value) {
+ if (value < 1024) {
+ fprintf(stderr, "%d B", (int)value);
+ } else if (value < 1048576) {
+ fprintf(stderr, "%0.3f KiB", (double)value / 1024.0);
+ } else if (value < 1073741824) {
+ fprintf(stderr, "%0.3f MiB", (double)value / 1048576.0);
+ } else {
+ fprintf(stderr, "%0.3f GiB", (double)value / 1073741824.0);
+ }
+}
+
+static void PrintFileProcessingProgress(Context* context) {
+ fprintf(stderr, "[%s]: ", PrintablePath(context->current_input_path));
+ PrintBytes(context->total_in);
+ fprintf(stderr, " -> ");
+ PrintBytes(context->total_out);
+}
+
static BROTLI_BOOL DecompressFile(Context* context, BrotliDecoderState* s) {
BrotliDecoderResult result = BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT;
InitializeBuffers(context);
@@ -848,11 +890,18 @@ static BROTLI_BOOL DecompressFile(Context* context, BrotliDecoderState* s) {
if (!ProvideOutput(context)) return BROTLI_FALSE;
} else if (result == BROTLI_DECODER_RESULT_SUCCESS) {
if (!FlushOutput(context)) return BROTLI_FALSE;
- if (context->available_in != 0 || HasMoreInput(context)) {
+ int has_more_input =
+ (context->available_in != 0) || (fgetc(context->fin) != EOF);
+ if (has_more_input) {
fprintf(stderr, "corrupt input [%s]\n",
PrintablePath(context->current_input_path));
return BROTLI_FALSE;
}
+ if (context->verbosity > 0) {
+ fprintf(stderr, "Decompressed ");
+ PrintFileProcessingProgress(context);
+ fprintf(stderr, "\n");
+ }
return BROTLI_TRUE;
} else {
fprintf(stderr, "corrupt input [%s]\n",
@@ -915,7 +964,13 @@ static BROTLI_BOOL CompressFile(Context* context, BrotliEncoderState* s) {
}
if (BrotliEncoderIsFinished(s)) {
- return FlushOutput(context);
+ if (!FlushOutput(context)) return BROTLI_FALSE;
+ if (context->verbosity > 0) {
+ fprintf(stderr, "Compressed ");
+ PrintFileProcessingProgress(context);
+ fprintf(stderr, "\n");
+ }
+ return BROTLI_TRUE;
}
}
}
@@ -979,11 +1034,11 @@ int main(int argc, char** argv) {
context.quality = 11;
context.lgwin = -1;
+ context.verbosity = 0;
context.force_overwrite = BROTLI_FALSE;
context.junk_source = BROTLI_FALSE;
context.copy_stat = BROTLI_TRUE;
context.test_integrity = BROTLI_FALSE;
- context.verbose = BROTLI_FALSE;
context.write_to_stdout = BROTLI_FALSE;
context.decompress = BROTLI_FALSE;
context.large_window = BROTLI_FALSE;
diff --git a/compiler_config_setting.bzl b/compiler_config_setting.bzl
new file mode 100644
index 0000000..572032b
--- /dev/null
+++ b/compiler_config_setting.bzl
@@ -0,0 +1,28 @@
+# Copyright 2018 Google Inc. All Rights Reserved.
+#
+# Distributed under MIT license.
+# See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+
+"""Creates config_setting that allows selecting based on 'compiler' value."""
+
+def create_msvc_config():
+ # The "do_not_use_tools_cpp_compiler_present" attribute exists to
+ # distinguish between older versions of Bazel that do not support
+ # "@bazel_tools//tools/cpp:compiler" flag_value, and newer ones that do.
+ # In the future, the only way to select on the compiler will be through
+ # flag_values{"@bazel_tools//tools/cpp:compiler"} and the else branch can
+ # be removed.
+ if hasattr(cc_common, "do_not_use_tools_cpp_compiler_present"):
+ native.config_setting(
+ name = "msvc",
+ flag_values = {
+ "@bazel_tools//tools/cpp:compiler": "msvc-cl",
+ },
+ visibility = ["//visibility:public"],
+ )
+ else:
+ native.config_setting(
+ name = "msvc",
+ values = {"compiler": "msvc-cl"},
+ visibility = ["//visibility:public"],
+ )
diff --git a/docs/constants.h.3 b/docs/constants.h.3
new file mode 100644
index 0000000..edf071c
--- /dev/null
+++ b/docs/constants.h.3
@@ -0,0 +1,47 @@
+.TH "constants.h" 3 "Wed May 13 2020" "Brotli" \" -*- nroff -*-
+.ad l
+.nh
+.SH NAME
+constants.h \- Common constants used in decoder and encoder API\&.
+
+.SH SYNOPSIS
+.br
+.PP
+.SS "Macros"
+
+.in +1c
+.ti -1c
+.RI "#define \fBBROTLI_LARGE_MAX_DISTANCE_BITS\fP 62U"
+.br
+.RI "\fIThe theoretical maximum number of distance bits specified for large window brotli, for 64-bit encoders and decoders\&. \fP"
+.ti -1c
+.RI "#define \fBBROTLI_LARGE_MAX_WBITS\fP 30"
+.br
+.RI "\fIThe maximum supported large brotli window bits by the encoder and decoder\&. \fP"
+.ti -1c
+.RI "#define \fBBROTLI_MAX_NPOSTFIX\fP 3"
+.br
+.RI "\fIMaximal number of 'postfix' bits\&. \fP"
+.in -1c
+.SH "Detailed Description"
+.PP
+Common constants used in decoder and encoder API\&.
+
+
+.SH "Macro Definition Documentation"
+.PP
+.SS "#define BROTLI_LARGE_MAX_DISTANCE_BITS 62U"
+
+.PP
+The theoretical maximum number of distance bits specified for large window brotli, for 64-bit encoders and decoders\&. Even when in practice 32-bit encoders and decoders only support up to 30 max distance bits, the value is set to 62 because it affects the large window brotli file format\&. Specifically, it affects the encoding of simple huffman tree for distances, see Specification RFC 7932 chapter 3\&.4\&.
+.SS "#define BROTLI_LARGE_MAX_WBITS 30"
+
+.PP
+The maximum supported large brotli window bits by the encoder and decoder\&. Large window brotli allows up to 62 bits, however the current encoder and decoder, designed for 32-bit integers, only support up to 30 bits maximum\&.
+.SS "#define BROTLI_MAX_NPOSTFIX 3"
+
+.PP
+Maximal number of 'postfix' bits\&. Number of 'postfix' bits is stored as 2 bits in meta-block header\&.
+.SH "Author"
+.PP
+Generated automatically by Doxygen for Brotli from the source code\&.
diff --git a/docs/encode.h.3 b/docs/encode.h.3
index eff57bd..0cab816 100644
--- a/docs/encode.h.3
+++ b/docs/encode.h.3
@@ -298,12 +298,24 @@ Flag that determines if 'Large Window Brotli' is used\&.
\fB\fIBROTLI_PARAM_NPOSTFIX \fP\fP
Recommended number of postfix bits (NPOSTFIX)\&. Encoder may change this value\&.
.PP
-Range is from 0 to ::BROTLI_MAX_NPOSTFIX\&.
+Range is from 0 to \fBBROTLI_MAX_NPOSTFIX\fP\&.
.TP
\fB\fIBROTLI_PARAM_NDIRECT \fP\fP
Recommended number of direct distance codes (NDIRECT)\&. Encoder may change this value\&.
.PP
Range is from 0 to (15 << NPOSTFIX) in steps of (1 << NPOSTFIX)\&.
+.TP
+\fB\fIBROTLI_PARAM_STREAM_OFFSET \fP\fP
+Number of bytes of input stream already processed by a different instance\&.
+.PP
+\fBNote:\fP
+.RS 4
+It is important to configure all the encoder instances with same parameters (except this one) in order to allow all the encoded parts obey the same restrictions implied by header\&.
+.RE
+.PP
+If offset is not 0, then stream header is omitted\&. In any case output start is byte aligned, so for proper streams stitching 'predecessor' stream must be flushed\&.
+.PP
+Range is not artificially limited, but all the values greater or equal to maximal window size have the same effect\&. Values greater than 2**30 are not allowed\&.
.SH "Function Documentation"
.PP
.SS "\fBBROTLI_BOOL\fP BrotliEncoderCompress (int quality, int lgwin, \fBBrotliEncoderMode\fP mode, size_t input_size, const uint8_t input_buffer[input_size], size_t * encoded_size, uint8_t encoded_buffer[*encoded_size])"
@@ -314,6 +326,8 @@ Performs one-shot memory-to-memory compression\&. Compresses the data in \fCinpu
\fBNote:\fP
.RS 4
If \fBBrotliEncoderMaxCompressedSize\fP(\fCinput_size\fP) returns non-zero value, then output is guaranteed to be no longer than that\&.
+.PP
+If \fClgwin\fP is greater than \fBBROTLI_MAX_WINDOW_BITS\fP then resulting stream might be incompatible with RFC 7932; to decode such streams, decoder should be configured with \fBBROTLI_DECODER_PARAM_LARGE_WINDOW\fP = \fC1\fP
.RE
.PP
\fBParameters:\fP
diff --git a/go/WORKSPACE b/go/WORKSPACE
index 8a88c7e..e965269 100644
--- a/go/WORKSPACE
+++ b/go/WORKSPACE
@@ -5,12 +5,17 @@ local_repository(
path = "..",
)
+load("@bazel_tools//tools/build_defs/repo:http.bzl", "http_archive")
+
http_archive(
name = "io_bazel_rules_go",
- urls = ["https://github.com/bazelbuild/rules_go/releases/download/0.12.0/rules_go-0.12.0.tar.gz"],
- sha256 = "c1f52b8789218bb1542ed362c4f7de7052abcf254d865d96fb7ba6d44bc15ee3",
+ urls = [
+ "https://storage.googleapis.com/bazel-mirror/github.com/bazelbuild/rules_go/releases/download/0.19.0/rules_go-0.19.0.tar.gz",
+ "https://github.com/bazelbuild/rules_go/releases/download/0.19.0/rules_go-0.19.0.tar.gz",
+ ],
+ sha256 = "9fb16af4d4836c8222142e54c9efa0bb5fc562ffc893ce2abeac3e25daead144",
)
-load("@io_bazel_rules_go//go:def.bzl", "go_rules_dependencies", "go_register_toolchains")
+load("@io_bazel_rules_go//go:deps.bzl", "go_rules_dependencies", "go_register_toolchains")
go_rules_dependencies()
go_register_toolchains()
diff --git a/go/cbrotli/cbrotli_test.go b/go/cbrotli/cbrotli_test.go
index f59ec58..36ad2ba 100644
--- a/go/cbrotli/cbrotli_test.go
+++ b/go/cbrotli/cbrotli_test.go
@@ -274,6 +274,10 @@ func TestReader(t *testing.T) {
"<%d bytes>",
got, len(content))
}
+ buf := make([]byte, 4)
+ if _, err := r.Read(buf); err != errReaderClosed {
+ t.Errorf("Read-after-Close returned %v, expected %v", err, errReaderClosed)
+ }
}
func TestDecode(t *testing.T) {
diff --git a/go/cbrotli/go.mod b/go/cbrotli/go.mod
new file mode 100644
index 0000000..cd8c859
--- /dev/null
+++ b/go/cbrotli/go.mod
@@ -0,0 +1 @@
+module github.com/google/brotli/go/cbrotli
diff --git a/go/cbrotli/reader.go b/go/cbrotli/reader.go
index 3d8d424..6e390c3 100644
--- a/go/cbrotli/reader.go
+++ b/go/cbrotli/reader.go
@@ -82,6 +82,9 @@ func (r *Reader) Close() error {
}
func (r *Reader) Read(p []byte) (n int, err error) {
+ if r.state == nil {
+ return 0, errReaderClosed
+ }
if int(C.BrotliDecoderHasMoreOutput(r.state)) == 0 && len(r.in) == 0 {
m, readErr := r.src.Read(r.buf)
if m == 0 {
diff --git a/java/BUILD b/java/BUILD
index f7dd0c0..cd55c54 100644
--- a/java/BUILD
+++ b/java/BUILD
@@ -36,6 +36,18 @@ cc_library(
# <<< JNI headers
+genrule(
+ name = "license_resource",
+ srcs = ["@org_brotli//:LICENSE"],
+ outs = ["META-INF/LICENSE"],
+ cmd = "cp -f $< $@",
+)
+
+java_library(
+ name = "license",
+ resources = [":license_resource"],
+)
+
########################################################
# WARNING: do not (transitively) depend on this target!
########################################################
diff --git a/java/WORKSPACE b/java/WORKSPACE
index 06fbdfe..6f9902a 100644
--- a/java/WORKSPACE
+++ b/java/WORKSPACE
@@ -5,12 +5,24 @@ local_repository(
path = "..",
)
-maven_jar(
- name = "junit_junit",
- artifact = "junit:junit:4.12",
+load("@bazel_tools//tools/build_defs/repo:http.bzl", "http_archive", "http_file")
+
+RULES_JVM_EXTERNAL_TAG = "3.0"
+RULES_JVM_EXTERNAL_SHA = "62133c125bf4109dfd9d2af64830208356ce4ef8b165a6ef15bbff7460b35c3a"
+
+http_archive(
+ name = "rules_jvm_external",
+ strip_prefix = "rules_jvm_external-%s" % RULES_JVM_EXTERNAL_TAG,
+ sha256 = RULES_JVM_EXTERNAL_SHA,
+ url = "https://github.com/bazelbuild/rules_jvm_external/archive/%s.zip" % RULES_JVM_EXTERNAL_TAG,
)
-load("@bazel_tools//tools/build_defs/repo:http.bzl", "http_file")
+load("@rules_jvm_external//:defs.bzl", "maven_install")
+
+maven_install(
+ artifacts = ["junit:junit:4.12"],
+ repositories = ["https://repo1.maven.org/maven2"],
+)
http_file(
name = "openjdk_jni_h",
diff --git a/java/org/brotli/common/BUILD b/java/org/brotli/common/BUILD
new file mode 100644
index 0000000..771b1e3
--- /dev/null
+++ b/java/org/brotli/common/BUILD
@@ -0,0 +1,11 @@
+# Description:
+# Java port of Brotli.
+
+package(default_visibility = ["//visibility:public"])
+
+licenses(["notice"]) # MIT
+
+java_library(
+ name = "shared_dictionary",
+ srcs = ["SharedDictionaryType.java"],
+)
diff --git a/java/org/brotli/common/SharedDictionaryType.java b/java/org/brotli/common/SharedDictionaryType.java
new file mode 100644
index 0000000..b592d2b
--- /dev/null
+++ b/java/org/brotli/common/SharedDictionaryType.java
@@ -0,0 +1,15 @@
+/* Copyright 2018 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+package org.brotli.common;
+
+/** POJO enum that mirrors C BrotliSharedDictionaryType. */
+public class SharedDictionaryType {
+ // Disallow instantiation.
+ private SharedDictionaryType() {}
+
+ public static final int RAW = 0;
+ public static final int SERIALIZED = 1;
+}
diff --git a/java/org/brotli/dec/BUILD b/java/org/brotli/dec/BUILD
index e6d3a4d..208642e 100644
--- a/java/org/brotli/dec/BUILD
+++ b/java/org/brotli/dec/BUILD
@@ -5,57 +5,55 @@ package(default_visibility = ["//visibility:public"])
licenses(["notice"]) # MIT
+TEST_DEPS = [
+ ":dec",
+ "@maven//:junit_junit",
+]
+
java_library(
name = "dec",
srcs = glob(
["*.java"],
exclude = ["*Test*.java"],
),
- proguard_specs = ["proguard.cfg"],
+ proguard_specs = ["proguard.pgcfg"],
+ resource_jars = ["//:license"],
)
-java_library(
- name = "test_lib",
- testonly = 1,
- srcs = glob(["*Test*.java"]),
- deps = [
- ":dec",
- "@junit_junit//jar",
- ],
-)
+load(":build_defs.bzl", "brotli_java_test")
-java_test(
+brotli_java_test(
name = "BitReaderTest",
- test_class = "org.brotli.dec.BitReaderTest",
- runtime_deps = [":test_lib"],
+ srcs = ["BitReaderTest.java"],
+ deps = TEST_DEPS,
)
-java_test(
+brotli_java_test(
name = "DecodeTest",
- test_class = "org.brotli.dec.DecodeTest",
- runtime_deps = [":test_lib"],
+ srcs = ["DecodeTest.java"],
+ deps = TEST_DEPS,
)
-java_test(
+brotli_java_test(
name = "DictionaryTest",
- test_class = "org.brotli.dec.DictionaryTest",
- runtime_deps = [":test_lib"],
+ srcs = ["DictionaryTest.java"],
+ deps = TEST_DEPS,
)
-java_test(
+brotli_java_test(
name = "EagerStreamTest",
- test_class = "org.brotli.dec.EagerStreamTest",
- runtime_deps = [":test_lib"],
+ srcs = ["EagerStreamTest.java"],
+ deps = TEST_DEPS,
)
-java_test(
+brotli_java_test(
name = "SynthTest",
- test_class = "org.brotli.dec.SynthTest",
- runtime_deps = [":test_lib"],
+ srcs = ["SynthTest.java"],
+ deps = TEST_DEPS,
)
-java_test(
+brotli_java_test(
name = "TransformTest",
- test_class = "org.brotli.dec.TransformTest",
- runtime_deps = [":test_lib"],
+ srcs = ["TransformTest.java"],
+ deps = TEST_DEPS,
)
diff --git a/java/org/brotli/dec/BitReader.java b/java/org/brotli/dec/BitReader.java
index 5d54e01..6dfeedc 100644
--- a/java/org/brotli/dec/BitReader.java
+++ b/java/org/brotli/dec/BitReader.java
@@ -12,9 +12,14 @@ package org.brotli.dec;
final class BitReader {
// Possible values: {5, 6}. 5 corresponds to 32-bit build, 6 to 64-bit. This value is used for
- // conditional compilation -> produced artifacts might be binary INCOMPATIBLE (JLS 13.2).
- private static final int LOG_BITNESS = 6;
- private static final int BITNESS = 1 << LOG_BITNESS;
+ // JIT conditional compilation.
+ private static final int LOG_BITNESS = Utils.getLogBintness();
+
+ // Not only Java compiler prunes "if (const false)" code, but JVM as well.
+ // Code under "if (DEBUG != 0)" have zero performance impact (outside unit tests).
+ private static final int DEBUG = Utils.isDebugMode();
+
+ static final int BITNESS = 1 << LOG_BITNESS;
private static final int BYTENESS = BITNESS / 8;
private static final int CAPACITY = 4096;
@@ -89,7 +94,16 @@ final class BitReader {
}
}
+ static void assertAccumulatorHealthy(State s) {
+ if (s.bitOffset > BITNESS) {
+ throw new IllegalStateException("Accumulator underloaded: " + s.bitOffset);
+ }
+ }
+
static void fillBitWindow(State s) {
+ if (DEBUG != 0) {
+ assertAccumulatorHealthy(s);
+ }
if (s.bitOffset >= HALF_BITNESS) {
// Same as doFillBitWindow. JVM fails to inline it.
if (BITNESS == 64) {
@@ -103,7 +117,10 @@ final class BitReader {
}
}
- private static void doFillBitWindow(State s) {
+ static void doFillBitWindow(State s) {
+ if (DEBUG != 0) {
+ assertAccumulatorHealthy(s);
+ }
if (BITNESS == 64) {
s.accumulator64 = ((long) s.intBuffer[s.halfOffset++] << HALF_BITNESS)
| (s.accumulator64 >>> HALF_BITNESS);
@@ -122,6 +139,12 @@ final class BitReader {
}
}
+ /**
+ * Fetches bits from accumulator.
+ *
+ * WARNING: accumulator MUST contain at least the specified amount of bits,
+ * otherwise BitReader will become broken.
+ */
static int readFewBits(State s, int n) {
int val = peekBits(s) & ((1 << n) - 1);
s.bitOffset += n;
diff --git a/java/org/brotli/dec/BitReaderTest.java b/java/org/brotli/dec/BitReaderTest.java
index fa57640..da59ebc 100644
--- a/java/org/brotli/dec/BitReaderTest.java
+++ b/java/org/brotli/dec/BitReaderTest.java
@@ -32,4 +32,23 @@ public class BitReaderTest {
}
fail("BrotliRuntimeException should have been thrown by BitReader.checkHealth");
}
+
+ @Test
+ public void testAccumulatorUnderflowDetected() {
+ State reader = new State();
+ Decode.initState(reader, new ByteArrayInputStream(new byte[8]));
+ // 65 bits is enough for both 32 and 64 bit systems.
+ BitReader.readBits(reader, 13);
+ BitReader.readBits(reader, 13);
+ BitReader.readBits(reader, 13);
+ BitReader.readBits(reader, 13);
+ BitReader.readBits(reader, 13);
+ try {
+ BitReader.fillBitWindow(reader);
+ } catch (IllegalStateException ex) {
+ // This exception is expected.
+ return;
+ }
+ fail("IllegalStateException should have been thrown by 'broken' BitReader");
+ }
}
diff --git a/java/org/brotli/dec/BrotliInputStream.java b/java/org/brotli/dec/BrotliInputStream.java
index a27e928..5eca238 100644
--- a/java/org/brotli/dec/BrotliInputStream.java
+++ b/java/org/brotli/dec/BrotliInputStream.java
@@ -84,8 +84,16 @@ public class BrotliInputStream extends InputStream {
}
}
- public void setEager(boolean eager) {
- state.isEager = eager ? 1 : 0;
+ public void attachDictionaryChunk(byte[] data) {
+ Decode.attachDictionaryChunk(state, data);
+ }
+
+ public void enableEagerOutput() {
+ Decode.enableEagerOutput(state);
+ }
+
+ public void enableLargeWindow() {
+ Decode.enableLargeWindow(state);
}
/**
diff --git a/java/org/brotli/dec/CompoundDictionaryTest.java b/java/org/brotli/dec/CompoundDictionaryTest.java
new file mode 100644
index 0000000..e69cbc4
--- /dev/null
+++ b/java/org/brotli/dec/CompoundDictionaryTest.java
@@ -0,0 +1,63 @@
+/* Copyright 2020 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+package org.brotli.dec;
+
+import static org.junit.Assert.assertEquals;
+
+import java.io.ByteArrayInputStream;
+import java.io.IOException;
+import org.junit.Test;
+import org.junit.runner.RunWith;
+import org.junit.runners.JUnit4;
+
+/**
+ * Tests for {@link Dictionary}.
+ */
+@RunWith(JUnit4.class)
+public class CompoundDictionaryTest {
+
+ /** See {@link SynthTest} */
+ private static final byte[] ONE_COPY = {
+ (byte) 0xa1, (byte) 0xa8, (byte) 0x00, (byte) 0xc0, (byte) 0x2f, (byte) 0x01, (byte) 0x10,
+ (byte) 0xc4, (byte) 0x44, (byte) 0x09, (byte) 0x00
+ };
+
+ private static final String TEXT = "Kot lomom kolol slona!";
+
+ @Test
+ public void testNoDictionary() throws IOException {
+ BrotliInputStream decoder = new BrotliInputStream(new ByteArrayInputStream(ONE_COPY));
+ byte[] buffer = new byte[32];
+ int length = decoder.read(buffer, 0, buffer.length);
+ assertEquals(TEXT.length(), length);
+ assertEquals("alternate\" type=\"appli", new String(buffer, 0, length, "US-ASCII"));
+ decoder.close();
+ }
+
+ @Test
+ public void testOnePieceDictionary() throws IOException {
+ BrotliInputStream decoder = new BrotliInputStream(new ByteArrayInputStream(ONE_COPY));
+ decoder.attachDictionaryChunk(TEXT.getBytes("US-ASCII"));
+ byte[] buffer = new byte[32];
+ int length = decoder.read(buffer, 0, buffer.length);
+ assertEquals(TEXT.length(), length);
+ assertEquals(TEXT, new String(buffer, 0, length, "US-ASCII"));
+ decoder.close();
+ }
+
+ @Test
+ public void testTwoPieceDictionary() throws IOException {
+ BrotliInputStream decoder = new BrotliInputStream(new ByteArrayInputStream(ONE_COPY));
+ decoder.attachDictionaryChunk(TEXT.substring(0, 13).getBytes("US-ASCII"));
+ decoder.attachDictionaryChunk(TEXT.substring(13).getBytes("US-ASCII"));
+ byte[] buffer = new byte[32];
+ int length = decoder.read(buffer, 0, buffer.length);
+ assertEquals(TEXT.length(), length);
+ assertEquals(TEXT, new String(buffer, 0, length, "US-ASCII"));
+ decoder.close();
+ }
+}
diff --git a/java/org/brotli/dec/Decode.java b/java/org/brotli/dec/Decode.java
index 9e3d43b..8395f04 100644
--- a/java/org/brotli/dec/Decode.java
+++ b/java/org/brotli/dec/Decode.java
@@ -8,45 +8,63 @@ package org.brotli.dec;
import java.io.IOException;
import java.io.InputStream;
+import java.nio.ByteBuffer;
/**
* API for Brotli decompression.
*/
final class Decode {
+ static final int MIN_LARGE_WINDOW_BITS = 10;
+ /* Maximum was chosen to be 30 to allow efficient decoder implementation.
+ * Format allows bigger window, but Java does not support 2G+ arrays. */
+ static final int MAX_LARGE_WINDOW_BITS = 30;
+
//----------------------------------------------------------------------------
// RunningState
//----------------------------------------------------------------------------
private static final int UNINITIALIZED = 0;
- private static final int BLOCK_START = 1;
- private static final int COMPRESSED_BLOCK_START = 2;
- private static final int MAIN_LOOP = 3;
- private static final int READ_METADATA = 4;
- private static final int COPY_UNCOMPRESSED = 5;
- private static final int INSERT_LOOP = 6;
- private static final int COPY_LOOP = 7;
- private static final int TRANSFORM = 8;
- private static final int FINISHED = 9;
- private static final int CLOSED = 10;
- private static final int INIT_WRITE = 11;
- private static final int WRITE = 12;
+ private static final int INITIALIZED = 1;
+ private static final int BLOCK_START = 2;
+ private static final int COMPRESSED_BLOCK_START = 3;
+ private static final int MAIN_LOOP = 4;
+ private static final int READ_METADATA = 5;
+ private static final int COPY_UNCOMPRESSED = 6;
+ private static final int INSERT_LOOP = 7;
+ private static final int COPY_LOOP = 8;
+ private static final int USE_DICTIONARY = 9;
+ private static final int FINISHED = 10;
+ private static final int CLOSED = 11;
+ private static final int INIT_WRITE = 12;
+ private static final int WRITE = 13;
+ private static final int COPY_FROM_COMPOUND_DICTIONARY = 14;
private static final int DEFAULT_CODE_LENGTH = 8;
private static final int CODE_LENGTH_REPEAT_CODE = 16;
private static final int NUM_LITERAL_CODES = 256;
- private static final int NUM_INSERT_AND_COPY_CODES = 704;
+ private static final int NUM_COMMAND_CODES = 704;
private static final int NUM_BLOCK_LENGTH_CODES = 26;
private static final int LITERAL_CONTEXT_BITS = 6;
private static final int DISTANCE_CONTEXT_BITS = 2;
+ private static final int CD_BLOCK_MAP_BITS = 8;
private static final int HUFFMAN_TABLE_BITS = 8;
private static final int HUFFMAN_TABLE_MASK = 0xFF;
/**
- * Maximum possible Huffman table size for an alphabet size of 704, max code length 15 and root
- * table bits 8.
+ * Maximum possible Huffman table size for an alphabet size of (index * 32),
+ * max code length 15 and root table bits 8.
+ * The biggest alphabet is "command" - 704 symbols. Though "distance" alphabet could theoretically
+ * outreach that limit (for 62 extra bit distances), practically it is limited by
+ * MAX_ALLOWED_DISTANCE and never gets bigger than 544 symbols.
*/
- static final int HUFFMAN_TABLE_SIZE = 1080;
+ static final int[] MAX_HUFFMAN_TABLE_SIZE = {
+ 256, 402, 436, 468, 500, 534, 566, 598, 630, 662, 694, 726, 758, 790, 822,
+ 854, 886, 920, 952, 984, 1016, 1048, 1080
+ };
+
+ private static final int HUFFMAN_TABLE_SIZE_26 = 396;
+ private static final int HUFFMAN_TABLE_SIZE_258 = 632;
private static final int CODE_LENGTH_CODES = 18;
private static final int[] CODE_LENGTH_CODE_ORDER = {
@@ -55,7 +73,7 @@ final class Decode {
private static final int NUM_DISTANCE_SHORT_CODES = 16;
private static final int[] DISTANCE_SHORT_CODE_INDEX_OFFSET = {
- 3, 2, 1, 0, 3, 3, 3, 3, 3, 3, 2, 2, 2, 2, 2, 2
+ 0, 3, 2, 1, 0, 0, 0, 0, 0, 0, 3, 3, 3, 3, 3, 3
};
private static final int[] DISTANCE_SHORT_CODE_VALUE_OFFSET = {
@@ -70,20 +88,19 @@ final class Decode {
0x020000, 0x020004, 0x020003, 0x030002, 0x020000, 0x020004, 0x020003, 0x040005
};
- static final int[] DICTIONARY_OFFSETS_BY_LENGTH = {
- 0, 0, 0, 0, 0, 4096, 9216, 21504, 35840, 44032, 53248, 63488, 74752, 87040, 93696, 100864,
- 104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280, 122016
- };
-
- static final int[] DICTIONARY_SIZE_BITS_BY_LENGTH = {
- 0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10, 9, 9, 8, 7, 7, 8, 7, 7, 6, 6, 5, 5
- };
+ // TODO: generalize.
+ static final int MAX_TRANSFORMED_WORD_LENGTH = 5 + 24 + 8;
- static final int MIN_WORD_LENGTH = 4;
+ private static final int MAX_DISTANCE_BITS = 24;
+ private static final int MAX_LARGE_WINDOW_DISTANCE_BITS = 62;
- static final int MAX_WORD_LENGTH = 24;
-
- static final int MAX_TRANSFORMED_WORD_LENGTH = 5 + MAX_WORD_LENGTH + 8;
+ /**
+ * Safe distance limit.
+ *
+ * Limit ((1 << 31) - 4) allows safe distance calculation without overflows,
+ * given the distance alphabet size is limited to corresponding size.
+ */
+ private static final int MAX_ALLOWED_DISTANCE = 0x7FFFFFFC;
//----------------------------------------------------------------------------
// Prefix code LUT.
@@ -97,33 +114,103 @@ final class Decode {
2, 2, 2, 2, 3, 3, 3, 3, 4, 4, 4, 4, 5, 5, 5, 5, 6, 6, 7, 8, 9, 10, 11, 12, 13, 24
};
- static final int[] INSERT_LENGTH_OFFSET = {
- 0, 1, 2, 3, 4, 5, 6, 8, 10, 14, 18, 26, 34, 50, 66, 98, 130, 194, 322, 578, 1090, 2114, 6210,
- 22594
+ static final short[] INSERT_LENGTH_N_BITS = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x02, 0x02, 0x03, 0x03,
+ 0x04, 0x04, 0x05, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0A, 0x0C, 0x0E, 0x18
};
- static final int[] INSERT_LENGTH_N_BITS = {
- 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 12, 14, 24
+ static final short[] COPY_LENGTH_N_BITS = {
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x02, 0x02,
+ 0x03, 0x03, 0x04, 0x04, 0x05, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0A, 0x18
};
- static final int[] COPY_LENGTH_OFFSET = {
- 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 18, 22, 30, 38, 54, 70, 102, 134, 198, 326, 582, 1094,
- 2118
- };
+ // Each command is represented with 4x16-bit values:
+ // * [insertLenExtraBits, copyLenExtraBits]
+ // * insertLenOffset
+ // * copyLenOffset
+ // * distanceContext
+ static final short[] CMD_LOOKUP = new short[NUM_COMMAND_CODES * 4];
- static final int[] COPY_LENGTH_N_BITS = {
- 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 24
- };
+ static {
+ unpackCommandLookupTable(CMD_LOOKUP);
+ }
- static final int[] INSERT_RANGE_LUT = {
- 0, 0, 8, 8, 0, 16, 8, 16, 16
- };
+ private static int log2floor(int i) {
+ int result = -1;
+ int step = 16;
+ while (step > 0) {
+ if ((i >>> step) != 0) {
+ result += step;
+ i = i >>> step;
+ }
+ step = step >> 1;
+ }
+ return result + i;
+ }
- static final int[] COPY_RANGE_LUT = {
- 0, 8, 0, 8, 16, 0, 16, 8, 16
- };
+ private static int calculateDistanceAlphabetSize(int npostfix, int ndirect, int maxndistbits) {
+ return NUM_DISTANCE_SHORT_CODES + ndirect + 2 * (maxndistbits << npostfix);
+ }
+
+ // TODO: add a correctness test for this function when
+ // large-window and dictionary are implemented.
+ private static int calculateDistanceAlphabetLimit(int maxDistance, int npostfix, int ndirect) {
+ if (maxDistance < ndirect + (2 << npostfix)) {
+ throw new IllegalArgumentException("maxDistance is too small");
+ }
+ int offset = ((maxDistance - ndirect) >> npostfix) + 4;
+ int ndistbits = log2floor(offset) - 1;
+ int group = ((ndistbits - 1) << 1) | ((offset >> ndistbits) & 1);
+ return ((group - 1) << npostfix) + (1 << npostfix) + ndirect + NUM_DISTANCE_SHORT_CODES;
+ }
+ private static void unpackCommandLookupTable(short[] cmdLookup) {
+ short[] insertLengthOffsets = new short[24];
+ short[] copyLengthOffsets = new short[24];
+ copyLengthOffsets[0] = 2;
+ for (int i = 0; i < 23; ++i) {
+ insertLengthOffsets[i + 1] =
+ (short) (insertLengthOffsets[i] + (1 << INSERT_LENGTH_N_BITS[i]));
+ copyLengthOffsets[i + 1] =
+ (short) (copyLengthOffsets[i] + (1 << COPY_LENGTH_N_BITS[i]));
+ }
+
+ for (int cmdCode = 0; cmdCode < NUM_COMMAND_CODES; ++cmdCode) {
+ int rangeIdx = cmdCode >>> 6;
+ /* -4 turns any regular distance code to negative. */
+ int distanceContextOffset = -4;
+ if (rangeIdx >= 2) {
+ rangeIdx -= 2;
+ distanceContextOffset = 0;
+ }
+ int insertCode = (((0x29850 >>> (rangeIdx * 2)) & 0x3) << 3) | ((cmdCode >>> 3) & 7);
+ int copyCode = (((0x26244 >>> (rangeIdx * 2)) & 0x3) << 3) | (cmdCode & 7);
+ short copyLengthOffset = copyLengthOffsets[copyCode];
+ int distanceContext =
+ distanceContextOffset + (copyLengthOffset > 4 ? 3 : copyLengthOffset - 2);
+ int index = cmdCode * 4;
+ cmdLookup[index + 0] =
+ (short) (INSERT_LENGTH_N_BITS[insertCode] | (COPY_LENGTH_N_BITS[copyCode] << 8));
+ cmdLookup[index + 1] = insertLengthOffsets[insertCode];
+ cmdLookup[index + 2] = copyLengthOffsets[copyCode];
+ cmdLookup[index + 3] = (short) distanceContext;
+ }
+ }
+
+ /**
+ * Reads brotli stream header and parses "window bits".
+ *
+ * @param s initialized state, before any read is performed.
+ * @return -1 if header is invalid
+ */
private static int decodeWindowBits(State s) {
+ /* Change the meaning of flag. Before that step it means "decoder must be capable of reading
+ * "large-window" brotli stream. After this step it means that "large-window" feature
+ * is actually detected. Despite the window size could be same as before (lgwin = 10..24),
+ * encoded distances are allowed to be much greater, thus bigger dictinary could be used. */
+ int largeWindowEnabled = s.isLargeWindow;
+ s.isLargeWindow = 0;
+
BitReader.fillBitWindow(s);
if (BitReader.readFewBits(s, 1) == 0) {
return 16;
@@ -134,12 +221,70 @@ final class Decode {
}
n = BitReader.readFewBits(s, 3);
if (n != 0) {
- return 8 + n;
+ if (n == 1) {
+ if (largeWindowEnabled == 0) {
+ /* Reserved value in regular brotli stream. */
+ return -1;
+ }
+ s.isLargeWindow = 1;
+ /* Check "reserved" bit for future (post-large-window) extensions. */
+ if (BitReader.readFewBits(s, 1) == 1) {
+ return -1;
+ }
+ n = BitReader.readFewBits(s, 6);
+ if (n < MIN_LARGE_WINDOW_BITS || n > MAX_LARGE_WINDOW_BITS) {
+ /* Encoded window bits value is too small or too big. */
+ return -1;
+ }
+ return n;
+ } else {
+ return 8 + n;
+ }
}
return 17;
}
/**
+ * Switch decoder to "eager" mode.
+ *
+ * In "eager" mode decoder returns as soon as there is enough data to fill output buffer.
+ *
+ * @param s initialized state, before any read is performed.
+ */
+ static void enableEagerOutput(State s) {
+ if (s.runningState != INITIALIZED) {
+ throw new IllegalStateException("State MUST be freshly initialized");
+ }
+ s.isEager = 1;
+ }
+
+ static void enableLargeWindow(State s) {
+ if (s.runningState != INITIALIZED) {
+ throw new IllegalStateException("State MUST be freshly initialized");
+ }
+ s.isLargeWindow = 1;
+ }
+
+ // TODO: do we need byte views?
+ static void attachDictionaryChunk(State s, byte[] data) {
+ if (s.runningState != INITIALIZED) {
+ throw new IllegalStateException("State MUST be freshly initialized");
+ }
+ if (s.cdNumChunks == 0) {
+ s.cdChunks = new byte[16][];
+ s.cdChunkOffsets = new int[16];
+ s.cdBlockBits = -1;
+ }
+ if (s.cdNumChunks == 15) {
+ throw new IllegalStateException("Too many dictionary chunks");
+ }
+ s.cdChunks[s.cdNumChunks] = data;
+ s.cdNumChunks++;
+ s.cdTotalSize += data.length;
+ s.cdChunkOffsets[s.cdNumChunks] = s.cdTotalSize;
+ }
+
+ /**
* Associate input with decoder state.
*
* @param s uninitialized state without associated input
@@ -149,16 +294,16 @@ final class Decode {
if (s.runningState != UNINITIALIZED) {
throw new IllegalStateException("State MUST be uninitialized");
}
- s.blockTrees = new int[6 * HUFFMAN_TABLE_SIZE];
+ /* 6 trees + 1 extra "offset" slot to simplify table decoding logic. */
+ s.blockTrees = new int[7 + 3 * (HUFFMAN_TABLE_SIZE_258 + HUFFMAN_TABLE_SIZE_26)];
+ s.blockTrees[0] = 7;
+ s.distRbIdx = 3;
+ int maxDistanceAlphabetLimit = calculateDistanceAlphabetLimit(MAX_ALLOWED_DISTANCE, 3, 15 << 3);
+ s.distExtraBits = new byte[maxDistanceAlphabetLimit];
+ s.distOffset = new int[maxDistanceAlphabetLimit];
s.input = input;
BitReader.initBitReader(s);
- int windowBits = decodeWindowBits(s);
- if (windowBits == 9) { /* Reserved case for future expansion. */
- throw new BrotliRuntimeException("Invalid 'windowBits' code");
- }
- s.maxRingBufferSize = 1 << windowBits;
- s.maxBackwardDistance = s.maxRingBufferSize - 16;
- s.runningState = BLOCK_START;
+ s.runningState = INITIALIZED;
}
static void close(State s) throws IOException {
@@ -237,11 +382,12 @@ final class Decode {
/**
* Decodes the next Huffman code from bit-stream.
*/
- private static int readSymbol(int[] table, int offset, State s) {
+ private static int readSymbol(int[] tableGroup, int tableIdx, State s) {
+ int offset = tableGroup[tableIdx];
int val = BitReader.peekBits(s);
offset += val & HUFFMAN_TABLE_MASK;
- int bits = table[offset] >> 16;
- int sym = table[offset] & 0xFFFF;
+ int bits = tableGroup[offset] >> 16;
+ int sym = tableGroup[offset] & 0xFFFF;
if (bits <= HUFFMAN_TABLE_BITS) {
s.bitOffset += bits;
return sym;
@@ -249,27 +395,18 @@ final class Decode {
offset += sym;
int mask = (1 << bits) - 1;
offset += (val & mask) >>> HUFFMAN_TABLE_BITS;
- s.bitOffset += ((table[offset] >> 16) + HUFFMAN_TABLE_BITS);
- return table[offset] & 0xFFFF;
+ s.bitOffset += ((tableGroup[offset] >> 16) + HUFFMAN_TABLE_BITS);
+ return tableGroup[offset] & 0xFFFF;
}
- private static int readBlockLength(int[] table, int offset, State s) {
+ private static int readBlockLength(int[] tableGroup, int tableIdx, State s) {
BitReader.fillBitWindow(s);
- int code = readSymbol(table, offset, s);
+ int code = readSymbol(tableGroup, tableIdx, s);
int n = BLOCK_LENGTH_N_BITS[code];
BitReader.fillBitWindow(s);
return BLOCK_LENGTH_OFFSET[code] + BitReader.readBits(s, n);
}
- private static int translateShortCodes(int code, int[] ringBuffer, int index) {
- if (code < NUM_DISTANCE_SHORT_CODES) {
- index += DISTANCE_SHORT_CODE_INDEX_OFFSET[code];
- index &= 3;
- return ringBuffer[index] + DISTANCE_SHORT_CODE_VALUE_OFFSET[code];
- }
- return code - NUM_DISTANCE_SHORT_CODES + 1;
- }
-
private static void moveToFront(int[] v, int index) {
int value = v[index];
for (; index > 0; index--) {
@@ -299,9 +436,9 @@ final class Decode {
int repeat = 0;
int repeatCodeLen = 0;
int space = 32768;
- int[] table = new int[32];
-
- Huffman.buildHuffmanTable(table, 0, 5, codeLengthCodeLengths, CODE_LENGTH_CODES);
+ int[] table = new int[32 + 1]; /* Speculative single entry table group. */
+ int tableIdx = table.length - 1;
+ Huffman.buildHuffmanTable(table, tableIdx, 5, codeLengthCodeLengths, CODE_LENGTH_CODES);
while (symbol < numSymbols && space > 0) {
BitReader.readMoreInput(s);
@@ -352,85 +489,128 @@ final class Decode {
Utils.fillIntsWithZeroes(codeLengths, symbol, numSymbols);
}
- static int checkDupes(int[] symbols, int length) {
+ private static void checkDupes(int[] symbols, int length) {
for (int i = 0; i < length - 1; ++i) {
for (int j = i + 1; j < length; ++j) {
if (symbols[i] == symbols[j]) {
- return 0;
+ throw new BrotliRuntimeException("Duplicate simple Huffman code symbol"); // COV_NF_LINE
}
}
}
- return 1;
}
- // TODO: Use specialized versions for smaller tables.
- static void readHuffmanCode(int alphabetSize, int[] table, int offset, State s) {
- int ok = 1;
- int simpleCodeOrSkip;
- BitReader.readMoreInput(s);
- // TODO: Avoid allocation.
- int[] codeLengths = new int[alphabetSize];
- BitReader.fillBitWindow(s);
- simpleCodeOrSkip = BitReader.readFewBits(s, 2);
- if (simpleCodeOrSkip == 1) { // Read symbols, codes & code lengths directly.
- int maxBitsCounter = alphabetSize - 1;
- int maxBits = 0;
- int[] symbols = new int[4];
- int numSymbols = BitReader.readFewBits(s, 2) + 1;
- while (maxBitsCounter != 0) {
- maxBitsCounter >>= 1;
- maxBits++;
- }
- // TODO: uncomment when codeLengths is reused.
- // Utils.fillWithZeroes(codeLengths, 0, alphabetSize);
- for (int i = 0; i < numSymbols; i++) {
- BitReader.fillBitWindow(s);
- symbols[i] = BitReader.readFewBits(s, maxBits) % alphabetSize;
- codeLengths[symbols[i]] = 2;
- }
- codeLengths[symbols[0]] = 1;
- switch (numSymbols) {
- case 2:
- codeLengths[symbols[1]] = 1;
- break;
- case 4:
- if (BitReader.readFewBits(s, 1) == 1) {
- codeLengths[symbols[2]] = 3;
- codeLengths[symbols[3]] = 3;
- } else {
- codeLengths[symbols[0]] = 2;
- }
- break;
- default:
- break;
- }
- ok = checkDupes(symbols, numSymbols);
- } else { // Decode Huffman-coded code lengths.
- int[] codeLengthCodeLengths = new int[CODE_LENGTH_CODES];
- int space = 32;
- int numCodes = 0;
- for (int i = simpleCodeOrSkip; i < CODE_LENGTH_CODES && space > 0; i++) {
- int codeLenIdx = CODE_LENGTH_CODE_ORDER[i];
- BitReader.fillBitWindow(s);
- int p = BitReader.peekBits(s) & 15;
- // TODO: Demultiplex FIXED_TABLE.
- s.bitOffset += FIXED_TABLE[p] >> 16;
- int v = FIXED_TABLE[p] & 0xFFFF;
- codeLengthCodeLengths[codeLenIdx] = v;
- if (v != 0) {
- space -= (32 >> v);
- numCodes++;
- }
+ /**
+ * Reads up to 4 symbols directly and applies predefined histograms.
+ */
+ private static int readSimpleHuffmanCode(int alphabetSizeMax, int alphabetSizeLimit,
+ int[] tableGroup, int tableIdx, State s) {
+ // TODO: Avoid allocation?
+ int[] codeLengths = new int[alphabetSizeLimit];
+ int[] symbols = new int[4];
+
+ int maxBits = 1 + log2floor(alphabetSizeMax - 1);
+
+ int numSymbols = BitReader.readFewBits(s, 2) + 1;
+ for (int i = 0; i < numSymbols; i++) {
+ BitReader.fillBitWindow(s);
+ int symbol = BitReader.readFewBits(s, maxBits);
+ if (symbol >= alphabetSizeLimit) {
+ throw new BrotliRuntimeException("Can't readHuffmanCode"); // COV_NF_LINE
}
- if (space != 0 && numCodes != 1) {
- ok = 0;
+ symbols[i] = symbol;
+ }
+ checkDupes(symbols, numSymbols);
+
+ int histogramId = numSymbols;
+ if (numSymbols == 4) {
+ histogramId += BitReader.readFewBits(s, 1);
+ }
+
+ switch (histogramId) {
+ case 1:
+ codeLengths[symbols[0]] = 1;
+ break;
+
+ case 2:
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 1;
+ break;
+
+ case 3:
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 2;
+ break;
+
+ case 4: // uniform 4-symbol histogram
+ codeLengths[symbols[0]] = 2;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 2;
+ codeLengths[symbols[3]] = 2;
+ break;
+
+ case 5: // prioritized 4-symbol histogram
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 3;
+ codeLengths[symbols[3]] = 3;
+ break;
+
+ default:
+ break;
+ }
+
+ // TODO: Use specialized version?
+ return Huffman.buildHuffmanTable(
+ tableGroup, tableIdx, HUFFMAN_TABLE_BITS, codeLengths, alphabetSizeLimit);
+ }
+
+ // Decode Huffman-coded code lengths.
+ private static int readComplexHuffmanCode(int alphabetSizeLimit, int skip,
+ int[] tableGroup, int tableIdx, State s) {
+ // TODO: Avoid allocation?
+ int[] codeLengths = new int[alphabetSizeLimit];
+ int[] codeLengthCodeLengths = new int[CODE_LENGTH_CODES];
+ int space = 32;
+ int numCodes = 0;
+ for (int i = skip; i < CODE_LENGTH_CODES && space > 0; i++) {
+ int codeLenIdx = CODE_LENGTH_CODE_ORDER[i];
+ BitReader.fillBitWindow(s);
+ int p = BitReader.peekBits(s) & 15;
+ // TODO: Demultiplex FIXED_TABLE.
+ s.bitOffset += FIXED_TABLE[p] >> 16;
+ int v = FIXED_TABLE[p] & 0xFFFF;
+ codeLengthCodeLengths[codeLenIdx] = v;
+ if (v != 0) {
+ space -= (32 >> v);
+ numCodes++;
}
- readHuffmanCodeLengths(codeLengthCodeLengths, alphabetSize, codeLengths, s);
}
- if (ok == 0) {
- throw new BrotliRuntimeException("Can't readHuffmanCode"); // COV_NF_LINE
+ if (space != 0 && numCodes != 1) {
+ throw new BrotliRuntimeException("Corrupted Huffman code histogram"); // COV_NF_LINE
+ }
+
+ readHuffmanCodeLengths(codeLengthCodeLengths, alphabetSizeLimit, codeLengths, s);
+
+ return Huffman.buildHuffmanTable(
+ tableGroup, tableIdx, HUFFMAN_TABLE_BITS, codeLengths, alphabetSizeLimit);
+ }
+
+ /**
+ * Decodes Huffman table from bit-stream.
+ *
+ * @return number of slots used by resulting Huffman table
+ */
+ private static int readHuffmanCode(int alphabetSizeMax, int alphabetSizeLimit,
+ int[] tableGroup, int tableIdx, State s) {
+ BitReader.readMoreInput(s);
+ BitReader.fillBitWindow(s);
+ int simpleCodeOrSkip = BitReader.readFewBits(s, 2);
+ if (simpleCodeOrSkip == 1) {
+ return readSimpleHuffmanCode(alphabetSizeMax, alphabetSizeLimit, tableGroup, tableIdx, s);
+ } else {
+ return readComplexHuffmanCode(alphabetSizeLimit, simpleCodeOrSkip, tableGroup, tableIdx, s);
}
- Huffman.buildHuffmanTable(table, offset, HUFFMAN_TABLE_BITS, codeLengths, alphabetSize);
}
private static int decodeContextMap(int contextMapSize, byte[] contextMap, State s) {
@@ -448,12 +628,16 @@ final class Decode {
if (useRleForZeros != 0) {
maxRunLengthPrefix = BitReader.readFewBits(s, 4) + 1;
}
- int[] table = new int[HUFFMAN_TABLE_SIZE];
- readHuffmanCode(numTrees + maxRunLengthPrefix, table, 0, s);
+ int alphabetSize = numTrees + maxRunLengthPrefix;
+ int tableSize = MAX_HUFFMAN_TABLE_SIZE[(alphabetSize + 31) >> 5];
+ /* Speculative single entry table group. */
+ int[] table = new int[tableSize + 1];
+ int tableIdx = table.length - 1;
+ readHuffmanCode(alphabetSize, alphabetSize, table, tableIdx, s);
for (int i = 0; i < contextMapSize; ) {
BitReader.readMoreInput(s);
BitReader.fillBitWindow(s);
- int code = readSymbol(table, 0, s);
+ int code = readSymbol(table, tableIdx, s);
if (code == 0) {
contextMap[i] = 0;
i++;
@@ -484,8 +668,8 @@ final class Decode {
final int[] ringBuffers = s.rings;
final int offset = 4 + treeType * 2;
BitReader.fillBitWindow(s);
- int blockType = readSymbol(s.blockTrees, treeType * HUFFMAN_TABLE_SIZE, s);
- int result = readBlockLength(s.blockTrees, (treeType + 3) * HUFFMAN_TABLE_SIZE, s);
+ int blockType = readSymbol(s.blockTrees, 2 * treeType, s);
+ int result = readBlockLength(s.blockTrees, 2 * treeType + 1, s);
if (blockType == 1) {
blockType = ringBuffers[offset + 1] + 1;
@@ -506,8 +690,7 @@ final class Decode {
s.literalBlockLength = decodeBlockTypeAndLength(s, 0, s.numLiteralBlockTypes);
int literalBlockType = s.rings[5];
s.contextMapSlice = literalBlockType << LITERAL_CONTEXT_BITS;
- s.literalTreeIndex = s.contextMap[s.contextMapSlice] & 0xFF;
- s.literalTree = s.hGroup0[s.literalTreeIndex];
+ s.literalTreeIdx = s.contextMap[s.contextMapSlice] & 0xFF;
int contextMode = s.contextModes[literalBlockType];
s.contextLookupOffset1 = contextMode << 9;
s.contextLookupOffset2 = s.contextLookupOffset1 + 256;
@@ -515,7 +698,7 @@ final class Decode {
private static void decodeCommandBlockSwitch(State s) {
s.commandBlockLength = decodeBlockTypeAndLength(s, 1, s.numCommandBlockTypes);
- s.treeCommandOffset = s.hGroup1[s.rings[7]];
+ s.commandTreeIdx = s.rings[7];
}
private static void decodeDistanceBlockSwitch(State s) {
@@ -554,9 +737,9 @@ final class Decode {
return;
}
// TODO: Reset? Do we need this?
- s.hGroup0 = new int[0];
- s.hGroup1 = new int[0];
- s.hGroup2 = new int[0];
+ s.literalTreeGroup = new int[0];
+ s.commandTreeGroup = new int[0];
+ s.distanceTreeGroup = new int[0];
BitReader.readMoreInput(s);
decodeMetaBlockLength(s);
@@ -583,12 +766,57 @@ final class Decode {
}
private static int readMetablockPartition(State s, int treeType, int numBlockTypes) {
+ int offset = s.blockTrees[2 * treeType];
if (numBlockTypes <= 1) {
+ s.blockTrees[2 * treeType + 1] = offset;
+ s.blockTrees[2 * treeType + 2] = offset;
return 1 << 28;
}
- readHuffmanCode(numBlockTypes + 2, s.blockTrees, treeType * HUFFMAN_TABLE_SIZE, s);
- readHuffmanCode(NUM_BLOCK_LENGTH_CODES, s.blockTrees, (treeType + 3) * HUFFMAN_TABLE_SIZE, s);
- return readBlockLength(s.blockTrees, (treeType + 3) * HUFFMAN_TABLE_SIZE, s);
+
+ int blockTypeAlphabetSize = numBlockTypes + 2;
+ offset += readHuffmanCode(
+ blockTypeAlphabetSize, blockTypeAlphabetSize, s.blockTrees, 2 * treeType, s);
+ s.blockTrees[2 * treeType + 1] = offset;
+
+ int blockLengthAlphabetSize = NUM_BLOCK_LENGTH_CODES;
+ offset += readHuffmanCode(
+ blockLengthAlphabetSize, blockLengthAlphabetSize, s.blockTrees, 2 * treeType + 1, s);
+ s.blockTrees[2 * treeType + 2] = offset;
+
+ return readBlockLength(s.blockTrees, 2 * treeType + 1, s);
+ }
+
+ private static void calculateDistanceLut(State s, int alphabetSizeLimit) {
+ byte[] distExtraBits = s.distExtraBits;
+ int[] distOffset = s.distOffset;
+ int npostfix = s.distancePostfixBits;
+ int ndirect = s.numDirectDistanceCodes;
+ int postfix = 1 << npostfix;
+ int bits = 1;
+ int half = 0;
+
+ /* Skip short codes. */
+ int i = NUM_DISTANCE_SHORT_CODES;
+
+ /* Fill direct codes. */
+ for (int j = 0; j < ndirect; ++j) {
+ distExtraBits[i] = 0;
+ distOffset[i] = j + 1;
+ ++i;
+ }
+
+ /* Fill regular distance codes. */
+ while (i < alphabetSizeLimit) {
+ int base = ndirect + ((((2 + half) << bits) - 4) << npostfix) + 1;
+ /* Always fill the complete group. */
+ for (int j = 0; j < postfix; ++j) {
+ distExtraBits[i] = (byte) bits;
+ distOffset[i] = base + j;
+ ++i;
+ }
+ bits = bits + half;
+ half = half ^ 1;
+ }
}
private static void readMetablockHuffmanCodesAndContextMaps(State s) {
@@ -602,10 +830,7 @@ final class Decode {
BitReader.readMoreInput(s);
BitReader.fillBitWindow(s);
s.distancePostfixBits = BitReader.readFewBits(s, 2);
- s.numDirectDistanceCodes =
- NUM_DISTANCE_SHORT_CODES + (BitReader.readFewBits(s, 4) << s.distancePostfixBits);
- s.distancePostfixMask = (1 << s.distancePostfixBits) - 1;
- int numDistanceCodes = s.numDirectDistanceCodes + (48 << s.distancePostfixBits);
+ s.numDirectDistanceCodes = BitReader.readFewBits(s, 4) << s.distancePostfixBits;
// TODO: Reuse?
s.contextModes = new byte[s.numLiteralBlockTypes];
for (int i = 0; i < s.numLiteralBlockTypes;) {
@@ -613,7 +838,7 @@ final class Decode {
int limit = Math.min(i + 96, s.numLiteralBlockTypes);
for (; i < limit; ++i) {
BitReader.fillBitWindow(s);
- s.contextModes[i] = (byte) (BitReader.readFewBits(s, 2));
+ s.contextModes[i] = (byte) BitReader.readFewBits(s, 2);
}
BitReader.readMoreInput(s);
}
@@ -635,18 +860,29 @@ final class Decode {
int numDistTrees = decodeContextMap(s.numDistanceBlockTypes << DISTANCE_CONTEXT_BITS,
s.distContextMap, s);
- s.hGroup0 = decodeHuffmanTreeGroup(NUM_LITERAL_CODES, numLiteralTrees, s);
- s.hGroup1 =
- decodeHuffmanTreeGroup(NUM_INSERT_AND_COPY_CODES, s.numCommandBlockTypes, s);
- s.hGroup2 = decodeHuffmanTreeGroup(numDistanceCodes, numDistTrees, s);
+ s.literalTreeGroup = decodeHuffmanTreeGroup(NUM_LITERAL_CODES, NUM_LITERAL_CODES,
+ numLiteralTrees, s);
+ s.commandTreeGroup = decodeHuffmanTreeGroup(NUM_COMMAND_CODES, NUM_COMMAND_CODES,
+ s.numCommandBlockTypes, s);
+ int distanceAlphabetSizeMax = calculateDistanceAlphabetSize(
+ s.distancePostfixBits, s.numDirectDistanceCodes, MAX_DISTANCE_BITS);
+ int distanceAlphabetSizeLimit = distanceAlphabetSizeMax;
+ if (s.isLargeWindow == 1) {
+ distanceAlphabetSizeMax = calculateDistanceAlphabetSize(
+ s.distancePostfixBits, s.numDirectDistanceCodes, MAX_LARGE_WINDOW_DISTANCE_BITS);
+ distanceAlphabetSizeLimit = calculateDistanceAlphabetLimit(
+ MAX_ALLOWED_DISTANCE, s.distancePostfixBits, s.numDirectDistanceCodes);
+ }
+ s.distanceTreeGroup = decodeHuffmanTreeGroup(distanceAlphabetSizeMax, distanceAlphabetSizeLimit,
+ numDistTrees, s);
+ calculateDistanceLut(s, distanceAlphabetSizeLimit);
s.contextMapSlice = 0;
s.distContextMapSlice = 0;
- s.contextLookupOffset1 = (int) (s.contextModes[0]) << 9;
+ s.contextLookupOffset1 = s.contextModes[0] * 512;
s.contextLookupOffset2 = s.contextLookupOffset1 + 256;
- s.literalTreeIndex = 0;
- s.literalTree = s.hGroup0[0];
- s.treeCommandOffset = s.hGroup1[0];
+ s.literalTreeIdx = 0;
+ s.commandTreeIdx = 0;
s.rings[4] = 1;
s.rings[5] = 0;
@@ -697,13 +933,14 @@ final class Decode {
}
}
- private static int[] decodeHuffmanTreeGroup(int alphabetSize, int n, State s) {
- int[] group = new int[n + (n * HUFFMAN_TABLE_SIZE)];
+ private static int[] decodeHuffmanTreeGroup(int alphabetSizeMax, int alphabetSizeLimit,
+ int n, State s) {
+ int maxTableSize = MAX_HUFFMAN_TABLE_SIZE[(alphabetSizeLimit + 31) >> 5];
+ int[] group = new int[n + n * maxTableSize];
int next = n;
- for (int i = 0; i < n; i++) {
+ for (int i = 0; i < n; ++i) {
group[i] = next;
- Decode.readHuffmanCode(alphabetSize, group, next, s);
- next += HUFFMAN_TABLE_SIZE;
+ next += readHuffmanCode(alphabetSizeMax, alphabetSizeLimit, group, i, s);
}
return group;
}
@@ -717,6 +954,118 @@ final class Decode {
return result;
}
+ private static void doUseDictionary(State s, int fence) {
+ if (s.distance > MAX_ALLOWED_DISTANCE) {
+ throw new BrotliRuntimeException("Invalid backward reference");
+ }
+ int address = s.distance - s.maxDistance - 1 - s.cdTotalSize;
+ if (address < 0) {
+ initializeCompoundDictionaryCopy(s, -address - 1, s.copyLength);
+ s.runningState = COPY_FROM_COMPOUND_DICTIONARY;
+ } else {
+ // Force lazy dictionary initialization.
+ ByteBuffer dictionaryData = Dictionary.getData();
+ int wordLength = s.copyLength;
+ if (wordLength > Dictionary.MAX_DICTIONARY_WORD_LENGTH) {
+ throw new BrotliRuntimeException("Invalid backward reference"); // COV_NF_LINE
+ }
+ int shift = Dictionary.sizeBits[wordLength];
+ if (shift == 0) {
+ throw new BrotliRuntimeException("Invalid backward reference"); // COV_NF_LINE
+ }
+ int offset = Dictionary.offsets[wordLength];
+ int mask = (1 << shift) - 1;
+ int wordIdx = address & mask;
+ int transformIdx = address >>> shift;
+ offset += wordIdx * wordLength;
+ Transform.Transforms transforms = Transform.RFC_TRANSFORMS;
+ if (transformIdx >= transforms.numTransforms) {
+ throw new BrotliRuntimeException("Invalid backward reference"); // COV_NF_LINE
+ }
+ int len = Transform.transformDictionaryWord(s.ringBuffer, s.pos, dictionaryData,
+ offset, wordLength, transforms, transformIdx);
+ s.pos += len;
+ s.metaBlockLength -= len;
+ if (s.pos >= fence) {
+ s.nextRunningState = MAIN_LOOP;
+ s.runningState = INIT_WRITE;
+ return;
+ }
+ s.runningState = MAIN_LOOP;
+ }
+ }
+
+ private static void initializeCompoundDictionary(State s) {
+ s.cdBlockMap = new byte[1 << CD_BLOCK_MAP_BITS];
+ int blockBits = CD_BLOCK_MAP_BITS;
+ // If this function is executed, then s.cdTotalSize > 0.
+ while (((s.cdTotalSize - 1) >>> blockBits) != 0) {
+ blockBits++;
+ }
+ blockBits -= CD_BLOCK_MAP_BITS;
+ s.cdBlockBits = blockBits;
+ int cursor = 0;
+ int index = 0;
+ while (cursor < s.cdTotalSize) {
+ while (s.cdChunkOffsets[index + 1] < cursor) {
+ index++;
+ }
+ s.cdBlockMap[cursor >>> blockBits] = (byte) index;
+ cursor += 1 << blockBits;
+ }
+ }
+
+ private static void initializeCompoundDictionaryCopy(State s, int address, int length) {
+ if (s.cdBlockBits == -1) {
+ initializeCompoundDictionary(s);
+ }
+ int index = s.cdBlockMap[address >>> s.cdBlockBits];
+ while (address >= s.cdChunkOffsets[index + 1]) {
+ index++;
+ }
+ if (s.cdTotalSize > address + length) {
+ throw new BrotliRuntimeException("Invalid backward reference");
+ }
+ /* Update the recent distances cache */
+ s.distRbIdx = (s.distRbIdx + 1) & 0x3;
+ s.rings[s.distRbIdx] = s.distance;
+ s.metaBlockLength -= length;
+ s.cdBrIndex = index;
+ s.cdBrOffset = address - s.cdChunkOffsets[index];
+ s.cdBrLength = length;
+ s.cdBrCopied = 0;
+ }
+
+ private static int copyFromCompoundDictionary(State s, int fence) {
+ int pos = s.pos;
+ int origPos = pos;
+ while (s.cdBrLength != s.cdBrCopied) {
+ int space = fence - pos;
+ int chunkLength = s.cdChunkOffsets[s.cdBrIndex + 1] - s.cdChunkOffsets[s.cdBrIndex];
+ int remChunkLength = chunkLength - s.cdBrOffset;
+ int length = s.cdBrLength - s.cdBrCopied;
+ if (length > remChunkLength) {
+ length = remChunkLength;
+ }
+ if (length > space) {
+ length = space;
+ }
+ Utils.copyBytes(
+ s.ringBuffer, pos, s.cdChunks[s.cdBrIndex], s.cdBrOffset, s.cdBrOffset + length);
+ pos += length;
+ s.cdBrOffset += length;
+ s.cdBrCopied += length;
+ if (length == remChunkLength) {
+ s.cdBrIndex++;
+ s.cdBrOffset = 0;
+ }
+ if (pos >= fence) {
+ break;
+ }
+ }
+ return pos - origPos;
+ }
+
/**
* Actual decompress implementation.
*/
@@ -727,6 +1076,16 @@ final class Decode {
if (s.runningState == CLOSED) {
throw new IllegalStateException("Can't decompress after close");
}
+ if (s.runningState == INITIALIZED) {
+ int windowBits = decodeWindowBits(s);
+ if (windowBits == -1) { /* Reserved case for future expansion. */
+ throw new BrotliRuntimeException("Invalid 'windowBits' code");
+ }
+ s.maxRingBufferSize = 1 << windowBits;
+ s.maxBackwardDistance = s.maxRingBufferSize - 16;
+ s.runningState = BLOCK_START;
+ }
+
int fence = calculateFence(s);
int ringBufferMask = s.ringBufferSize - 1;
byte[] ringBuffer = s.ringBuffer;
@@ -761,23 +1120,21 @@ final class Decode {
}
s.commandBlockLength--;
BitReader.fillBitWindow(s);
- int cmdCode = readSymbol(s.hGroup1, s.treeCommandOffset, s);
- int rangeIdx = cmdCode >>> 6;
- s.distanceCode = 0;
- if (rangeIdx >= 2) {
- rangeIdx -= 2;
- s.distanceCode = -1;
- }
- int insertCode = INSERT_RANGE_LUT[rangeIdx] + ((cmdCode >>> 3) & 7);
+ int cmdCode = readSymbol(s.commandTreeGroup, s.commandTreeIdx, s) << 2;
+ short insertAndCopyExtraBits = CMD_LOOKUP[cmdCode];
+ int insertLengthOffset = CMD_LOOKUP[cmdCode + 1];
+ int copyLengthOffset = CMD_LOOKUP[cmdCode + 2];
+ s.distanceCode = CMD_LOOKUP[cmdCode + 3];
BitReader.fillBitWindow(s);
- int insertBits = INSERT_LENGTH_N_BITS[insertCode];
- int insertExtra = BitReader.readBits(s, insertBits);
- s.insertLength = INSERT_LENGTH_OFFSET[insertCode] + insertExtra;
- int copyCode = COPY_RANGE_LUT[rangeIdx] + (cmdCode & 7);
+ {
+ int extraBits = insertAndCopyExtraBits & 0xFF;
+ s.insertLength = insertLengthOffset + BitReader.readBits(s, extraBits);
+ }
BitReader.fillBitWindow(s);
- int copyBits = COPY_LENGTH_N_BITS[copyCode];
- int copyExtra = BitReader.readBits(s, copyBits);
- s.copyLength = COPY_LENGTH_OFFSET[copyCode] + copyExtra;
+ {
+ int extraBits = insertAndCopyExtraBits >> 8;
+ s.copyLength = copyLengthOffset + BitReader.readBits(s, extraBits);
+ }
s.j = 0;
s.runningState = INSERT_LOOP;
@@ -792,8 +1149,7 @@ final class Decode {
}
s.literalBlockLength--;
BitReader.fillBitWindow(s);
- ringBuffer[s.pos] =
- (byte) readSymbol(s.hGroup0, s.literalTree, s);
+ ringBuffer[s.pos] = (byte) readSymbol(s.literalTreeGroup, s.literalTreeIdx, s);
s.pos++;
s.j++;
if (s.pos >= fence) {
@@ -810,14 +1166,13 @@ final class Decode {
if (s.literalBlockLength == 0) {
decodeLiteralBlockSwitch(s);
}
- int literalTreeIndex = s.contextMap[s.contextMapSlice
- + (Context.LOOKUP[s.contextLookupOffset1 + prevByte1]
- | Context.LOOKUP[s.contextLookupOffset2 + prevByte2])] & 0xFF;
+ int literalContext = Context.LOOKUP[s.contextLookupOffset1 + prevByte1]
+ | Context.LOOKUP[s.contextLookupOffset2 + prevByte2];
+ int literalTreeIdx = s.contextMap[s.contextMapSlice + literalContext] & 0xFF;
s.literalBlockLength--;
prevByte2 = prevByte1;
BitReader.fillBitWindow(s);
- prevByte1 = readSymbol(
- s.hGroup0, s.hGroup0[literalTreeIndex], s);
+ prevByte1 = readSymbol(s.literalTreeGroup, literalTreeIdx, s);
ringBuffer[s.pos] = (byte) prevByte1;
s.pos++;
s.j++;
@@ -836,36 +1191,38 @@ final class Decode {
s.runningState = MAIN_LOOP;
continue;
}
- if (s.distanceCode < 0) {
+ int distanceCode = s.distanceCode;
+ if (distanceCode < 0) {
+ // distanceCode in untouched; assigning it 0 won't affect distance ring buffer rolling.
+ s.distance = s.rings[s.distRbIdx];
+ } else {
BitReader.readMoreInput(s);
if (s.distanceBlockLength == 0) {
decodeDistanceBlockSwitch(s);
}
s.distanceBlockLength--;
BitReader.fillBitWindow(s);
- s.distanceCode = readSymbol(s.hGroup2, s.hGroup2[
- s.distContextMap[s.distContextMapSlice
- + (s.copyLength > 4 ? 3 : s.copyLength - 2)] & 0xFF], s);
- if (s.distanceCode >= s.numDirectDistanceCodes) {
- s.distanceCode -= s.numDirectDistanceCodes;
- int postfix = s.distanceCode & s.distancePostfixMask;
- s.distanceCode >>>= s.distancePostfixBits;
- int n = (s.distanceCode >>> 1) + 1;
- int offset = ((2 + (s.distanceCode & 1)) << n) - 4;
- BitReader.fillBitWindow(s);
- int distanceExtra = BitReader.readBits(s, n);
- s.distanceCode = s.numDirectDistanceCodes + postfix
- + ((offset + distanceExtra) << s.distancePostfixBits);
+ int distTreeIdx = s.distContextMap[s.distContextMapSlice + distanceCode] & 0xFF;
+ distanceCode = readSymbol(s.distanceTreeGroup, distTreeIdx, s);
+ if (distanceCode < NUM_DISTANCE_SHORT_CODES) {
+ int index = (s.distRbIdx + DISTANCE_SHORT_CODE_INDEX_OFFSET[distanceCode]) & 0x3;
+ s.distance = s.rings[index] + DISTANCE_SHORT_CODE_VALUE_OFFSET[distanceCode];
+ if (s.distance < 0) {
+ throw new BrotliRuntimeException("Negative distance"); // COV_NF_LINE
+ }
+ } else {
+ int extraBits = s.distExtraBits[distanceCode];
+ int bits;
+ if (s.bitOffset + extraBits <= BitReader.BITNESS) {
+ bits = BitReader.readFewBits(s, extraBits);
+ } else {
+ BitReader.fillBitWindow(s);
+ bits = BitReader.readBits(s, extraBits);
+ }
+ s.distance = s.distOffset[distanceCode] + (bits << s.distancePostfixBits);
}
}
- // Convert the distance code to the actual distance by possibly looking up past distances
- // from the ringBuffer.
- s.distance = translateShortCodes(s.distanceCode, s.rings, s.distRbIdx);
- if (s.distance < 0) {
- throw new BrotliRuntimeException("Negative distance"); // COV_NF_LINE
- }
-
if (s.maxDistance != s.maxBackwardDistance
&& s.pos < s.maxBackwardDistance) {
s.maxDistance = s.pos;
@@ -874,13 +1231,13 @@ final class Decode {
}
if (s.distance > s.maxDistance) {
- s.runningState = TRANSFORM;
+ s.runningState = USE_DICTIONARY;
continue;
}
- if (s.distanceCode > 0) {
- s.rings[s.distRbIdx & 3] = s.distance;
- s.distRbIdx++;
+ if (distanceCode > 0) {
+ s.distRbIdx = (s.distRbIdx + 1) & 0x3;
+ s.rings[s.distRbIdx] = s.distance;
}
if (s.copyLength > s.metaBlockLength) {
@@ -897,7 +1254,10 @@ final class Decode {
int dstEnd = dst + copyLength;
if ((srcEnd < ringBufferMask) && (dstEnd < ringBufferMask)) {
if (copyLength < 12 || (srcEnd > dst && dstEnd > src)) {
- for (int k = 0; k < copyLength; ++k) {
+ for (int k = 0; k < copyLength; k += 4) {
+ ringBuffer[dst++] = ringBuffer[src++];
+ ringBuffer[dst++] = ringBuffer[src++];
+ ringBuffer[dst++] = ringBuffer[src++];
ringBuffer[dst++] = ringBuffer[src++];
}
} else {
@@ -925,31 +1285,16 @@ final class Decode {
}
continue;
- case TRANSFORM:
- if (s.copyLength >= MIN_WORD_LENGTH
- && s.copyLength <= MAX_WORD_LENGTH) {
- int offset = DICTIONARY_OFFSETS_BY_LENGTH[s.copyLength];
- int wordId = s.distance - s.maxDistance - 1;
- int shift = DICTIONARY_SIZE_BITS_BY_LENGTH[s.copyLength];
- int mask = (1 << shift) - 1;
- int wordIdx = wordId & mask;
- int transformIdx = wordId >>> shift;
- offset += wordIdx * s.copyLength;
- if (transformIdx < Transform.NUM_TRANSFORMS) {
- int len = Transform.transformDictionaryWord(ringBuffer, s.pos,
- Dictionary.getData(), offset, s.copyLength, transformIdx);
- s.pos += len;
- s.metaBlockLength -= len;
- if (s.pos >= fence) {
- s.nextRunningState = MAIN_LOOP;
- s.runningState = INIT_WRITE;
- continue;
- }
- } else {
- throw new BrotliRuntimeException("Invalid backward reference"); // COV_NF_LINE
- }
- } else {
- throw new BrotliRuntimeException("Invalid backward reference"); // COV_NF_LINE
+ case USE_DICTIONARY:
+ doUseDictionary(s, fence);
+ continue;
+
+ case COPY_FROM_COMPOUND_DICTIONARY:
+ s.pos += copyFromCompoundDictionary(s, fence);
+ if (s.pos >= fence) {
+ s.nextRunningState = COPY_FROM_COMPOUND_DICTIONARY;
+ s.runningState = INIT_WRITE;
+ return;
}
s.runningState = MAIN_LOOP;
continue;
@@ -965,7 +1310,6 @@ final class Decode {
s.runningState = BLOCK_START;
continue;
-
case COPY_UNCOMPRESSED:
copyUncompressedData(s);
continue;
diff --git a/java/org/brotli/dec/Dictionary.java b/java/org/brotli/dec/Dictionary.java
index a6867b7..043572f 100644
--- a/java/org/brotli/dec/Dictionary.java
+++ b/java/org/brotli/dec/Dictionary.java
@@ -18,7 +18,12 @@ import java.nio.ByteBuffer;
* once in each classworld). To avoid this, it is enough to call {@link #getData()} proactively.
*/
public final class Dictionary {
- private static volatile ByteBuffer data;
+ static final int MIN_DICTIONARY_WORD_LENGTH = 4;
+ static final int MAX_DICTIONARY_WORD_LENGTH = 31;
+
+ private static ByteBuffer data;
+ static final int[] offsets = new int[32];
+ static final int[] sizeBits = new int[32];
private static class DataLoader {
static final boolean OK;
@@ -34,10 +39,44 @@ public final class Dictionary {
}
}
- public static void setData(ByteBuffer data) {
+ public static void setData(ByteBuffer data, int[] sizeBits) {
if (!data.isDirect() || !data.isReadOnly()) {
throw new BrotliRuntimeException("data must be a direct read-only byte buffer");
}
+ // TODO: is that so?
+ if (sizeBits.length > MAX_DICTIONARY_WORD_LENGTH) {
+ throw new BrotliRuntimeException(
+ "sizeBits length must be at most " + MAX_DICTIONARY_WORD_LENGTH);
+ }
+ for (int i = 0; i < MIN_DICTIONARY_WORD_LENGTH; ++i) {
+ if (sizeBits[i] != 0) {
+ throw new BrotliRuntimeException("first " + MIN_DICTIONARY_WORD_LENGTH + " must be 0");
+ }
+ }
+ int[] dictionaryOffsets = Dictionary.offsets;
+ int[] dictionarySizeBits = Dictionary.sizeBits;
+ System.arraycopy(sizeBits, 0, dictionarySizeBits, 0, sizeBits.length);
+ int pos = 0;
+ int limit = data.capacity();
+ for (int i = 0; i < sizeBits.length; ++i) {
+ dictionaryOffsets[i] = pos;
+ int bits = dictionarySizeBits[i];
+ if (bits != 0) {
+ if (bits >= 31) {
+ throw new BrotliRuntimeException("sizeBits values must be less than 31");
+ }
+ pos += i << bits;
+ if (pos <= 0 || pos > limit) {
+ throw new BrotliRuntimeException("sizeBits is inconsistent: overflow");
+ }
+ }
+ }
+ for (int i = sizeBits.length; i < 32; ++i) {
+ dictionaryOffsets[i] = pos;
+ }
+ if (pos != limit) {
+ throw new BrotliRuntimeException("sizeBits is inconsistent: underflow");
+ }
Dictionary.data = data;
}
diff --git a/java/org/brotli/dec/DictionaryData.java b/java/org/brotli/dec/DictionaryData.java
index f969df3..db281e3 100644
--- a/java/org/brotli/dec/DictionaryData.java
+++ b/java/org/brotli/dec/DictionaryData.java
@@ -16,10 +16,25 @@ import java.nio.ByteBuffer;
final class DictionaryData {
private static final String DATA0 = "timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0\"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$('#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml\"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid=\"sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$(\"#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS\"agedgreyGET\"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:e*/\r\n 100hall.\n\nA7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,\r\n\r\ncoolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px''););\">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarmb\u0000\u0019sboys[0].');\"POSTbearkids);}}marytend(UK)quadzh:f-siz----prop');\rliftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene b\u0000\u0014softrometillross<h3>pourfadepink<tr>mini)|!(minezh:hbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json', 'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:d'));puremageparatonebond:37Z_of_']);000,zh:gtankyardbowlbush:56ZJava30px\n|}\n%C3%:34ZjeffEXPIcashvisagolfsnowzh:iquer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;\n}\nexit:35Zvarsbeat'});diet999;anne}}</[i].LangkmB2wiretoysaddssealalex;\n\t}echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$('.50pxPh.Dmiscalanloandeskmileryanunixdisc);}\ndustclip).\n\n70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}\r\nHEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-\n!002)ndow[1];[];\nLog salt\r\n\t\tbangtrimbath){\r\n00px\n});ko:lfeesad>\rs:// [];tollplug(){\n{\r\n .js'200pdualboat.JPG);\n}quot);\n\n');\n\r\n}\r201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomC!sesteestaperotodohacecadaaC1obiendC-aasC-vidacasootroforosolootracualdijosidograntipotemadebealgoquC)estonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiP7P0P=P0P>P<Q\u0000P0Q\u0000Q\u0003Q\u0002P0P=P5P?P>P>Q\u0002P8P7P=P>P4P>Q\u0002P>P6P5P>P=P8Q\u0005P\u001DP0P5P5P1Q\u000BP<Q\u000BP\u0012Q\u000BQ\u0001P>P2Q\u000BP2P>P\u001DP>P>P1P\u001FP>P;P8P=P8P P$P\u001DP5P\u001CQ\u000BQ\u0002Q\u000BP\u001EP=P8P<P4P0P\u0017P0P\u0014P0P\u001DQ\u0003P\u001EP1Q\u0002P5P\u0018P7P5P9P=Q\u0003P<P<P\"Q\u000BQ\u0003P6Y\u0001Y\nX#Y\u0006Y\u0005X'Y\u0005X9Y\u0003Y\u0004X#Y\u0008X1X/Y\nX'Y\u0001Y\tY\u0007Y\u0008Y\u0004Y\u0005Y\u0004Y\u0003X'Y\u0008Y\u0004Y\u0007X(X3X'Y\u0004X%Y\u0006Y\u0007Y\nX#Y\nY\u0002X/Y\u0007Y\u0004X+Y\u0005X(Y\u0007Y\u0004Y\u0008Y\u0004Y\nX(Y\u0004X'Y\nX(Y\u0003X4Y\nX'Y\u0005X#Y\u0005Y\u0006X*X(Y\nY\u0004Y\u0006X-X(Y\u0007Y\u0005Y\u0005X4Y\u0008X4firstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue\"crossspentblogsbox\">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav\">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera\"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow\">genretrucklooksValueFrame.net/-->\n<try {\nvar makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top\">\n<!--POST\"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url=\"parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();\" Blocklinuxjonespixel');\">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar\">.src=toweralt=\"cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});\r\nbandsqueue= {};80px;cking{\r\n\t\taheadclockirishlike ratiostatsForm\"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg\"spainbeachtaxesmicroangel--></giftssteve-linkbody.});\n\tmount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:c\u0002simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/\"1.jpgwmodeparamSTARTleft idden, 201);\n}\nform.viruschairtransworstPagesitionpatch<!--\no-cacfirmstours,000 asiani++){adobe')[0]id=10both;menu .2.mi.png\"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120\" sweettr>\r\nname=diegopage swiss-->\n\n#fff;\">Log.com\"treatsheet) && 14px;sleepntentfiledja:c\u0003id=\"cName\"worseshots-box-delta\n&lt;bears:48Z<data-rural</a> spendbakershops= \"\";php\">ction13px;brianhellosize=o=%2F joinmaybe<img img\">, fjsimg\" \")[0]MTopBType\"newlyDanskczechtrailknows</h5>faq\">zh-cn10);\n-1\");type=bluestrulydavis.js';>\r\n<!steel you h2>\r\nform jesus100% menu.\r\n\t\r\nwalesrisksumentddingb-likteachgif\" vegasdanskeestishqipsuomisobredesdeentretodospuedeaC1osestC!tienehastaotrospartedondenuevohacerformamismomejormundoaquC-dC-assC3loayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaC-snuevasaludforosmedioquienmesespoderchileserC!vecesdecirjosC)estarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocC3moenerojuegoperC:haberestoynuncamujervalorfueralibrogustaigualvotoscasosguC-apuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleC3nplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenC!readiscopedrocercapuedapapelmenorC:tilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniC1oquedapasarbancohijosviajepabloC)stevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallC-jovendichaestantalessalirsuelopesosfinesllamabuscoC)stalleganegroplazahumorpagarjuntadobleislasbolsabaC1ohablaluchaC\u0001readicenjugarnotasvalleallC!cargadolorabajoestC)gustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo\">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother\" id=\"marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo\" bottomlist\">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename=\"amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.\n\nOnejoinedmenu\">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo\">beyond-scaleacceptservedmarineFootercamera</h1>\n_form\"leavesstress\" />\r\n.gif\" onloadloaderOxfordsistersurvivlistenfemaleDesignsize=\"appealtext\">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main\">inlinesundaywrap\">failedcensusminutebeaconquotes150px|estateremoteemail\"linkedright;signalformal1.htmlsignupprincefloat:.png\" forum.AccesspaperssoundsextendHeightsliderUTF-8\"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome\">headerensurebranchpiecesblock;statedtop\"><racingresize--&gt;pacitysexualbureau.jpg\" 10,000obtaintitlesamount, Inc.comedymenu\" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page\">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline\">body\">\n* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox\">\nSystem DavidcancertablesprovedApril reallydriveritem\">more\">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php\" assumelayerswilsonstoresreliefswedenCustomeasily your String\n\nWhiltaylorclear:resortfrenchthough\") + \"<body>buyingbrandsMembername\">oppingsector5px;\">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink\">Images=falsewhile hspace0&amp; \n\nIn powerPolski-colorjordanBottomStart -count2.htmlnews\">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml\" rights.html-blockregExp:hoverwithinvirginphones</tr>\rusing \n\tvar >');\n\t</td>\n</tr>\nbahasabrasilgalegomagyarpolskisrpskiX1X/Y\u0008d8-f\u0016\u0007g.\u0000d=\u0013g9\u0001i+\u0014d?!f\u0001/d8-e\u001B=f\u0008\u0011d;,d8\u0000d8*e\u0005,e\u000F8g.!g\u0010\u0006h.:e\u001D\u001Be\u000F/d;%f\u001C\re\n!f\u00176i\u00174d8*d::d:'e\u0013\u0001h\u0007*e71d<\u0001d8\u001Af\u001F%g\u001C\u000Be7%d=\u001Ch\u0001\u0014g3;f2!f\u001C\tg=\u0011g+\u0019f\t\u0000f\u001C\th/\u0004h.:d8-e?\u0003f\u0016\u0007g+ g\u0014(f\u00087i&\u0016i!5d=\u001Ch\u0000\u0005f\n\u0000f\u001C/i\u0017.i\"\u0018g\u001B8e\u00053d8\u000Bh==f\u0010\u001Cg4\"d=?g\u0014(h=/d;6e\u001C(g:?d8;i\"\u0018h5\u0004f\u0016\u0019h'\u0006i\"\u0011e\u001B\u001Ee$\rf3(e\u0006\u000Cg=\u0011g;\u001Cf\u00146h\u0017\u000Fe\u0006\u0005e.9f\u000E(h\r\u0010e8\u0002e\u001C:f6\u0008f\u0001/g):i\u00174e\u000F\u0011e8\u0003d;\u0000d9\u0008e%=e\u000F\u000Bg\u0014\u001Ff4;e\u001B>g\t\u0007e\u000F\u0011e1\u0015e&\u0002f\u001E\u001Cf\t\u000Bf\u001C:f\u00160i\u0017;f\u001C\u0000f\u00160f\u00169e<\u000Fe\u000C\u0017d:,f\u000F\u0010d>\u001Be\u00053d:\u000Ef\u001B4e$\u001Ah?\u0019d8*g3;g;\u001Fg\u001F%i\u0001\u0013f88f\u0008\u000Fe9?e\u0011\ne\u00056d;\u0016e\u000F\u0011h!(e.\te\u0005(g,,d8\u0000d<\u001Ae\u0011\u0018h?\u001Bh!\u000Cg\u00029e\u0007;g\t\u0008f\u001D\u0003g\u00145e-\u0010d8\u0016g\u0015\u000Ch.>h.!e\u0005\rh49f\u0015\u0019h\u00022e\n e\u0005%f4;e\n(d;\u0016d;,e\u0015\u0006e\u0013\u0001e\r\u001Ae.\"g\u000E0e\u001C(d8\nf57e&\u0002d=\u0015e72g;\u000Fg\u0015\u0019h(\u0000h/&g;\u0006g$>e\u000C:g\u0019;e=\u0015f\u001C,g+\u0019i\u001C\u0000h&\u0001d;7f <f\u0014/f\u000C\u0001e\u001B=i\u0019\u0005i\u0013>f\u000E%e\u001B=e.6e;:h.>f\u001C\u000Be\u000F\u000Bi\u0018\u0005h/;f3\u0015e>\u000Bd=\rg=.g;\u000Ff5\u000Ei\u0000\tf\u000B)h?\u0019f 7e=\u0013e\t\re\u0008\u0006g1;f\u000E\u0012h!\u000Ce\u001B d8:d:$f\u0018\u0013f\u001C\u0000e\u0010\u000Ei\u001F3d9\u0010d8\rh\u0003=i\u0000\u001Ah?\u0007h!\u000Cd8\u001Ag'\u0011f\n\u0000e\u000F/h\u0003=h.>e$\u0007e\u0010\u0008d=\u001Ce$'e.6g$>d<\u001Ag \u0014g)6d8\u0013d8\u001Ae\u0005(i\u0003(i!9g\u001B.h?\u0019i\u0007\u000Ch?\u0018f\u0018/e<\u0000e'\u000Bf\u0003\u0005e\u00065g\u00145h\u0004\u0011f\u0016\u0007d;6e\u0013\u0001g\t\u000Ce8.e\n)f\u0016\u0007e\u000C\u0016h5\u0004f:\u0010e$'e-&e-&d9 e\u001C0e\u001D\u0000f5\u000Fh'\u0008f\n\u0015h5\u0004e7%g(\u000Bh&\u0001f1\u0002f\u0000\u000Ed9\u0008f\u00176e\u0000\u0019e\n\u001Fh\u0003=d8;h&\u0001g\u001B.e\t\rh5\u0004h./e\u001F\u000Ee8\u0002f\u00169f3\u0015g\u00145e=1f\u000B\u001Bh\u0001\u0018e#0f\u0018\u000Ed;;d=\u0015e\u0001%e:7f\u00150f\r.g>\u000Ee\u001B=f1=h=&d;\u000Bg;\rd=\u0006f\u0018/d:$f5\u0001g\u0014\u001Fd:'f\t\u0000d;%g\u00145h/\u001Df\u0018>g$:d8\u0000d:\u001Be\r\u0015d=\rd::e\u0011\u0018e\u0008\u0006f\u001E\u0010e\u001C0e\u001B>f\u0017\u0005f88e7%e\u00057e-&g\u0014\u001Fg3;e\u0008\u0017g=\u0011e\u000F\u000Be8\u0016e-\u0010e/\u0006g \u0001i\"\u0011i\u0001\u0013f\u000E'e\u00086e\u001C0e\u000C:e\u001F:f\u001C,e\u0005(e\u001B=g=\u0011d8\ni\u0007\rh&\u0001g,,d:\u000Ce\u0016\u001Cf,\"h?\u001Be\u0005%e\u000F\u000Bf\u0003\u0005h?\u0019d:\u001Bh\u0000\u0003h/\u0015e\u000F\u0011g\u000E0e\u001F9h.-d;%d8\nf\u0014?e:\u001Cf\u0008\u0010d8:g\u000E/e\"\u0003i&\u0019f8/e\u0010\u000Cf\u00176e(1d9\u0010e\u000F\u0011i\u0000\u0001d8\u0000e.\u001Ae<\u0000e\u000F\u0011d=\u001Ce\u0013\u0001f \u0007e\u0007\u0006f,\"h?\u000Eh'#e\u00063e\u001C0f\u00169d8\u0000d8\u000Bd;%e\u000F\nh4#d;;f\u0008\u0016h\u0000\u0005e.\"f\u00087d;#h!(g'/e\u0008\u0006e%3d::f\u00150g \u0001i\u0014\u0000e\u0014.e\u0007:g\u000E0g&;g:?e:\u0014g\u0014(e\u0008\u0017h!(d8\re\u0010\u000Cg<\u0016h>\u0011g;\u001Fh.!f\u001F%h/\"d8\rh&\u0001f\u001C\te\u00053f\u001C:f\u001E\u0004e>\u0008e$\u001Af\u0012-f\u0014>g;\u0004g;\u0007f\u0014?g-\u0016g\u001B4f\u000E%h\u0003=e\n\u001Bf\u001D%f:\u0010f\u0019\u0002i\u0016\u0013g\u001C\u000Be\u00080g\u0003-i\u0017(e\u00053i\u0014.d8\u0013e\u000C:i\u001D\u001Ee88h\u000B1h/-g\u0019>e:&e8\u000Cf\u001C\u001Bg>\u000Ee%3f/\u0014h>\u0003g\u001F%h/\u0006h'\u0004e.\u001Ae;:h..i\u0003(i\u0017(f\u0004\u000Fh'\u0001g2>e=)f\u0017%f\u001C,f\u000F\u0010i+\u0018e\u000F\u0011h(\u0000f\u00169i\u001D\"e\u001F:i\u0007\u0011e$\u0004g\u0010\u0006f\u001D\u0003i\u0019\u0010e=1g\t\u0007i\u00136h!\u000Ch?\u0018f\u001C\te\u0008\u0006d:+g\t)e\u0013\u0001g;\u000Fh\u0010%f7;e\n d8\u0013e.6h?\u0019g'\rh/\u001Di\"\u0018h57f\u001D%d8\u001Ae\n!e\u0005,e\u0011\nh.0e=\u0015g.\u0000d;\u000Bh4(i\u0007\u000Fg\u00147d::e=1e\u0013\re<\u0015g\u0014(f\n%e\u0011\ni\u0003(e\u0008\u0006e?+i\u0000\u001Fe\u0012(h/\"f\u00176e0\u001Af3(f\u0004\u000Fg\u00143h/7e-&f !e:\u0014h/%e\u000E\u0006e\u000F2e\u000F*f\u0018/h?\u0014e\u001B\u001Eh4-d90e\u0010\rg'0d8:d:\u0006f\u0008\u0010e\n\u001Fh/4f\u0018\u000Ed>\u001Be:\u0014e-)e-\u0010d8\u0013i\"\u0018g(\u000Be:\u000Fd8\u0000h\u0008,f\u001C\u0003e\u0013!e\u000F*f\u001C\te\u00056e.\u0003d?\u001Df\n$h\u0000\u000Cd8\u0014d;\ne$)g*\u0017e\u000F#e\n(f\u0000\u0001g\n6f\u0000\u0001g\t9e\u0008+h.$d8:e?\u0005i!;f\u001B4f\u00160e0\u000Fh/4f\u0008\u0011e\u0000\u0011d=\u001Cd8:e*\u0012d=\u0013e\u000C\u0005f\u000B,i\u0002#d9\u0008d8\u0000f 7e\u001B=e\u0006\u0005f\u0018/e\u0010&f 9f\r.g\u00145h'\u0006e-&i\u0019\"e\u00057f\u001C\th?\u0007g(\u000Bg\u00141d:\u000Ed::f\t\re\u0007:f\u001D%d8\rh?\u0007f-#e\u001C(f\u0018\u000Ef\u0018\u001Ff\u0015\u0005d:\u000Be\u00053g3;f \u0007i\"\u0018e\u0015\u0006e\n!h>\u0013e\u0005%d8\u0000g\u001B4e\u001F:g!\u0000f\u0015\u0019e-&d:\u0006h'#e;:g-\u0011g;\u0013f\u001E\u001Ce\u0005(g\u0010\u0003i\u0000\u001Ag\u001F%h.!e\u0008\u0012e/9d:\u000Eh\t:f\u001C/g\u001B8e\u0006\u000Ce\u000F\u0011g\u0014\u001Fg\u001C\u001Fg\u001A\u0004e;:g+\u000Bg-\tg:'g1;e\u001E\u000Bg;\u000Fi*\u000Ce.\u001Eg\u000E0e\u00086d=\u001Cf\u001D%h\u0007*f \u0007g->d;%d8\u000Be\u000E\u001Fe\u0008\u001Bf\u0017 f3\u0015e\u00056d8-e\u0000\u000Bd::d8\u0000e\u0008\u0007f\u000C\u0007e\r\u0017e\u00053i\u0017-i\u001B\u0006e\u001B\"g,,d8\te\u00053f3(e\u001B f-$g\u0005'g\t\u0007f71e\u001C3e\u0015\u0006d8\u001Ae9?e7\u001Ef\u0017%f\u001C\u001Fi+\u0018g:'f\u001C\u0000h?\u0011g;<e\u0010\u0008h!(g$:d8\u0013h>\u0011h!\u000Cd8:d:$i\u0000\u001Ah/\u0004d;7h'\te>\u0017g2>e\r\u000Ee.6e:-e.\u000Cf\u0008\u0010f\u0004\u001Fh'\te.\th#\u0005e>\u0017e\u00080i\u0002.d;6e\u00086e:&i#\u001Fe\u0013\u0001h\u0019=g\u00046h=,h==f\n%d;7h.0h\u0000\u0005f\u00169f!\u0008h!\u000Cf\u0014?d::f0\u0011g\u0014(e\u0013\u0001d8\u001Ch%?f\u000F\u0010e\u0007:i\u0005\u0012e:\u0017g\u00046e\u0010\u000Ed;\u0018f,>g\u0003-g\u00029d;%e\t\re.\u000Ce\u0005(e\u000F\u0011e8\u0016h.>g=.i\"\u0006e/<e7%d8\u001Ae\u000C;i\u0019\"g\u001C\u000Bg\u001C\u000Bg;\u000Fe\u00058e\u000E\u001Fe\u001B e93e\u000F0e\u0010\u0004g'\re\"\u001Ee\n f\u001D\u0010f\u0016\u0019f\u00160e\"\u001Ed9\u000Be\u0010\u000Eh\u0001\u000Cd8\u001Af\u0015\u0008f\u001E\u001Cd;\ne94h.:f\u0016\u0007f\u0008\u0011e\u001B=e\u0011\nh/\tg\t\u0008d8;d?.f\u00149e\u000F\u0002d8\u000Ef\t\u0013e\r0e?+d9\u0010f\u001C:f\"0h'\u0002g\u00029e-\u0018e\u001C(g2>g%\u001Eh\u000E7e>\u0017e\u0008)g\u0014(g;'g;-d= d;,h?\u0019d9\u0008f(!e<\u000Fh/-h(\u0000h\u0003=e$\u001Fi\u001B\u0005h\u0019\u000Ef\u0013\rd=\u001Ci#\u000Ef <d8\u0000h57g'\u0011e-&d=\u0013h\u00022g\u001F-d?!f\u001D!d;6f2;g\u0016\u0017h?\u0010e\n(d:'d8\u001Ad<\u001Ah..e/<h\u0008*e\u0005\u0008g\u0014\u001Fh\u0001\u0014g\u001B\u001Fe\u000F/f\u0018/e\u0015\u000Fi!\u000Cg;\u0013f\u001E\u0004d=\u001Cg\u0014(h0\u0003f\u001F%h3\u0007f\u0016\u0019h\u0007*e\n(h4\u001Fh4#e\u0006\u001Cd8\u001Ah.?i\u0017.e.\u001Ef\u0016=f\u000E%e\u000F\u0017h.(h.:i\u0002#d8*e\u000F\ri&\u0008e\n e<:e%3f\u0000'h\u000C\u0003e\u001B4f\u001C\re\u000B\u0019d<\u0011i\u00172d;\nf\u0017%e.\"f\u001C\rh'\u0000g\u001C\u000Be\u000F\u0002e\n g\u001A\u0004h/\u001Dd8\u0000g\u00029d?\u001Dh/\u0001e\u001B>d9&f\u001C\tf\u0015\u0008f5\u000Bh/\u0015g';e\n(f\t\rh\u0003=e\u00063e.\u001Ah\u0002!g%(d8\rf\u0016-i\u001C\u0000f1\u0002d8\re>\u0017e\n\u001Ef3\u0015d9\u000Bi\u00174i\u0007\u0007g\u0014(h\u0010%i\u0014\u0000f\n\u0015h/\tg\u001B.f \u0007g\u00081f\u0003\u0005f\u0011\u0004e=1f\u001C\td:\u001Bh$\u0007h#=f\u0016\u0007e-&f\u001C:d<\u001Af\u00150e-\u0017h#\u0005d?.h4-g\t)e\u0006\u001Cf\u001D\u0011e\u0005(i\u001D\"g2>e\u0013\u0001e\u00056e.\u001Ed:\u000Bf\u0003\u0005f04e93f\u000F\u0010g$:d8\ne8\u0002h0\"h0\"f\u0019.i\u0000\u001Af\u0015\u0019e8\u0008d8\nd< g1;e\u0008+f-\u000Cf\u001B2f\u000B%f\u001C\te\u0008\u001Bf\u00160i\u0005\rd;6e\u000F*h&\u0001f\u00176d;#h3\u0007h(\nh>>e\u00080d::g\u0014\u001Fh.\"i\u0018\u0005h\u0000\u0001e8\u0008e1\u0015g$:e?\u0003g\u0010\u0006h44e-\u0010g62g+\u0019d8;i!\u000Ch\u0007*g\u00046g:'e\u0008+g.\u0000e\r\u0015f\u00149i\u001D)i\u0002#d:\u001Bf\u001D%h/4f\t\u0013e<\u0000d;#g \u0001e\u0008 i\u0019$h/\u0001e\u00088h\n\u0002g\u001B.i\u0007\rg\u00029f,!f\u00158e$\u001Ae0\u0011h'\u0004e\u0008\u0012h5\u0004i\u0007\u0011f\t>e\u00080d;%e\u0010\u000Ee$'e\u0005(d8;i!5f\u001C\u0000d=3e\u001B\u001Eg-\u0014e$)d8\u000Bd?\u001Di\u001A\u001Cg\u000E0d;#f#\u0000f\u001F%f\n\u0015g%(e0\u000Ff\u00176f2\u0012f\u001C\tf-#e88g\u0014\u001Ah\u00073d;#g\u0010\u0006g\u001B.e=\u0015e\u0005,e<\u0000e$\re\u00086i\u0007\u0011h\u001E\re98g&\u000Fg\t\u0008f\u001C,e=\"f\u0008\u0010e\u0007\u0006e$\u0007h!\u000Cf\u0003\u0005e\u001B\u001Ee\u00080f\u0000\u001Df\u00033f\u0000\u000Ef 7e\r\u000Fh..h.$h/\u0001f\u001C\u0000e%=d:'g\u0014\u001Ff\u000C\tg\u0005'f\u001C\rh#\u0005e9?d8\u001Ce\n(f<+i\u0007\u0007h4-f\u00160f\t\u000Bg;\u0004e\u001B>i\u001D\"f\u001D?e\u000F\u0002h\u0000\u0003f\u0014?f2;e.9f\u0018\u0013e$)e\u001C0e\n*e\n\u001Bd::d;,e\r\u0007g:'i\u0000\u001Fe:&d::g\t)h0\u0003f\u00154f5\u0001h!\u000Ci\u0000 f\u0008\u0010f\u0016\u0007e-\u0017i\u001F)e\u001B=h48f\u0018\u0013e<\u0000e1\u0015g\u001B8i\u0017\u001Ch!(g\u000E0e=1h'\u0006e&\u0002f-$g>\u000Ee.9e$'e0\u000Ff\n%i\u0001\u0013f\u001D!f,>e?\u0003f\u0003\u0005h.8e$\u001Af3\u0015h'\u0004e.6e1\u0005d9&e:\u0017h?\u001Ef\u000E%g+\u000Be\r3d8>f\n%f\n\u0000e7'e%%h?\u0010g\u0019;e\u0005%d;%f\u001D%g\u0010\u0006h.:d:\u000Bd;6h\u0007*g\u00141d8-e\r\u000Ee\n\u001Ee\u0005,e&\u0008e&\u0008g\u001C\u001Ff-#d8\ri\u0014\u0019e\u0005(f\u0016\u0007e\u0010\u0008e\u0010\u000Cd;7e\u0000<e\u0008+d::g\u001B\u0011g\u001D#e\u00057d=\u0013d8\u0016g:*e\u001B\"i\u0018\u001Fe\u0008\u001Bd8\u001Af\t?f\u000B\u0005e\"\u001Ei\u0015?f\u001C\td::d?\u001Df\u000C\u0001e\u0015\u0006e.6g;4d?.e\u000F0f9>e7&e\u000F3h\u0002!d;=g-\u0014f!\u0008e.\u001Ei\u0019\u0005g\u00145d?!g;\u000Fg\u0010\u0006g\u0014\u001Fe\u0011=e.#d< d;;e\n!f-#e<\u000Fg\t9h\t2d8\u000Bf\u001D%e\r\u000Fd<\u001Ae\u000F*h\u0003=e=\u0013g\u00046i\u0007\rf\u00160e\u0005'e.9f\u000C\u0007e/<h?\u0010h!\u000Cf\u0017%e?\u0017h3#e.6h6\u0005h?\u0007e\u001C\u001Fe\u001C0f5\u0019f1\u001Ff\u0014/d;\u0018f\u000E(e\u0007:g+\u0019i\u0015?f\u001D-e7\u001Ef\t'h!\u000Ce\u00086i\u0000 d9\u000Bd8\u0000f\u000E(e9?g\u000E0e\u001C:f\u000F\u000Fh?0e\u000F\u0018e\u000C\u0016d< g;\u001Ff-\u000Cf\t\u000Bd?\u001Di\u0019)h/>g(\u000Be\u000C;g\u0016\u0017g;\u000Fh?\u0007h?\u0007e\u000E;d9\u000Be\t\rf\u00146e\u0005%e94e:&f\u001D\u0002e?\u0017g>\u000Ed8=f\u001C\u0000i+\u0018g\u0019;i\u0019\u0006f\u001C*f\u001D%e\n e7%e\u0005\rh4#f\u0015\u0019g(\u000Bg\t\u0008e\u001D\u0017h:+d=\u0013i\u0007\re:\u0006e\u0007:e\u0014.f\u0008\u0010f\u001C,e=\"e<\u000Fe\u001C\u001Fh1\u0006e\u0007:e\u00039d8\u001Cf\u00169i\u0002.g.1e\r\u0017d:,f1\u0002h\u0001\u000Ce\u000F\u0016e>\u0017h\u0001\u000Cd=\rg\u001B8d?!i!5i\u001D\"e\u0008\u0006i\u0012\u001Fg=\u0011i!5g!.e.\u001Ae\u001B>d>\u000Bg=\u0011e\u001D\u0000g'/f\u001E\u0001i\u0014\u0019h//g\u001B.g\u001A\u0004e.\u001Dh4\u001Df\u001C:e\u00053i#\u000Ei\u0019)f\u000E\u0008f\u001D\u0003g\u0017\u0005f/\u0012e. g\t)i\u0019$d:\u0006h)\u0015h+\u0016g\u0016>g\u0017\u0005e\u000F\nf\u00176f1\u0002h4-g+\u0019g\u00029e\u0004?g+%f/\u000Fe$)d8-e$.h.$h/\u0006f/\u000Fd8*e$)f4%e-\u0017d=\u0013e\u000F0g\u0001#g;4f\n$f\u001C,i!5d8*f\u0000'e.\u0018f\u00169e88h'\u0001g\u001B8f\u001C:f\u0008\u0018g\u0015%e:\u0014e=\u0013e>\u000Be8\u0008f\u00169d>?f !e\u001B-h\u0002!e8\u0002f\u0008?e1\u000Bf \u000Fg\u001B.e\u0011\u0018e7%e/<h\u00074g*\u0001g\u00046i\u0001\u0013e\u00057f\u001C,g=\u0011g;\u0013e\u0010\u0008f!#f!\u0008e\n3e\n(e\u000F&e$\u0016g>\u000Ee\u0005\u0003e<\u0015h57f\u00149e\u000F\u0018g,,e\u001B\u001Bd<\u001Ah.!h**f\u0018\u000Ei\u001A\u0010g'\u0001e.\u001De.\u001Dh'\u0004h\u000C\u0003f6\u0008h49e\u00051e\u0010\u000Ce?\u0018h.0d=\u0013g3;e8&f\u001D%e\u0010\re-\u0017g\u0019<h!(e<\u0000f\u0014>e\n g\u001B\u001Fe\u000F\u0017e\u00080d:\u000Cf\t\u000Be$'i\u0007\u000Ff\u0008\u0010d::f\u00150i\u0007\u000Fe\u00051d:+e\u000C:e\u001F\u001Fe%3e-)e\u000E\u001Fe\u0008\u0019f\t\u0000e\u001C(g;\u0013f\u001D\u001Fi\u0000\u001Ad?!h6\u0005g:'i\u0005\rg=.e=\u0013f\u00176d<\u0018g'\u0000f\u0000'f\u0004\u001Ff\u0008?d:'i\u0001\nf\u00082e\u0007:e\u000F#f\u000F\u0010d:$e01d8\u001Ad?\u001De\u0001%g(\u000Be:&e\u000F\u0002f\u00150d:\u000Bd8\u001Af\u00154d8*e11d8\u001Cf\u0003\u0005f\u0004\u001Fg\t9f.\ne\u0008\u0006i!\u001Ef\u0010\u001Ce0\u000Be1\u001Ed:\u000Ei\u0017(f\u00087h4\"e\n!e#0i\u001F3e\u000F\ne\u00056h4\"g;\u000Fe\u001D\u001Af\u000C\u0001e92i\u0003(f\u0008\u0010g+\u000Be\u0008)g\u001B\nh\u0000\u0003h\u0019\u0011f\u0008\u0010i\u0003=e\u000C\u0005h#\u0005g\u0014(f\u00086f/\u0014h5\u001Bf\u0016\u0007f\u0018\u000Ef\u000B\u001Be\u0015\u0006e.\u000Cf\u00154g\u001C\u001Ff\u0018/g\u001C<g\u001D\u001Bd<\u0019d<4e(\u0001f\u001C\u001Bi\"\u0006e\u001F\u001Fe\r+g\u0014\u001Fd<\u0018f\u0003 h+\u0016e#\u0007e\u0005,e\u00051h\t/e%=e\u0005\u0005e\u0008\u0006g,&e\u0010\u0008i\u0019\u0004d;6g\t9g\u00029d8\re\u000F/h\u000B1f\u0016\u0007h5\u0004d:'f 9f\u001C,f\u0018\u000Ef\u0018>e/\u0006g\"<e\u0005,d<\u0017f0\u0011f\u0017\u000Ff\u001B4e\n d:+e\u000F\u0017e\u0010\u000Ce-&e\u0010/e\n(i\u0000\u0002e\u0010\u0008e\u000E\u001Ff\u001D%i\u0017.g-\u0014f\u001C,f\u0016\u0007g>\u000Ei#\u001Fg;?h\t2g(3e.\u001Ag;\u0008d:\u000Eg\u0014\u001Fg\t)d>\u001Bf1\u0002f\u0010\u001Cg\u000B\u0010e\n\u001Bi\u0007\u000Fd8%i\u0007\rf08h?\u001Ce\u0006\u0019g\u001C\u001Ff\u001C\ti\u0019\u0010g+\u001Ed:\te/9h1!h49g\u0014(d8\re%=g;\u001De/9e\r\u0001e\u0008\u0006d?\u0003h?\u001Bg\u00029h/\u0004e=1i\u001F3d<\u0018e\n?d8\re0\u0011f,#h5\u000Fe96d8\u0014f\u001C\tg\u00029f\u00169e\u0010\u0011e\u0005(f\u00160d?!g\u0014(h.>f\u0016=e=\"h1!h5\u0004f <g*\u0001g 4i\u001A\u000Fg\u001D\u0000i\u0007\re$'d:\u000Ef\u0018/f/\u0015d8\u001Af\u0019:h\u0003=e\u000C\u0016e7%e.\u000Cg>\u000Ee\u0015\u0006e\u001F\u000Eg;\u001Fd8\u0000e\u0007:g\t\u0008f\t\u0013i\u0000 g\u0014\"e\u0013\u0001f&\u0002e\u00065g\u0014(d:\u000Ed?\u001Dg\u0015\u0019e\u001B g4 d8-e\u001C\u000Be-\u0018e\u0002(h44e\u001B>f\u001C\u0000f\u0004\u001Bi\u0015?f\u001C\u001Fe\u000F#d;7g\u0010\u0006h4\"e\u001F:e\u001C0e.\tf\u000E\u0012f-&f1\ti\u0007\u000Ci\u001D\"e\u0008\u001Be;:e$)g):i&\u0016e\u0005\u0008e.\u000Ce\u0016\u0004i)1e\n(d8\u000Bi\u001D\"d8\re\u0006\rh/\u001Ad?!f\u0004\u000Fd9\ti\u00183e\u0005\th\u000B1e\u001B=f<\u0002d:.e\u0006\u001Bd:\u000Bg\u000E)e.6g>$d<\u0017e\u0006\u001Cf0\u0011e\r3e\u000F/e\u0010\rg(1e.6e\u00057e\n(g\u0014;f\u00033e\u00080f3(f\u0018\u000Ee0\u000Fe-&f\u0000'h\u0003=h\u0000\u0003g \u0014g!,d;6h'\u0002g\u001C\u000Bf8\u0005f%\u001Af\u0010\u001Eg,\u0011i&\u0016i \u0001i;\u0004i\u0007\u0011i\u0000\u0002g\u0014(f1\u001Fh\u000B\u000Fg\u001C\u001Fe.\u001Ed8;g.!i\u00186f.5h(;e\u0006\ng?;h/\u0011f\u001D\u0003e\u0008)e\u0001\u001Ae%=d<<d9\u000Ei\u0000\u001Ah./f\u0016=e7%g\u000B\u0000f\u0005\u000Bd9\u001Fh.8g\u000E/d?\u001De\u001F9e\u0005;f&\u0002e?5e$'e\u001E\u000Bf\u001C:g%(g\u0010\u0006h'#e\u000C?e\u0010\rcuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestC!nnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegC:nbuenosvolverpuntossemanahabC-aagostonuevosunidoscarlosequiponiC1osmuchosalgunacorreoimagenpartirarribamarC-ahombreempleoverdadcambiomuchasfueronpasadolC-neaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposserC!neuropamediosfrenteacercademC!sofertacochesmodeloitalialetrasalgC:ncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrC!puestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosC:nicocaminositiosrazC3ndebidopruebatoledotenC-ajesC:sesperococinaorigentiendacientocC!dizhablarserC-alatinafuerzaestiloguerraentrarC)xitolC3pezagendavC-deoevitarpaginametrosjavierpadresfC!cilcabezaC!reassalidaenvC-ojapC3nabusosbienestextosllevarpuedanfuertecomC:nclaseshumanotenidobilbaounidadestC!seditarcreadoP4P;Q\u000FQ\u0007Q\u0002P>P:P0P:P8P;P8Q\rQ\u0002P>P2Q\u0001P5P5P3P>P?Q\u0000P8Q\u0002P0P:P5Q\tP5Q\u0003P6P5P\u001AP0P:P1P5P7P1Q\u000BP;P>P=P8P\u0012Q\u0001P5P?P>P4P-Q\u0002P>Q\u0002P>P<Q\u0007P5P<P=P5Q\u0002P;P5Q\u0002Q\u0000P0P7P>P=P0P3P4P5P<P=P5P\u0014P;Q\u000FP\u001FQ\u0000P8P=P0Q\u0001P=P8Q\u0005Q\u0002P5P<P:Q\u0002P>P3P>P4P2P>Q\u0002Q\u0002P0P<P!P(P\u0010P<P0Q\u000FP'Q\u0002P>P2P0Q\u0001P2P0P<P5P<Q\u0003P\"P0P:P4P2P0P=P0P<Q\rQ\u0002P8Q\rQ\u0002Q\u0003P\u0012P0P<Q\u0002P5Q\u0005P?Q\u0000P>Q\u0002Q\u0003Q\u0002P=P0P4P4P=Q\u000FP\u0012P>Q\u0002Q\u0002Q\u0000P8P=P5P9P\u0012P0Q\u0001P=P8P<Q\u0001P0P<Q\u0002P>Q\u0002Q\u0000Q\u0003P1P\u001EP=P8P<P8Q\u0000P=P5P5P\u001EP\u001EP\u001EP;P8Q\u0006Q\rQ\u0002P0P\u001EP=P0P=P5P<P4P>P<P<P>P9P4P2P5P>P=P>Q\u0001Q\u0003P4`$\u0015`%\u0007`$9`%\u0008`$\u0015`%\u0000`$8`%\u0007`$\u0015`$>`$\u0015`%\u000B`$\u0014`$0`$*`$0`$(`%\u0007`$\u000F`$\u0015`$\u0015`$?`$-`%\u0000`$\u0007`$8`$\u0015`$0`$$`%\u000B`$9`%\u000B`$\u0006`$*`$9`%\u0000`$/`$9`$/`$>`$$`$\u0015`$%`$>jagran`$\u0006`$\u001C`$\u001C`%\u000B`$\u0005`$,`$&`%\u000B`$\u0017`$\u0008`$\u001C`$>`$\u0017`$\u000F`$9`$.`$\u0007`$(`$5`$9`$/`%\u0007`$%`%\u0007`$%`%\u0000`$\u0018`$0`$\u001C`$,`$&`%\u0000`$\u0015`$\u0008`$\u001C`%\u0000`$5`%\u0007`$(`$\u0008`$(`$\u000F`$9`$0`$\t`$8`$.`%\u0007`$\u0015`$.`$5`%\u000B`$2`%\u0007`$8`$,`$.`$\u0008`$&`%\u0007`$\u0013`$0`$\u0006`$.`$,`$8`$-`$0`$,`$(`$\u001A`$2`$.`$(`$\u0006`$\u0017`$8`%\u0000`$2`%\u0000X9Y\u0004Y\tX%Y\u0004Y\tY\u0007X0X'X\"X.X1X9X/X/X'Y\u0004Y\tY\u0007X0Y\u0007X5Y\u0008X1X:Y\nX1Y\u0003X'Y\u0006Y\u0008Y\u0004X'X(Y\nY\u0006X9X1X6X0Y\u0004Y\u0003Y\u0007Y\u0006X'Y\nY\u0008Y\u0005Y\u0002X'Y\u0004X9Y\u0004Y\nX'Y\u0006X'Y\u0004Y\u0003Y\u0006X-X*Y\tY\u0002X(Y\u0004Y\u0008X-X)X'X.X1Y\u0001Y\u0002X7X9X(X/X1Y\u0003Y\u0006X%X0X'Y\u0003Y\u0005X'X'X-X/X%Y\u0004X'Y\u0001Y\nY\u0007X(X9X6Y\u0003Y\nY\u0001X(X-X+Y\u0008Y\u0005Y\u0006Y\u0008Y\u0007Y\u0008X#Y\u0006X'X,X/X'Y\u0004Y\u0007X'X3Y\u0004Y\u0005X9Y\u0006X/Y\u0004Y\nX3X9X(X1X5Y\u0004Y\tY\u0005Y\u0006X0X(Y\u0007X'X#Y\u0006Y\u0007Y\u0005X+Y\u0004Y\u0003Y\u0006X*X'Y\u0004X'X-Y\nX+Y\u0005X5X1X4X1X-X-Y\u0008Y\u0004Y\u0008Y\u0001Y\nX'X0X'Y\u0004Y\u0003Y\u0004Y\u0005X1X)X'Y\u0006X*X'Y\u0004Y\u0001X#X(Y\u0008X.X'X5X#Y\u0006X*X'Y\u0006Y\u0007X'Y\u0004Y\nX9X6Y\u0008Y\u0008Y\u0002X/X'X(Y\u0006X.Y\nX1X(Y\u0006X*Y\u0004Y\u0003Y\u0005X4X'X!Y\u0008Y\u0007Y\nX'X(Y\u0008Y\u0002X5X5Y\u0008Y\u0005X'X1Y\u0002Y\u0005X#X-X/Y\u0006X-Y\u0006X9X/Y\u0005X1X#Y\nX'X-X)Y\u0003X*X(X/Y\u0008Y\u0006Y\nX,X(Y\u0005Y\u0006Y\u0007X*X-X*X,Y\u0007X)X3Y\u0006X)Y\nX*Y\u0005Y\u0003X1X)X:X2X)Y\u0006Y\u0001X3X(Y\nX*Y\u0004Y\u0004Y\u0007Y\u0004Y\u0006X'X*Y\u0004Y\u0003Y\u0002Y\u0004X(Y\u0004Y\u0005X'X9Y\u0006Y\u0007X#Y\u0008Y\u0004X4Y\nX!Y\u0006Y\u0008X1X#Y\u0005X'Y\u0001Y\nY\u0003X(Y\u0003Y\u0004X0X'X*X1X*X(X(X#Y\u0006Y\u0007Y\u0005X3X'Y\u0006Y\u0003X(Y\nX9Y\u0001Y\u0002X/X-X3Y\u0006Y\u0004Y\u0007Y\u0005X4X9X1X#Y\u0007Y\u0004X4Y\u0007X1Y\u0002X7X1X7Y\u0004X(profileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>\r\nwrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle=\"Mobile killingshowingItaliandroppedheavilyeffects-1']);\nconfirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.\n\nThe but notdensityBritainChineselack oftributeIreland\" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang=\"return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue=\"complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role=\"missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})();\r\npaymenttroubleconceptcompareparentsplayersregionsmonitor ''The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html\">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen\n\nWhen observe</h2>\r\nModern provide\" alt=\"borders.\n\nFor \n\nMany artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>\r\n Countryignoredloss ofjust asGeorgiastrange<head><stopped1']);\r\nislandsnotableborder:list ofcarried100,000</h3>\n severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id=\"foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login\">convertviolententeredfirst\">circuitFinlandchemistshe was10px;\">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title\">tooltipSectiondesignsTurkishyounger.match(})();\n\nburningoperatedegreessource=Richardcloselyplasticentries</tr>\r\ncolor:#ul id=\"possessrollingphysicsfailingexecutecontestlink toDefault<br />\n: true,chartertourismclassicproceedexplain</h1>\r\nonline.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src=\"/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e&quot;tradingleft\">\npersonsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy\n\t\t<!--Daniel bindingblock\">imposedutilizeAbraham(except{width:putting).html(|| [];\nDATA[ *kitchenmountedactual dialectmainly _blank'installexpertsif(typeIt also&copy; \">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref=\"/\" rel=\"developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in\n\t<!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday's.html\" target=wearingAll Rig;\n})();raising Also, crucialabout\">declare-->\n<scfirefoxas muchappliesindex, s, but type = \n\r\n<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin\" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>\r\n returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of\n\nSome 'click'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion=\"pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major\":\"httpin his menu\">\nmonthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small\">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks\">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel\">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8\">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>\nevidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>\n he left).val()false);logicalbankinghome tonaming Arizonacredits);\n});\nfounderin turnCollinsbefore But thechargedTitle\">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered']);\n has theunclearEvent',both innot all\n\n<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage\" linear painterand notrarely acronymdelivershorter00&amp;as manywidth=\"/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don'tretreat. Some ww.\");\nbombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft\"><comScorAll thejQuery.touristClassicfalse\" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>\n\n. When in bothdismissExplorealways via thespaC1olwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>\n\t\tit intoranked rate oful>\r\n attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped\").css(hostilelead tolittle groups,Picture-->\r\n\r\n rows=\" objectinverse<footerCustomV><\\/scrsolvingChamberslaverywoundedwhereas!= 'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead')[0Criticsstudios>&copy;group\">assemblmaking pressedwidget.ps:\" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass=\"but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;\">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + \"gconsultdecimalhelpfulrevivedis veryr'+'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(\" />\n\t\there isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();\n is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded=\"true\"spacingis mosta more totallyfall of});\r\n immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace\">header-well asStanleybridges/globalCroatia About [0];\n it, andgroupedbeing a){throwhe madelighterethicalFFFFFF\"bottom\"like a employslive inas seenprintermost ofub-linkrejectsand useimage\">succeedfeedingNuclearinformato helpWomen'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older\">us.js\"> Since universlarger open to!-- endlies in']);\r\n marketwho is (\"DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = 'make a securedBaptistvoting \n\t\tvar March 2grew upClimate.removeskilledway the</head>face ofacting right\">to workreduceshas haderectedshow();action=book ofan area== \"htt<header\n<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage\">MobilClements\" id=\"as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded\"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;\">\r\npushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>\npeople.in one =windowfooter_a good reklamaothers,to this_cookiepanel\">London,definescrushedbaptismcoastalstatus title\" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />\r\nAtlantanucleusCounty,purely count\">easily build aonclicka givenpointerh&quot;events else {\nditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink\"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg\" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium\"DO NOT France,with a war andsecond take a >\r\n\r\n\r\nmarket.highwaydone inctivity\"last\">obligedrise to\"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right\" bicycleacing=\"day andstatingRather,higher Office are nowtimes, when a pay foron this-link\">;borderaround annual the Newput the.com\" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks\">\n();\" rea place\\u003Caabout atr>\r\n\t\tccount gives a<SCRIPTRailwaythemes/toolboxById(\"xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>\r\n<ustomVa;&gt;</importsor thatmostly &amp;re size=\"</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>\r\n\r\n<!organis <br />BeijingcatalC deutscheuropeueuskaragaeilgesvenskaespaC1amensajeusuariotrabajomC)xicopC!ginasiempresistemaoctubreduranteaC1adirempresamomentonuestroprimeratravC)sgraciasnuestraprocesoestadoscalidadpersonanC:meroacuerdomC:sicamiembroofertasalgunospaC-sesejemploderechoademC!sprivadoagregarenlacesposiblehotelessevillaprimeroC:ltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseC1oturismocC3digoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastC-tuloconocersegundoconsejofranciaminutossegundatenemosefectosmC!lagasesiC3nrevistagranadacompraringresogarcC-aacciC3necuadorquienesinclusodeberC!materiahombresmuestrapodrC-amaC1anaC:ltimaestamosoficialtambienningC:nsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner\">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo\"><adaughterauthor\" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom\">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton\" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id=\"discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive\">somewhatvictoriaWestern title=\"LocationcontractvisitorsDownloadwithout right\">\nmeasureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg\" />machines</h2>\n keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow\" valuable</label>relativebringingincreasegovernorplugins/List of Header\">\" name=\" (&quot;graduate</head>\ncommercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>\n\t\t<select citizensclothingwatching<li id=\"specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split(\"lizationOctober ){returnimproved--&gt;\n\ncoveragechairman.png\" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css\" /> websitereporteddefault\"/></a>\r\nelectricscotlandcreationquantity. ISBN 0did not instance-search-\" lang=\"speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: 'http:'script'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id=\"William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout=\"approved maximumheader\"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=\"\"intervalwirelessentitledagenciesSearch\" measuredthousandspending&hellip;new Date\" size=\"pageNamemiddle\" \" /></a>hidden\">sequencepersonaloverflowopinionsillinoislinks\">\n\t<title>versionssaturdayterminalitempropengineersectionsdesignerproposal=\"false\"EspaC1olreleasessubmit\" er&quot;additionsymptomsorientedresourceright\"><pleasurestationshistory.leaving border=contentscenter\">.\n\nSome directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal\"><span>search\">operatorrequestsa &quot;allowingDocumentrevision. \n\nThe yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1\"indicatefamiliar qualitymargin:0 contentviewportcontacts-title\">portable.length eligibleinvolvesatlanticonload=\"default.suppliedpaymentsglossary\n\nAfter guidance</td><tdencodingmiddle\">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>\n\taffectedsupportspointer;toString</small>oklahomawill be investor0\" alt=\"holidaysResourcelicensed (which . After considervisitingexplorerprimary search\" android\"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js\"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions\"campbell<!-- end</span><<br />\r\n_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=\" Companyexamples<iframe believespresentsmarshallpart of properly).\n\nThe taxonomymuch of </span>\n\" data-srtuguC*sscrollTo project<head>\r\nattorneyemphasissponsorsfancyboxworld's wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix\n<head>\narticle <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent\"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton\">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth=\"2lazyloadnovemberused in height=\"cript\">\n&nbsp;</<tr><td height:2/productcountry include footer\" &lt;!-- title\"></jquery.</form>\n(g.\u0000d=\u0013)(g9\u0001i+\u0014)hrvatskiitalianoromC\"nD\u0003tC<rkC'eX'X1X/Y\u0008tambiC)nnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuC)sdeportesproyectoproductopC:bliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniC3nimprimirmientrasamC)ricavendedorsociedadrespectorealizarregistropalabrasinterC)sentoncesespecialmiembrosrealidadcC3rdobazaragozapC!ginassocialesbloqueargestiC3nalquilersistemascienciascompletoversiC3ncompletaestudiospC:blicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayorC-aalemaniafunciC3nC:ltimoshaciendoaquellosediciC3nfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojC3venesdistritotC)cnicaconjuntoenergC-atrabajarasturiasrecienteutilizarboletC-nsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallaprC3ximoalmerC-aanimalesquiC)nescorazC3nsecciC3nbuscandoopcionesexteriorconceptotodavC-agalerC-aescribirmedicinalicenciaconsultaaspectoscrC-ticadC3laresjusticiadeberC!nperC-odonecesitamantenerpequeC1orecibidatribunaltenerifecanciC3ncanariasdescargadiversosmallorcarequieretC)cnicodeberC-aviviendafinanzasadelantefuncionaconsejosdifC-cilciudadesantiguasavanzadatC)rminounidadessC!nchezcampaC1asoftonicrevistascontienesectoresmomentosfacultadcrC)ditodiversassupuestofactoressegundospequeC1aP3P>P4P0P5Q\u0001P;P8P5Q\u0001Q\u0002Q\u000CP1Q\u000BP;P>P1Q\u000BQ\u0002Q\u000CQ\rQ\u0002P>P<P\u0015Q\u0001P;P8Q\u0002P>P3P>P<P5P=Q\u000FP2Q\u0001P5Q\u0005Q\rQ\u0002P>P9P4P0P6P5P1Q\u000BP;P8P3P>P4Q\u0003P4P5P=Q\u000CQ\rQ\u0002P>Q\u0002P1Q\u000BP;P0Q\u0001P5P1Q\u000FP>P4P8P=Q\u0001P5P1P5P=P0P4P>Q\u0001P0P9Q\u0002Q\u0004P>Q\u0002P>P=P5P3P>Q\u0001P2P>P8Q\u0001P2P>P9P8P3Q\u0000Q\u000BQ\u0002P>P6P5P2Q\u0001P5P<Q\u0001P2P>Q\u000EP;P8Q\u0008Q\u000CQ\rQ\u0002P8Q\u0005P?P>P:P0P4P=P5P9P4P>P<P0P<P8Q\u0000P0P;P8P1P>Q\u0002P5P<Q\u0003Q\u0005P>Q\u0002Q\u000FP4P2Q\u0003Q\u0005Q\u0001P5Q\u0002P8P;Q\u000EP4P8P4P5P;P>P<P8Q\u0000P5Q\u0002P5P1Q\u000FQ\u0001P2P>P5P2P8P4P5Q\u0007P5P3P>Q\rQ\u0002P8P<Q\u0001Q\u0007P5Q\u0002Q\u0002P5P<Q\u000BQ\u0006P5P=Q\u000BQ\u0001Q\u0002P0P;P2P5P4Q\u000CQ\u0002P5P<P5P2P>P4Q\u000BQ\u0002P5P1P5P2Q\u000BQ\u0008P5P=P0P<P8Q\u0002P8P?P0Q\u0002P>P<Q\u0003P?Q\u0000P0P2P;P8Q\u0006P0P>P4P=P0P3P>P4Q\u000BP7P=P0Q\u000EP<P>P3Q\u0003P4Q\u0000Q\u0003P3P2Q\u0001P5P9P8P4P5Q\u0002P:P8P=P>P>P4P=P>P4P5P;P0P4P5P;P5Q\u0001Q\u0000P>P:P8Q\u000EP=Q\u000FP2P5Q\u0001Q\u000CP\u0015Q\u0001Q\u0002Q\u000CQ\u0000P0P7P0P=P0Q\u0008P8X'Y\u0004Y\u0004Y\u0007X'Y\u0004X*Y\nX,Y\u0005Y\nX9X.X'X5X)X'Y\u0004X0Y\nX9Y\u0004Y\nY\u0007X,X/Y\nX/X'Y\u0004X\"Y\u0006X'Y\u0004X1X/X*X-Y\u0003Y\u0005X5Y\u0001X-X)Y\u0003X'Y\u0006X*X'Y\u0004Y\u0004Y\nY\nY\u0003Y\u0008Y\u0006X4X(Y\u0003X)Y\u0001Y\nY\u0007X'X(Y\u0006X'X*X-Y\u0008X'X!X#Y\u0003X+X1X.Y\u0004X'Y\u0004X'Y\u0004X-X(X/Y\u0004Y\nY\u0004X/X1Y\u0008X3X'X6X:X7X*Y\u0003Y\u0008Y\u0006Y\u0007Y\u0006X'Y\u0003X3X'X-X)Y\u0006X'X/Y\nX'Y\u0004X7X(X9Y\u0004Y\nY\u0003X4Y\u0003X1X'Y\nY\u0005Y\u0003Y\u0006Y\u0005Y\u0006Y\u0007X'X4X1Y\u0003X)X1X&Y\nX3Y\u0006X4Y\nX7Y\u0005X'X0X'X'Y\u0004Y\u0001Y\u0006X4X(X'X(X*X9X(X1X1X-Y\u0005X)Y\u0003X'Y\u0001X)Y\nY\u0002Y\u0008Y\u0004Y\u0005X1Y\u0003X2Y\u0003Y\u0004Y\u0005X)X#X-Y\u0005X/Y\u0002Y\u0004X(Y\nY\nX9Y\u0006Y\nX5Y\u0008X1X)X7X1Y\nY\u0002X4X'X1Y\u0003X,Y\u0008X'Y\u0004X#X.X1Y\tY\u0005X9Y\u0006X'X'X(X-X+X9X1Y\u0008X6X(X4Y\u0003Y\u0004Y\u0005X3X,Y\u0004X(Y\u0006X'Y\u0006X.X'Y\u0004X/Y\u0003X*X'X(Y\u0003Y\u0004Y\nX)X(X/Y\u0008Y\u0006X#Y\nX6X'Y\nY\u0008X,X/Y\u0001X1Y\nY\u0002Y\u0003X*X(X*X#Y\u0001X6Y\u0004Y\u0005X7X(X.X'Y\u0003X+X1X(X'X1Y\u0003X'Y\u0001X6Y\u0004X'X-Y\u0004Y\tY\u0006Y\u0001X3Y\u0007X#Y\nX'Y\u0005X1X/Y\u0008X/X#Y\u0006Y\u0007X'X/Y\nY\u0006X'X'Y\u0004X'Y\u0006Y\u0005X9X1X6X*X9Y\u0004Y\u0005X/X'X.Y\u0004Y\u0005Y\u0005Y\u0003Y\u0006\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0001\u0000\u0001\u0000\u0001\u0000\u0001\u0000\u0002\u0000\u0002\u0000\u0002\u0000\u0002\u0000\u0004\u0000\u0004\u0000\u0004\u0000\u0004\u0000\u0000\u0001\u0002\u0003\u0004\u0005\u0006\u0007\u0007\u0006\u0005\u0004\u0003\u0002\u0001\u0000\u0008\t\n\u000B\u000C\r\u000E\u000F\u000F\u000E\r\u000C\u000B\n\t\u0008\u0010\u0011\u0012\u0013\u0014\u0015\u0016\u0017\u0017\u0016\u0015\u0014\u0013\u0012\u0011\u0010\u0018\u0019\u001A\u001B\u001C\u001D\u001E\u001F\u001F\u001E\u001D\u001C\u001B\u001A\u0019\u0018\u007F\u007F\u007F\u007F\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u007F\u007F\u007F\u007F\u0001\u0000\u0000\u0000\u0002\u0000\u0000\u0000\u0002\u0000\u0000\u0000\u0001\u0000\u0000\u0000\u0001\u0000\u0000\u0000\u0003\u0000\u0000\u0000\u007F\u007F\u0000\u0001\u0000\u0000\u0000\u0001\u0000\u0000\u007F\u007F\u0000\u0001\u0000\u0000\u0000\u0008\u0000\u0008\u0000\u0008\u0000\u0008\u0000\u0000\u0000\u0001\u0000\u0002\u0000\u0003\u0000\u0004\u0000\u0005\u0000\u0006\u0000\u0007resourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter\" value=\"</select>Australia\" class=\"situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement\" title=\"potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form>\r\nstatementattentionBiography} else {\nsolutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter\">\nexceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick=\"biographyotherwisepermanentFranC'aisHollywoodexpansionstandards</style>\nreductionDecember preferredCambridgeopponentsBusiness confusion>\n<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>\nmountainslike the essentialfinancialselectionaction=\"/abandonedEducationparseInt(stabilityunable to</title>\nrelationsNote thatefficientperformedtwo yearsSince thethereforewrapper\">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>\nsuspectedmargin: 0spiritual</head>\n\nmicrosoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header\">February numerous overflow:componentfragmentsexcellentcolspan=\"technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>\n\tsponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting\" width=\".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper\"enough toalong thedelivered-->\r\n<!--American protectedNovember </style><furnitureInternet onblur=\"suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir=\"ltr\"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;\n\nsouthwestthe rightradiationmay have unescape(spoken in\" href=\"/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip\">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>\ncame fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8\" /><![CDATA[\">ContactSouthern bgcolor=\"series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->\n<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=\">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id=\"precedingTechnicalphysicistoccurs innavigatorsection\">span id=\"sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt=\"in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent\">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id=\"right\">\r\nresidenceleave thecontent\">are often })();\r\nprobably Professor-button\" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular\">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor\n&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved\n\nIn the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also\n<head>\n<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained\"></div>\n</a></td>depend onsearch\">\npieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue=\"\">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.\n\nAfter , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover\" style=\"states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as Serviceslocation and oftenmeasuringand it ispaperbackvalues of\r\n<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href=\"y:inline;Church ofthe eventvery highofficial -height: content=\"/cgi-bin/to createafrikaansesperantofranC'aislatvieE!ulietuviE3D\u000CeE!tinaD\reE!tina`9\u0004`8\u0017`8\"f\u0017%f\u001C,h*\u001Eg.\u0000d=\u0013e-\u0017g9\u0001i+\u0014e-\u0017m\u0015\u001Cj5-l\u00164d8:d;\u0000d9\u0008h.!g.\u0017f\u001C:g,\u0014h.0f\u001C,h(\u000Eh+\u0016e\r\u0000f\u001C\re\n!e\u0019(d:\u0012h\u0001\u0014g=\u0011f\u0008?e\u001C0d:'d?1d9\u0010i\u0003(e\u0007:g\t\u0008g$>f\u000E\u0012h!\u000Cf&\u001Ci\u0003(h\u0010=f <h?\u001Bd8\u0000f-%f\u0014/d;\u0018e.\u001Di*\u000Ch/\u0001g \u0001e'\u0014e\u0011\u0018d<\u001Af\u00150f\r.e:\u0013f6\u0008h49h\u0000\u0005e\n\u001Ee\u0005,e.$h.(h.:e\u000C:f71e\u001C3e8\u0002f\u0012-f\u0014>e\u0019(e\u000C\u0017d:,e8\u0002e$'e-&g\u0014\u001Fh6\nf\u001D%h6\ng.!g\u0010\u0006e\u0011\u0018d?!f\u0001/g=\u0011serviciosartC-culoargentinabarcelonacualquierpublicadoproductospolC-ticarespuestawikipediasiguientebC:squedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciC3nnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomC-aimC!genescontactardescargarnecesarioatenciC3ntelC)fonocomisiC3ncancionescapacidadencontraranC!lisisfavoritostC)rminosprovinciaetiquetaselementosfuncionesresultadocarC!cterpropiedadprincipionecesidadmunicipalcreaciC3ndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzC!lezdocumentopelC-cularecientesgeneralestarragonaprC!cticanovedadespropuestapacientestC)cnicasobjetivoscontactos`$.`%\u0007`$\u0002`$2`$?`$\u000F`$9`%\u0008`$\u0002`$\u0017`$/`$>`$8`$>`$%`$\u000F`$5`$\u0002`$0`$9`%\u0007`$\u0015`%\u000B`$\u0008`$\u0015`%\u0001`$\u001B`$0`$9`$>`$,`$>`$&`$\u0015`$9`$>`$8`$-`%\u0000`$9`%\u0001`$\u000F`$0`$9`%\u0000`$.`%\u0008`$\u0002`$&`$?`$(`$,`$>`$$diplodocs`$8`$.`$/`$0`%\u0002`$*`$(`$>`$.`$*`$$`$>`$+`$?`$0`$\u0014`$8`$$`$$`$0`$9`$2`%\u000B`$\u0017`$9`%\u0001`$\u0006`$,`$>`$0`$&`%\u0007`$6`$9`%\u0001`$\u0008`$\u0016`%\u0007`$2`$/`$&`$?`$\u0015`$>`$.`$5`%\u0007`$,`$$`%\u0000`$(`$,`%\u0000`$\u001A`$.`%\u000C`$$`$8`$>`$2`$2`%\u0007`$\u0016`$\u001C`%\t`$,`$.`$&`$&`$$`$%`$>`$(`$9`%\u0000`$6`$9`$0`$\u0005`$2`$\u0017`$\u0015`$-`%\u0000`$(`$\u0017`$0`$*`$>`$8`$0`$>`$$`$\u0015`$?`$\u000F`$\t`$8`%\u0007`$\u0017`$/`%\u0000`$9`%\u0002`$\u0001`$\u0006`$\u0017`%\u0007`$\u001F`%\u0000`$.`$\u0016`%\u000B`$\u001C`$\u0015`$>`$0`$\u0005`$-`%\u0000`$\u0017`$/`%\u0007`$$`%\u0001`$.`$5`%\u000B`$\u001F`$&`%\u0007`$\u0002`$\u0005`$\u0017`$0`$\u0010`$8`%\u0007`$.`%\u0007`$2`$2`$\u0017`$>`$9`$>`$2`$\n`$*`$0`$\u001A`$>`$0`$\u0010`$8`$>`$&`%\u0007`$0`$\u001C`$?`$8`$&`$?`$2`$,`$\u0002`$&`$,`$(`$>`$9`%\u0002`$\u0002`$2`$>`$\u0016`$\u001C`%\u0000`$$`$,`$\u001F`$(`$.`$?`$2`$\u0007`$8`%\u0007`$\u0006`$(`%\u0007`$(`$/`$>`$\u0015`%\u0001`$2`$2`%\t`$\u0017`$-`$>`$\u0017`$0`%\u0007`$2`$\u001C`$\u0017`$9`$0`$>`$.`$2`$\u0017`%\u0007`$*`%\u0007`$\u001C`$9`$>`$%`$\u0007`$8`%\u0000`$8`$9`%\u0000`$\u0015`$2`$>`$ `%\u0000`$\u0015`$9`$>`$\u0001`$&`%\u0002`$0`$$`$9`$$`$8`$>`$$`$/`$>`$&`$\u0006`$/`$>`$*`$>`$\u0015`$\u0015`%\u000C`$(`$6`$>`$.`$&`%\u0007`$\u0016`$/`$9`%\u0000`$0`$>`$/`$\u0016`%\u0001`$&`$2`$\u0017`%\u0000categoriesexperience</title>\r\nCopyright javascriptconditionseverything<p class=\"technologybackground<a class=\"management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox\" techniquesprotectionapparentlyas well asunt', 'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor=\"#especially content=\"productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=\".indexOf(\"conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus=\"<form id=\"processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png\" (document,boundariesexpressionsettlementBackgroundout of theenterprise(\"https:\" unescape(\"password\" democratic<a href=\"/wrapper\">\nmembershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher\"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick=\"considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic\" height=\"link rel=\".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class=\"0px;marginmechanicalstatisticscelebratedGovernment\n\nDuring tdevelopersartificialequivalentoriginatedCommissionattachment<span id=\"there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang=\"en\" </style>\r\nabsolute; supportingextremely mainstream</strong> popularityemployment</table>\r\n colspan=\"</form>\n conversionabout the </p></div>integrated\" lang=\"enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class=\"<a title=\"(includingparametersprohibited= \"http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0\" class=\"completelyillustratefive yearsinstrumentPublishing1\" class=\"psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;\nfunction it was theConventionautomobileProtestantaggressiveafter the Similarly,\" /></div>collection\r\nfunctionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>\n</.indexOf('i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }\n</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt=\"adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to\"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css\"\tfunction innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>\n\tdiplomaticcontainingperformingextensionsmay not beconcept of onclick=\"It is alsofinancial making theLuxembourgadditionalare calledengaged in\"script\");but it waselectroniconsubmit=\"\n<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences\n</head>\r\nrecognisedinitializelimited toAlexandriaretirementAdventuresfour years\n\n&lt;!-- increasingdecorationh3 class=\"origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews\" width=\"1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class=\"Scientificclass=\"no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional\n<head>\n<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix\">the publicmany yearswhich wereover time,synonymouscontent\">\npresumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined\"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan=\"only a fewmeant thatled to the-->\r\n<div <fieldset>Archbishop class=\"nobeing usedapproachesprivilegesnoscript>\nresults inmay be theEaster eggmechanismsreasonablePopulationCollectionselected\">noscript>\r/index.phparrival of-jssdk'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>\n\t\tcomplaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype=\"absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>\npercentagebest-knowncreating a\" dir=\"ltrLieutenant\n<div id=\"they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.\n\nIn the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/\" class=\"geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid=\"searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured\">is said tostructuralreferendummost oftena separate->\n<div id Official worldwide.aria-labelthe planetand it wasd\" value=\"looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id=\"opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/\" title=\".com/indextaking thepittsburghcontent\">\r<script>(fturned outhaving the</span>\r\n occasionalbecause itstarted tophysically></div>\n created byCurrently, bgcolor=\"tabindex=\"disastrousAnalytics also has a><div id=\"</style>\n<called forsinger and.src = \"//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguC*sW\"W\u0011W(W\u0019W*Y\u0001X'X1X3[\u000CdesarrollocomentarioeducaciC3nseptiembreregistradodirecciC3nubicaciC3npublicidadrespuestasresultadosimportantereservadosartC-culosdiferentessiguientesrepC:blicasituaciC3nministerioprivacidaddirectorioformaciC3npoblaciC3npresidentecont";
private static final String DATA1 = "enidosaccesoriostechnoratipersonalescategorC-aespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolC-ticasanterioresdocumentosnaturalezamaterialesdiferenciaeconC3micatransporterodrC-guezparticiparencuentrandiscusiC3nestructurafundaciC3nfrecuentespermanentetotalmenteP<P>P6P=P>P1Q\u0003P4P5Q\u0002P<P>P6P5Q\u0002P2Q\u0000P5P<Q\u000FQ\u0002P0P:P6P5Q\u0007Q\u0002P>P1Q\u000BP1P>P;P5P5P>Q\u0007P5P=Q\u000CQ\rQ\u0002P>P3P>P:P>P3P4P0P?P>Q\u0001P;P5P2Q\u0001P5P3P>Q\u0001P0P9Q\u0002P5Q\u0007P5Q\u0000P5P7P<P>P3Q\u0003Q\u0002Q\u0001P0P9Q\u0002P0P6P8P7P=P8P<P5P6P4Q\u0003P1Q\u0003P4Q\u0003Q\u0002P\u001FP>P8Q\u0001P:P7P4P5Q\u0001Q\u000CP2P8P4P5P>Q\u0001P2Q\u000FP7P8P=Q\u0003P6P=P>Q\u0001P2P>P5P9P;Q\u000EP4P5P9P?P>Q\u0000P=P>P<P=P>P3P>P4P5Q\u0002P5P9Q\u0001P2P>P8Q\u0005P?Q\u0000P0P2P0Q\u0002P0P:P>P9P<P5Q\u0001Q\u0002P>P8P<P5P5Q\u0002P6P8P7P=Q\u000CP>P4P=P>P9P;Q\u0003Q\u0007Q\u0008P5P?P5Q\u0000P5P4Q\u0007P0Q\u0001Q\u0002P8Q\u0007P0Q\u0001Q\u0002Q\u000CQ\u0000P0P1P>Q\u0002P=P>P2Q\u000BQ\u0005P?Q\u0000P0P2P>Q\u0001P>P1P>P9P?P>Q\u0002P>P<P<P5P=P5P5Q\u0007P8Q\u0001P;P5P=P>P2Q\u000BP5Q\u0003Q\u0001P;Q\u0003P3P>P:P>P;P>P=P0P7P0P4Q\u0002P0P:P>P5Q\u0002P>P3P4P0P?P>Q\u0007Q\u0002P8P\u001FP>Q\u0001P;P5Q\u0002P0P:P8P5P=P>P2Q\u000BP9Q\u0001Q\u0002P>P8Q\u0002Q\u0002P0P:P8Q\u0005Q\u0001Q\u0000P0P7Q\u0003P!P0P=P:Q\u0002Q\u0004P>Q\u0000Q\u0003P<P\u001AP>P3P4P0P:P=P8P3P8Q\u0001P;P>P2P0P=P0Q\u0008P5P9P=P0P9Q\u0002P8Q\u0001P2P>P8P<Q\u0001P2Q\u000FP7Q\u000CP;Q\u000EP1P>P9Q\u0007P0Q\u0001Q\u0002P>Q\u0001Q\u0000P5P4P8P\u001AQ\u0000P>P<P5P$P>Q\u0000Q\u0003P<Q\u0000Q\u000BP=P:P5Q\u0001Q\u0002P0P;P8P?P>P8Q\u0001P:Q\u0002Q\u000BQ\u0001Q\u000FQ\u0007P<P5Q\u0001Q\u000FQ\u0006Q\u0006P5P=Q\u0002Q\u0000Q\u0002Q\u0000Q\u0003P4P0Q\u0001P0P<Q\u000BQ\u0005Q\u0000Q\u000BP=P:P0P\u001DP>P2Q\u000BP9Q\u0007P0Q\u0001P>P2P<P5Q\u0001Q\u0002P0Q\u0004P8P;Q\u000CP<P<P0Q\u0000Q\u0002P0Q\u0001Q\u0002Q\u0000P0P=P<P5Q\u0001Q\u0002P5Q\u0002P5P:Q\u0001Q\u0002P=P0Q\u0008P8Q\u0005P<P8P=Q\u0003Q\u0002P8P<P5P=P8P8P<P5Q\u000EQ\u0002P=P>P<P5Q\u0000P3P>Q\u0000P>P4Q\u0001P0P<P>P<Q\rQ\u0002P>P<Q\u0003P:P>P=Q\u0006P5Q\u0001P2P>P5P<P:P0P:P>P9P\u0010Q\u0000Q\u0005P8P2Y\u0005Y\u0006X*X/Y\tX%X1X3X'Y\u0004X1X3X'Y\u0004X)X'Y\u0004X9X'Y\u0005Y\u0003X*X(Y\u0007X'X(X1X'Y\u0005X,X'Y\u0004Y\nY\u0008Y\u0005X'Y\u0004X5Y\u0008X1X,X/Y\nX/X)X'Y\u0004X9X6Y\u0008X%X6X'Y\u0001X)X'Y\u0004Y\u0002X3Y\u0005X'Y\u0004X9X'X(X*X-Y\u0005Y\nY\u0004Y\u0005Y\u0004Y\u0001X'X*Y\u0005Y\u0004X*Y\u0002Y\tX*X9X/Y\nY\u0004X'Y\u0004X4X9X1X#X.X(X'X1X*X7Y\u0008Y\nX1X9Y\u0004Y\nY\u0003Y\u0005X%X1Y\u0001X'Y\u0002X7Y\u0004X(X'X*X'Y\u0004Y\u0004X:X)X*X1X*Y\nX(X'Y\u0004Y\u0006X'X3X'Y\u0004X4Y\nX.Y\u0005Y\u0006X*X/Y\nX'Y\u0004X9X1X(X'Y\u0004Y\u0002X5X5X'Y\u0001Y\u0004X'Y\u0005X9Y\u0004Y\nY\u0007X'X*X-X/Y\nX+X'Y\u0004Y\u0004Y\u0007Y\u0005X'Y\u0004X9Y\u0005Y\u0004Y\u0005Y\u0003X*X(X)Y\nY\u0005Y\u0003Y\u0006Y\u0003X'Y\u0004X7Y\u0001Y\u0004Y\u0001Y\nX/Y\nY\u0008X%X/X'X1X)X*X'X1Y\nX.X'Y\u0004X5X-X)X*X3X,Y\nY\u0004X'Y\u0004Y\u0008Y\u0002X*X9Y\u0006X/Y\u0005X'Y\u0005X/Y\nY\u0006X)X*X5Y\u0005Y\nY\u0005X#X1X4Y\nY\u0001X'Y\u0004X0Y\nY\u0006X9X1X(Y\nX)X(Y\u0008X'X(X)X#Y\u0004X9X'X(X'Y\u0004X3Y\u0001X1Y\u0005X4X'Y\u0003Y\u0004X*X9X'Y\u0004Y\tX'Y\u0004X#Y\u0008Y\u0004X'Y\u0004X3Y\u0006X)X,X'Y\u0005X9X)X'Y\u0004X5X-Y\u0001X'Y\u0004X/Y\nY\u0006Y\u0003Y\u0004Y\u0005X'X*X'Y\u0004X.X'X5X'Y\u0004Y\u0005Y\u0004Y\u0001X#X9X6X'X!Y\u0003X*X'X(X)X'Y\u0004X.Y\nX1X1X3X'X&Y\u0004X'Y\u0004Y\u0002Y\u0004X(X'Y\u0004X#X/X(Y\u0005Y\u0002X'X7X9Y\u0005X1X'X3Y\u0004Y\u0005Y\u0006X7Y\u0002X)X'Y\u0004Y\u0003X*X(X'Y\u0004X1X,Y\u0004X'X4X*X1Y\u0003X'Y\u0004Y\u0002X/Y\u0005Y\nX9X7Y\nY\u0003sByTagName(.jpg\" alt=\"1px solid #.gif\" alt=\"transparentinformationapplication\" onclick=\"establishedadvertising.png\" alt=\"environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright\">0\" height=\"even thoughreplacementdestinationCorporation<ul class=\"AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class=\"hundreds of\n\nHowever, compositionclear:both;cooperationwithin the label for=\"border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength=\"switzerlandDevelopmentessentially\n\nAlthough </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics\n\t<div id=\"illustratedengineeringterritoriesauthoritiesdistributed6\" height=\"sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class=\"more recentit has beeninvasion of).getTime()fundamentalDespite the\"><div id=\"inspirationexaminationpreparationexplanation<input id=\"</a></span>versions ofinstrumentsbefore the = 'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright\" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content\">\n<td class=\"undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src=\"/<h1 class=\"publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=\";width:100%independent<h3 class=\" onchange=\").addClass(interactionOne of the daughter ofaccessoriesbranches of\r\n<div id=\"the largestdeclarationregulationsInformationtranslationdocumentaryin order to\">\n<head>\n<\" height=\"1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer\">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class=\"distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>\n</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>\n selected=\"high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1\"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex=\"it could be<noscript>\nhaving been\r\n<head>\r\n< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often\"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval\"></span></in New Yorkadditional compression\n\n<div id=\"incorporate;</script><attachEventbecame the \" target=\"_carried outSome of thescience andthe time ofContainer\">maintainingChristopherMuch of thewritings of\" height=\"2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit=\"director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class=\"Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the\" height=\"3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>\r\nContinentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name=\"TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel=\"This is the <a href=\"/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og=\"><a class=\"class=\"textConversion may be usedmanufactureafter beingclearfix\">\nquestion ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html\"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period\" name=\"q\" confined toa result ofvalue=\"\" />is actuallyEnvironment\r\n</head>\r\nConversely,>\n<div id=\"0\" width=\"1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious\">this is notthe presentif they areand finallya matter of\r\n\t</div>\r\n\r\n</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer\" class=\"frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>\n<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger\n\t</script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>\n they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight=\"0\" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class=\"btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world'scan lead torefers to aborder=\"0\" government winning theresulted in while the Washington,the subjectcity in the></div>\r\n\t\treflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=\"\"><a href=\"themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href=\"/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in\t\t<div id=\"it\" value=\"language ofas they areproduced inis that theexplain thediv></div>\nHowever thelead to the\t<a href=\"/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenD\rinacomentariosuniversidadcondicionesactividadesexperienciatecnologC-aproducciC3npuntuaciC3naplicaciC3ncontraseC1acategorC-asregistrarseprofesionaltratamientoregC-stratesecretarC-aprincipalesprotecciC3nimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociaciC3ndisponiblesevaluaciC3nestudiantesresponsableresoluciC3nguadalajararegistradosoportunidadcomercialesfotografC-aautoridadesingenierC-atelevisiC3ncompetenciaoperacionesestablecidosimplementeactualmentenavegaciC3nconformidadline-height:font-family:\" : \"http://applicationslink\" href=\"specifically//<![CDATA[\nOrganizationdistribution0px; height:relationshipdevice-width<div class=\"<label for=\"registration</noscript>\n/index.html\"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name=\"intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class=\"organisationcivilization19th centuryarchitectureincorporated20th century-container\">most notably/></a></div>notification'undefined')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang=\"&lt;/sup&gt;dealing withphiladelphiahistorically);</script>\npadding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd\">\r\n<htgeographicalConstitution', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style=\"Encyclopediaiframe src=\"demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence\" tabindex=\"float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time\"><a class=\"In addition,description+conversationcontact withis generallyr\" content=\"representing&lt;math&gt;presentationoccasionally<img width=\"navigation\">compensationchampionshipmedia=\"all\" violation ofreference toreturn true;Strict//EN\" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}\n</script>\nChristianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=\"\"><a href=\"/introductionbelonging toclaimed thatconsequences<meta name=\"Guide to theoverwhelmingagainst the concentrated,\n.nontouch observations</a>\n</div>\nf (document.border: 1px {font-size:1treatment of0\" height=\"1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript\" neverthelesssignificanceBroadcasting>&nbsp;</td>container\">\nsuch as the influence ofa particularsrc='http://navigation\" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite\" xml:lang=\"deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype=\"image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet\t<ul class=\"installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures\n\t\t<a href=\"close to theexamples of is about the(see below).\" id=\"searchprofessionalis availablethe official\t\t</script>\n\n\t\t<div id=\"accelerationthrough the Hall of Famedescriptionstranslationsinterference type='text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the\t<li class=\"instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class=\"aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc=\"http://px; height: available tomanufacturerhuman rightslink href=\"/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>\r\nconsider thean estimatedthe National<div id=\"pagresulting incommissionedanalogous toare required/ul>\n</div>\nwas based onand became a&nbsp;&nbsp;t\" value=\"\" was capturedno more thanrespectivelycontinue to >\r\n<head>\r\n<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml\" title=\"weight:bold;creating thedisplay:nonereplaced the<img src=\"/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css\" media=\"People from available onproved to besuggestions\"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class=\"evidence forexplanationsenvironments\"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign=\"top\"principle ofat the time,</noscript>\rsaid to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style=\"input name=\"the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class=\"lastworking with'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the\n</script>\n\nan effort toincrease theto the southspacing=\"0\">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>\nthought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds\" content=\"authority ofnorthwestern</div>\n<div \"></div>\r\n consultationcommunity ofthe nationalit should beparticipants align=\"leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class=\"splace in thewhere he was<li class=\"fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions\">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class=\"effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\\s+|\\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers\t<link rel=\"provided thethe story ofcompetitionsenglish (UK)english (US)P\u001CP>P=P3P>P;P!Q\u0000P?Q\u0001P:P8Q\u0001Q\u0000P?Q\u0001P:P8Q\u0001Q\u0000P?Q\u0001P:P>Y\u0004X9X1X(Y\nX)f-#i+\u0014d8-f\u0016\u0007g.\u0000d=\u0013d8-f\u0016\u0007g9\u0001d=\u0013d8-f\u0016\u0007f\u001C\ti\u0019\u0010e\u0005,e\u000F8d::f0\u0011f\u0014?e:\u001Ci\u0018?i\u0007\u000Ce74e74g$>d<\u001Ad8;d9\tf\u0013\rd=\u001Cg3;g;\u001Ff\u0014?g-\u0016f3\u0015h'\u0004informaciC3nherramientaselectrC3nicodescripciC3nclasificadosconocimientopublicaciC3nrelacionadasinformC!ticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontC!ctenoshabitacionescumplimientorestaurantesdisposiciC3nconsecuenciaelectrC3nicaaplicacionesdesconectadoinstalaciC3nrealizaciC3nutilizaciC3nenciclopediaenfermedadesinstrumentosexperienciasinstituciC3nparticularessubcategoriaQ\u0002P>P;Q\u000CP:P>P P>Q\u0001Q\u0001P8P8Q\u0000P0P1P>Q\u0002Q\u000BP1P>P;Q\u000CQ\u0008P5P?Q\u0000P>Q\u0001Q\u0002P>P<P>P6P5Q\u0002P5P4Q\u0000Q\u0003P3P8Q\u0005Q\u0001P;Q\u0003Q\u0007P0P5Q\u0001P5P9Q\u0007P0Q\u0001P2Q\u0001P5P3P4P0P P>Q\u0001Q\u0001P8Q\u000FP\u001CP>Q\u0001P:P2P5P4Q\u0000Q\u0003P3P8P5P3P>Q\u0000P>P4P0P2P>P?Q\u0000P>Q\u0001P4P0P=P=Q\u000BQ\u0005P4P>P;P6P=Q\u000BP8P<P5P=P=P>P\u001CP>Q\u0001P:P2Q\u000BQ\u0000Q\u0003P1P;P5P9P\u001CP>Q\u0001P:P2P0Q\u0001Q\u0002Q\u0000P0P=Q\u000BP=P8Q\u0007P5P3P>Q\u0000P0P1P>Q\u0002P5P4P>P;P6P5P=Q\u0003Q\u0001P;Q\u0003P3P8Q\u0002P5P?P5Q\u0000Q\u000CP\u001EP4P=P0P:P>P?P>Q\u0002P>P<Q\u0003Q\u0000P0P1P>Q\u0002Q\u0003P0P?Q\u0000P5P;Q\u000FP2P>P>P1Q\tP5P>P4P=P>P3P>Q\u0001P2P>P5P3P>Q\u0001Q\u0002P0Q\u0002Q\u000CP8P4Q\u0000Q\u0003P3P>P9Q\u0004P>Q\u0000Q\u0003P<P5Q\u0005P>Q\u0000P>Q\u0008P>P?Q\u0000P>Q\u0002P8P2Q\u0001Q\u0001Q\u000BP;P:P0P:P0P6P4Q\u000BP9P2P;P0Q\u0001Q\u0002P8P3Q\u0000Q\u0003P?P?Q\u000BP2P<P5Q\u0001Q\u0002P5Q\u0000P0P1P>Q\u0002P0Q\u0001P:P0P7P0P;P?P5Q\u0000P2Q\u000BP9P4P5P;P0Q\u0002Q\u000CP4P5P=Q\u000CP3P8P?P5Q\u0000P8P>P4P1P8P7P=P5Q\u0001P>Q\u0001P=P>P2P5P<P>P<P5P=Q\u0002P:Q\u0003P?P8Q\u0002Q\u000CP4P>P;P6P=P0Q\u0000P0P<P:P0Q\u0005P=P0Q\u0007P0P;P>P P0P1P>Q\u0002P0P\"P>P;Q\u000CP:P>Q\u0001P>P2Q\u0001P5P<P2Q\u0002P>Q\u0000P>P9P=P0Q\u0007P0P;P0Q\u0001P?P8Q\u0001P>P:Q\u0001P;Q\u0003P6P1Q\u000BQ\u0001P8Q\u0001Q\u0002P5P<P?P5Q\u0007P0Q\u0002P8P=P>P2P>P3P>P?P>P<P>Q\tP8Q\u0001P0P9Q\u0002P>P2P?P>Q\u0007P5P<Q\u0003P?P>P<P>Q\tQ\u000CP4P>P;P6P=P>Q\u0001Q\u0001Q\u000BP;P:P8P1Q\u000BQ\u0001Q\u0002Q\u0000P>P4P0P=P=Q\u000BP5P<P=P>P3P8P5P?Q\u0000P>P5P:Q\u0002P!P5P9Q\u0007P0Q\u0001P<P>P4P5P;P8Q\u0002P0P:P>P3P>P>P=P;P0P9P=P3P>Q\u0000P>P4P5P2P5Q\u0000Q\u0001P8Q\u000FQ\u0001Q\u0002Q\u0000P0P=P5Q\u0004P8P;Q\u000CP<Q\u000BQ\u0003Q\u0000P>P2P=Q\u000FQ\u0000P0P7P=Q\u000BQ\u0005P8Q\u0001P:P0Q\u0002Q\u000CP=P5P4P5P;Q\u000EQ\u000FP=P2P0Q\u0000Q\u000FP<P5P=Q\u000CQ\u0008P5P<P=P>P3P8Q\u0005P4P0P=P=P>P9P7P=P0Q\u0007P8Q\u0002P=P5P;Q\u000CP7Q\u000FQ\u0004P>Q\u0000Q\u0003P<P0P\"P5P?P5Q\u0000Q\u000CP<P5Q\u0001Q\u000FQ\u0006P0P7P0Q\tP8Q\u0002Q\u000BP\u001BQ\u0003Q\u0007Q\u0008P8P5`$(`$9`%\u0000`$\u0002`$\u0015`$0`$(`%\u0007`$\u0005`$*`$(`%\u0007`$\u0015`$?`$/`$>`$\u0015`$0`%\u0007`$\u0002`$\u0005`$(`%\r`$/`$\u0015`%\r`$/`$>`$\u0017`$>`$\u0007`$!`$,`$>`$0`%\u0007`$\u0015`$?`$8`%\u0000`$&`$?`$/`$>`$*`$9`$2`%\u0007`$8`$?`$\u0002`$9`$-`$>`$0`$$`$\u0005`$*`$(`%\u0000`$5`$>`$2`%\u0007`$8`%\u0007`$5`$>`$\u0015`$0`$$`%\u0007`$.`%\u0007`$0`%\u0007`$9`%\u000B`$(`%\u0007`$8`$\u0015`$$`%\u0007`$,`$9`%\u0001`$$`$8`$>`$\u0007`$\u001F`$9`%\u000B`$\u0017`$>`$\u001C`$>`$(`%\u0007`$.`$?`$(`$\u001F`$\u0015`$0`$$`$>`$\u0015`$0`$(`$>`$\t`$(`$\u0015`%\u0007`$/`$9`$>`$\u0001`$8`$,`$8`%\u0007`$-`$>`$7`$>`$\u0006`$*`$\u0015`%\u0007`$2`$?`$/`%\u0007`$6`%\u0001`$0`%\u0002`$\u0007`$8`$\u0015`%\u0007`$\u0018`$\u0002`$\u001F`%\u0007`$.`%\u0007`$0`%\u0000`$8`$\u0015`$$`$>`$.`%\u0007`$0`$>`$2`%\u0007`$\u0015`$0`$\u0005`$'`$?`$\u0015`$\u0005`$*`$(`$>`$8`$.`$>`$\u001C`$.`%\u0001`$\u001D`%\u0007`$\u0015`$>`$0`$#`$9`%\u000B`$$`$>`$\u0015`$!`$<`%\u0000`$/`$9`$>`$\u0002`$9`%\u000B`$\u001F`$2`$6`$,`%\r`$&`$2`$?`$/`$>`$\u001C`%\u0000`$5`$(`$\u001C`$>`$$`$>`$\u0015`%\u0008`$8`%\u0007`$\u0006`$*`$\u0015`$>`$5`$>`$2`%\u0000`$&`%\u0007`$(`%\u0007`$*`%\u0002`$0`%\u0000`$*`$>`$(`%\u0000`$\t`$8`$\u0015`%\u0007`$9`%\u000B`$\u0017`%\u0000`$,`%\u0008`$ `$\u0015`$\u0006`$*`$\u0015`%\u0000`$5`$0`%\r`$7`$\u0017`$>`$\u0002`$5`$\u0006`$*`$\u0015`%\u000B`$\u001C`$?`$2`$>`$\u001C`$>`$(`$>`$8`$9`$.`$$`$9`$.`%\u0007`$\u0002`$\t`$(`$\u0015`%\u0000`$/`$>`$9`%\u0002`$&`$0`%\r`$\u001C`$8`%\u0002`$\u001A`%\u0000`$*`$8`$\u0002`$&`$8`$5`$>`$2`$9`%\u000B`$(`$>`$9`%\u000B`$$`%\u0000`$\u001C`%\u0008`$8`%\u0007`$5`$>`$*`$8`$\u001C`$(`$$`$>`$(`%\u0007`$$`$>`$\u001C`$>`$0`%\u0000`$\u0018`$>`$/`$2`$\u001C`$?`$2`%\u0007`$(`%\u0000`$\u001A`%\u0007`$\u001C`$>`$\u0002`$\u001A`$*`$$`%\r`$0`$\u0017`%\u0002`$\u0017`$2`$\u001C`$>`$$`%\u0007`$,`$>`$9`$0`$\u0006`$*`$(`%\u0007`$5`$>`$9`$(`$\u0007`$8`$\u0015`$>`$8`%\u0001`$,`$9`$0`$9`$(`%\u0007`$\u0007`$8`$8`%\u0007`$8`$9`$?`$$`$,`$!`$<`%\u0007`$\u0018`$\u001F`$(`$>`$$`$2`$>`$6`$*`$>`$\u0002`$\u001A`$6`%\r`$0`%\u0000`$,`$!`$<`%\u0000`$9`%\u000B`$$`%\u0007`$8`$>`$\u0008`$\u001F`$6`$>`$/`$&`$8`$\u0015`$$`%\u0000`$\u001C`$>`$$`%\u0000`$5`$>`$2`$>`$9`$\u001C`$>`$0`$*`$\u001F`$(`$>`$0`$\u0016`$(`%\u0007`$8`$!`$<`$\u0015`$.`$?`$2`$>`$\t`$8`$\u0015`%\u0000`$\u0015`%\u0007`$5`$2`$2`$\u0017`$$`$>`$\u0016`$>`$(`$>`$\u0005`$0`%\r`$%`$\u001C`$9`$>`$\u0002`$&`%\u0007`$\u0016`$>`$*`$9`$2`%\u0000`$(`$?`$/`$.`$,`$?`$(`$>`$,`%\u0008`$\u0002`$\u0015`$\u0015`$9`%\u0000`$\u0002`$\u0015`$9`$(`$>`$&`%\u0007`$$`$>`$9`$.`$2`%\u0007`$\u0015`$>`$+`%\u0000`$\u001C`$,`$\u0015`$?`$$`%\u0001`$0`$$`$.`$>`$\u0002`$\u0017`$5`$9`%\u0000`$\u0002`$0`%\u000B`$\u001C`$<`$.`$?`$2`%\u0000`$\u0006`$0`%\u000B`$*`$8`%\u0007`$(`$>`$/`$>`$&`$5`$2`%\u0007`$(`%\u0007`$\u0016`$>`$$`$>`$\u0015`$0`%\u0000`$,`$\t`$(`$\u0015`$>`$\u001C`$5`$>`$,`$*`%\u0002`$0`$>`$,`$!`$<`$>`$8`%\u000C`$&`$>`$6`%\u0007`$/`$0`$\u0015`$?`$/`%\u0007`$\u0015`$9`$>`$\u0002`$\u0005`$\u0015`$8`$0`$,`$(`$>`$\u000F`$5`$9`$>`$\u0002`$8`%\r`$%`$2`$.`$?`$2`%\u0007`$2`%\u0007`$\u0016`$\u0015`$5`$?`$7`$/`$\u0015`%\r`$0`$\u0002`$8`$.`%\u0002`$9`$%`$>`$(`$>X*X3X*X7Y\nX9Y\u0005X4X'X1Y\u0003X)X(Y\u0008X'X3X7X)X'Y\u0004X5Y\u0001X-X)Y\u0005Y\u0008X'X6Y\nX9X'Y\u0004X.X'X5X)X'Y\u0004Y\u0005X2Y\nX/X'Y\u0004X9X'Y\u0005X)X'Y\u0004Y\u0003X'X*X(X'Y\u0004X1X/Y\u0008X/X(X1Y\u0006X'Y\u0005X,X'Y\u0004X/Y\u0008Y\u0004X)X'Y\u0004X9X'Y\u0004Y\u0005X'Y\u0004Y\u0005Y\u0008Y\u0002X9X'Y\u0004X9X1X(Y\nX'Y\u0004X3X1Y\nX9X'Y\u0004X,Y\u0008X'Y\u0004X'Y\u0004X0Y\u0007X'X(X'Y\u0004X-Y\nX'X)X'Y\u0004X-Y\u0002Y\u0008Y\u0002X'Y\u0004Y\u0003X1Y\nY\u0005X'Y\u0004X9X1X'Y\u0002Y\u0005X-Y\u0001Y\u0008X8X)X'Y\u0004X+X'Y\u0006Y\nY\u0005X4X'Y\u0007X/X)X'Y\u0004Y\u0005X1X#X)X'Y\u0004Y\u0002X1X\"Y\u0006X'Y\u0004X4X(X'X(X'Y\u0004X-Y\u0008X'X1X'Y\u0004X,X/Y\nX/X'Y\u0004X#X3X1X)X'Y\u0004X9Y\u0004Y\u0008Y\u0005Y\u0005X,Y\u0005Y\u0008X9X)X'Y\u0004X1X-Y\u0005Y\u0006X'Y\u0004Y\u0006Y\u0002X'X7Y\u0001Y\u0004X3X7Y\nY\u0006X'Y\u0004Y\u0003Y\u0008Y\nX*X'Y\u0004X/Y\u0006Y\nX'X(X1Y\u0003X'X*Y\u0007X'Y\u0004X1Y\nX'X6X*X-Y\nX'X*Y\nX(X*Y\u0008Y\u0002Y\nX*X'Y\u0004X#Y\u0008Y\u0004Y\tX'Y\u0004X(X1Y\nX/X'Y\u0004Y\u0003Y\u0004X'Y\u0005X'Y\u0004X1X'X(X7X'Y\u0004X4X.X5Y\nX3Y\nX'X1X'X*X'Y\u0004X+X'Y\u0004X+X'Y\u0004X5Y\u0004X'X)X'Y\u0004X-X/Y\nX+X'Y\u0004X2Y\u0008X'X1X'Y\u0004X.Y\u0004Y\nX,X'Y\u0004X,Y\u0005Y\nX9X'Y\u0004X9X'Y\u0005Y\u0007X'Y\u0004X,Y\u0005X'Y\u0004X'Y\u0004X3X'X9X)Y\u0005X4X'Y\u0007X/Y\u0007X'Y\u0004X1X&Y\nX3X'Y\u0004X/X.Y\u0008Y\u0004X'Y\u0004Y\u0001Y\u0006Y\nX)X'Y\u0004Y\u0003X*X'X(X'Y\u0004X/Y\u0008X1Y\nX'Y\u0004X/X1Y\u0008X3X'X3X*X:X1Y\u0002X*X5X'Y\u0005Y\nY\u0005X'Y\u0004X(Y\u0006X'X*X'Y\u0004X9X8Y\nY\u0005entertainmentunderstanding = function().jpg\" width=\"configuration.png\" width=\"<body class=\"Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=\"\"><img src=\"/distinguishedthousands of communicationclear\"></div>investigationfavicon.ico\" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch\" type=\"form method=\"as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of\" maxlength=\"return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type=\"the number ofthe original comprehensiverefers to the</ul>\n</div>\nphilosophicallocation.hrefwas publishedSan Francisco(function(){\n<div id=\"mainsophisticatedmathematical /head>\r\n<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder=\"; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript\" src=\"/(function() {are available\n\t<link rel=\" src='http://interested inconventional \" alt=\"\" /></are generallyhas also beenmost popular correspondingcredited withtyle=\"border:</a></span></.gif\" width=\"<iframe src=\"table class=\"inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name=\"or\" content=\"controversialproperty=\"og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style=\"known as the shortly afterfor instance,described as /head>\n<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant\" border=\"0\">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name=\"searchattributed tocourse of themathematicianby the end ofat the end of\" border=\"0\" technological.removeClass(branch of theevidence that![endif]-->\r\nInstitute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href=\"confused with<link href=\"/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>\n</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription\" determine theavailable forAccording to wide range of\t<div class=\"more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover=\"because they async = true;problems withseems to havethe result of src=\"http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld's firstclassified asbottom of the(particularlyalign=\"left\" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout=\"New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd\">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to\t<meta name=\"are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to\t\t<ul class=\"visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style=\"equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these\n<div class=\"input class=\"replaced withis one of theeducation andinfluenced byreputation as\n<meta name=\"accommodation</div>\n</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the\n<div style=\"almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in\" value=\"\" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class=\"mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription\">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass=\"headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;\n</script>\n<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle=\"marginincluding thebahasa Melayunorsk bokmC%lnorsk nynorskslovenE!D\rinainternacionalcalificaciC3ncomunicaciC3nconstrucciC3n\"><div class=\"disambiguationDomainName', 'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->\n</><meta name=\"implementationinfrastructurerepresentationborder-bottom:</head>\n<body>=http%3A%2F%2F<form method=\"method=\"post\" /favicon.ico\" });\n</script>\n.setAttribute(Administration= new Array();<![endif]-->\r\ndisplay:block;Unfortunately,\">&nbsp;</div>/favicon.ico\">='stylesheet' identification, for example,<li><a href=\"/an alternativeas a result ofpt\"></script>\ntype=\"submit\" \n(function() {recommendationform action=\"/transformationreconstruction.style.display According to hidden\" name=\"along with thedocument.body.approximately Communicationspost\" action=\"meaning &quot;--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover=\"the governmenthref=\"https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->\n\ndepends on theUniversity of in contrast to placeholder=\"in the case ofinternational constitutionalstyle=\"border-: function() {Because of the-strict.dtd\">\n<table class=\"accompanied byaccount of the<script src=\"/nature of the the people in in addition tos); js.id = id\" width=\"100%\"regarding the Roman Catholican independentfollowing the .gif\" width=\"1the following discriminationarchaeologicalprime minister.js\"></script>combination of marginwidth=\"createElement(w.attachEvent(</a></td></tr>src=\"https://aIn particular, align=\"left\" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html\" title=\"(function () {comes from theapplication of<span class=\"sbelieved to beement('script'</a>\n</li>\n<livery different><span class=\"option value=\"(also known as\t<li><a href=\"><input name=\"separated fromreferred to as valign=\"top\">founder of theattempting to carbon dioxide\n\n<div class=\"class=\"search-/body>\n</html>opportunity tocommunications</head>\r\n<body style=\"width:Tia:?ng Via;\u0007tchanges in theborder-color:#0\" border=\"0\" </span></div><was discovered\" type=\"text\" );\n</script>\n\nDepartment of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>\n\n<div iwas consideredpercent of the\" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href='http://whether or notThere are alsothere are manya small numberother parts ofimpossible to class=\"buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=\" method=\"post\"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign=\"right\">many countriesfor many yearsearliest knownbecause it waspt\"></script>\r valign=\"top\" inhabitants offollowing year\r\n<div class=\"million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style=\"color:although therebest known forsubmit\" name=\"multiplicationmore than one recognition ofCouncil of theedition of the <meta name=\"Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class=\"descendants of<span class=\"i align=\"right\"</head>\n<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the\t<span class=\"is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class=\"<span class=\"t(Math.random()most prominentdescription ofConstantinoplewere published<div class=\"seappears in the1\" height=\"1\" most importantwhich includeswhich had beendestruction ofthe population\n\t<div class=\"possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle=\"clear:b\r\n</script>\r\n<was founded ininterview with_id\" content=\"capital of the\r\n<link rel=\"srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class=\"cperformance of(function() {\rif and only ifregions of theleading to therelations withUnited Nationsstyle=\"height:other than theype\" content=\"Association of\n</head>\n<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>\n<link rel=\" return false;the purpose ofthe ability to;color:#fff}\n.\n<span class=\"the subject ofdefinitions of>\r\n<link rel=\"claim that thehave developed<table width=\"celebration ofFollowing the to distinguish<span class=\"btakes place inunder the namenoted that the><![endif]-->\nstyle=\"margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id=\"was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>\r\n\r\nenvironmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made\" src=\"http://interpreted assecond half ofcrolling=\"no\" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class=\"footerand especiallytype=\"button\" </span></span>which included>\n<meta name=\"considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process <div class=\"the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class=\"ptext\" name=\"q\"\t\t<div class=\"the scientificrepresented bymathematicianselected by thethat have been><div class=\"cdiv id=\"headerin particular,converted into);\n</script>\n<philosophical srpskohrvatskitia:?ng Via;\u0007tP Q\u0003Q\u0001Q\u0001P:P8P9Q\u0000Q\u0003Q\u0001Q\u0001P:P8P9investigaciC3nparticipaciC3nP:P>Q\u0002P>Q\u0000Q\u000BP5P>P1P;P0Q\u0001Q\u0002P8P:P>Q\u0002P>Q\u0000Q\u000BP9Q\u0007P5P;P>P2P5P:Q\u0001P8Q\u0001Q\u0002P5P<Q\u000BP\u001DP>P2P>Q\u0001Q\u0002P8P:P>Q\u0002P>Q\u0000Q\u000BQ\u0005P>P1P;P0Q\u0001Q\u0002Q\u000CP2Q\u0000P5P<P5P=P8P:P>Q\u0002P>Q\u0000P0Q\u000FQ\u0001P5P3P>P4P=Q\u000FQ\u0001P:P0Q\u0007P0Q\u0002Q\u000CP=P>P2P>Q\u0001Q\u0002P8P#P:Q\u0000P0P8P=Q\u000BP2P>P?Q\u0000P>Q\u0001Q\u000BP:P>Q\u0002P>Q\u0000P>P9Q\u0001P4P5P;P0Q\u0002Q\u000CP?P>P<P>Q\tQ\u000CQ\u000EQ\u0001Q\u0000P5P4Q\u0001Q\u0002P2P>P1Q\u0000P0P7P>P<Q\u0001Q\u0002P>Q\u0000P>P=Q\u000BQ\u0003Q\u0007P0Q\u0001Q\u0002P8P5Q\u0002P5Q\u0007P5P=P8P5P\u0013P;P0P2P=P0Q\u000FP8Q\u0001Q\u0002P>Q\u0000P8P8Q\u0001P8Q\u0001Q\u0002P5P<P0Q\u0000P5Q\u0008P5P=P8Q\u000FP!P:P0Q\u0007P0Q\u0002Q\u000CP?P>Q\rQ\u0002P>P<Q\u0003Q\u0001P;P5P4Q\u0003P5Q\u0002Q\u0001P:P0P7P0Q\u0002Q\u000CQ\u0002P>P2P0Q\u0000P>P2P:P>P=P5Q\u0007P=P>Q\u0000P5Q\u0008P5P=P8P5P:P>Q\u0002P>Q\u0000P>P5P>Q\u0000P3P0P=P>P2P:P>Q\u0002P>Q\u0000P>P<P P5P:P;P0P<P0X'Y\u0004Y\u0005Y\u0006X*X/Y\tY\u0005Y\u0006X*X/Y\nX'X*X'Y\u0004Y\u0005Y\u0008X6Y\u0008X9X'Y\u0004X(X1X'Y\u0005X,X'Y\u0004Y\u0005Y\u0008X'Y\u0002X9X'Y\u0004X1X3X'X&Y\u0004Y\u0005X4X'X1Y\u0003X'X*X'Y\u0004X#X9X6X'X!X'Y\u0004X1Y\nX'X6X)X'Y\u0004X*X5Y\u0005Y\nY\u0005X'Y\u0004X'X9X6X'X!X'Y\u0004Y\u0006X*X'X&X,X'Y\u0004X#Y\u0004X9X'X(X'Y\u0004X*X3X,Y\nY\u0004X'Y\u0004X#Y\u0002X3X'Y\u0005X'Y\u0004X6X:X7X'X*X'Y\u0004Y\u0001Y\nX/Y\nY\u0008X'Y\u0004X*X1X-Y\nX(X'Y\u0004X,X/Y\nX/X)X'Y\u0004X*X9Y\u0004Y\nY\u0005X'Y\u0004X#X.X(X'X1X'Y\u0004X'Y\u0001Y\u0004X'Y\u0005X'Y\u0004X#Y\u0001Y\u0004X'Y\u0005X'Y\u0004X*X'X1Y\nX.X'Y\u0004X*Y\u0002Y\u0006Y\nX)X'Y\u0004X'Y\u0004X9X'X(X'Y\u0004X.Y\u0008X'X7X1X'Y\u0004Y\u0005X,X*Y\u0005X9X'Y\u0004X/Y\nY\u0003Y\u0008X1X'Y\u0004X3Y\nX'X-X)X9X(X/X'Y\u0004Y\u0004Y\u0007X'Y\u0004X*X1X(Y\nX)X'Y\u0004X1Y\u0008X'X(X7X'Y\u0004X#X/X(Y\nX)X'Y\u0004X'X.X(X'X1X'Y\u0004Y\u0005X*X-X/X)X'Y\u0004X'X:X'Y\u0006Y\ncursor:pointer;</title>\n<meta \" href=\"http://\"><span class=\"members of the window.locationvertical-align:/a> | <a href=\"<!doctype html>media=\"screen\" <option value=\"favicon.ico\" />\n\t\t<div class=\"characteristics\" method=\"get\" /body>\n</html>\nshortcut icon\" document.write(padding-bottom:representativessubmit\" value=\"align=\"center\" throughout the science fiction\n <div class=\"submit\" class=\"one of the most valign=\"top\"><was established);\r\n</script>\r\nreturn false;\">).style.displaybecause of the document.cookie<form action=\"/}body{margin:0;Encyclopedia ofversion of the .createElement(name\" content=\"</div>\n</div>\n\nadministrative </body>\n</html>history of the \"><input type=\"portion of the as part of the &nbsp;<a href=\"other countries\">\n<div class=\"</span></span><In other words,display: block;control of the introduction of/>\n<meta name=\"as well as the in recent years\r\n\t<div class=\"</div>\n\t</div>\ninspired by thethe end of the compatible withbecame known as style=\"margin:.js\"></script>< International there have beenGerman language style=\"color:#Communist Partyconsistent withborder=\"0\" cell marginheight=\"the majority of\" align=\"centerrelated to the many different Orthodox Churchsimilar to the />\n<link rel=\"swas one of the until his death})();\n</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling=\"no\" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign=\"center\">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style=\"width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>\n\t<div class=\"consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method=\"post\" was followed by&amp;mdash; thethe applicationjs\"></script>\r\nul></div></div>after the deathwith respect tostyle=\"padding:is particularlydisplay:inline; type=\"submit\" is divided intod8-f\u0016\u0007 (g.\u0000d=\u0013)responsabilidadadministraciC3ninternacionalescorrespondiente`$\t`$*`$/`%\u000B`$\u0017`$*`%\u0002`$0`%\r`$5`$9`$.`$>`$0`%\u0007`$2`%\u000B`$\u0017`%\u000B`$\u0002`$\u001A`%\u0001`$(`$>`$5`$2`%\u0007`$\u0015`$?`$(`$8`$0`$\u0015`$>`$0`$*`%\u0001`$2`$?`$8`$\u0016`%\u000B`$\u001C`%\u0007`$\u0002`$\u001A`$>`$9`$?`$\u000F`$-`%\u0007`$\u001C`%\u0007`$\u0002`$6`$>`$.`$?`$2`$9`$.`$>`$0`%\u0000`$\u001C`$>`$\u0017`$0`$#`$,`$(`$>`$(`%\u0007`$\u0015`%\u0001`$.`$>`$0`$,`%\r`$2`%\t`$\u0017`$.`$>`$2`$?`$\u0015`$.`$9`$?`$2`$>`$*`%\u0003`$7`%\r`$ `$,`$\"`$<`$$`%\u0007`$-`$>`$\u001C`$*`$>`$\u0015`%\r`$2`$?`$\u0015`$\u001F`%\r`$0`%\u0007`$(`$\u0016`$?`$2`$>`$+`$&`%\u000C`$0`$>`$(`$.`$>`$.`$2`%\u0007`$.`$$`$&`$>`$(`$,`$>`$\u001C`$>`$0`$5`$?`$\u0015`$>`$8`$\u0015`%\r`$/`%\u000B`$\u0002`$\u001A`$>`$9`$$`%\u0007`$*`$9`%\u0001`$\u0001`$\u001A`$,`$$`$>`$/`$>`$8`$\u0002`$5`$>`$&`$&`%\u0007`$\u0016`$(`%\u0007`$*`$?`$\u001B`$2`%\u0007`$5`$?`$6`%\u0007`$7`$0`$>`$\u001C`%\r`$/`$\t`$$`%\r`$$`$0`$.`%\u0001`$\u0002`$,`$\u0008`$&`%\u000B`$(`%\u000B`$\u0002`$\t`$*`$\u0015`$0`$#`$*`$\"`$<`%\u0007`$\u0002`$8`%\r`$%`$?`$$`$+`$?`$2`%\r`$.`$.`%\u0001`$\u0016`%\r`$/`$\u0005`$\u001A`%\r`$\u001B`$>`$\u001B`%\u0002`$\u001F`$$`%\u0000`$8`$\u0002`$\u0017`%\u0000`$$`$\u001C`$>`$\u000F`$\u0017`$>`$5`$?`$-`$>`$\u0017`$\u0018`$#`%\r`$\u001F`%\u0007`$&`%\u0002`$8`$0`%\u0007`$&`$?`$(`%\u000B`$\u0002`$9`$$`%\r`$/`$>`$8`%\u0007`$\u0015`%\r`$8`$\u0017`$>`$\u0002`$'`%\u0000`$5`$?`$6`%\r`$5`$0`$>`$$`%\u0007`$\u0002`$&`%\u0008`$\u001F`%\r`$8`$(`$\u0015`%\r`$6`$>`$8`$>`$.`$(`%\u0007`$\u0005`$&`$>`$2`$$`$,`$?`$\u001C`$2`%\u0000`$*`%\u0001`$0`%\u0002`$7`$9`$?`$\u0002`$&`%\u0000`$.`$?`$$`%\r`$0`$\u0015`$5`$?`$$`$>`$0`%\u0001`$*`$/`%\u0007`$8`%\r`$%`$>`$(`$\u0015`$0`%\u000B`$!`$<`$.`%\u0001`$\u0015`%\r`$$`$/`%\u000B`$\u001C`$(`$>`$\u0015`%\u0003`$*`$/`$>`$*`%\u000B`$8`%\r`$\u001F`$\u0018`$0`%\u0007`$2`%\u0002`$\u0015`$>`$0`%\r`$/`$5`$?`$\u001A`$>`$0`$8`%\u0002`$\u001A`$(`$>`$.`%\u0002`$2`%\r`$/`$&`%\u0007`$\u0016`%\u0007`$\u0002`$9`$.`%\u0007`$6`$>`$8`%\r`$\u0015`%\u0002`$2`$.`%\u0008`$\u0002`$(`%\u0007`$$`%\u0008`$/`$>`$0`$\u001C`$?`$8`$\u0015`%\u0007rss+xml\" title=\"-type\" content=\"title\" content=\"at the same time.js\"></script>\n<\" method=\"post\" </span></a></li>vertical-align:t/jquery.min.js\">.click(function( style=\"padding-})();\n</script>\n</span><a href=\"<a href=\"http://); return false;text-decoration: scrolling=\"no\" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif\" border=\"0\"</body>\n</html>\noverflow:hidden;img src=\"http://addEventListenerresponsible for s.js\"></script>\n/favicon.ico\" />operating system\" style=\"width:1target=\"_blank\">State Universitytext-align:left;\ndocument.write(, including the around the world);\r\n</script>\r\n<\" style=\"height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>\n\t\t</div>\ndisplay: none;\">\" />\n<link rel=\"\n (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the align=\"center\">University Pressdominated by theSecond World Wardistribution of style=\"position:the rest of the characterized by rel=\"nofollow\">derives from therather than the a combination ofstyle=\"width:100English-speakingcomputer scienceborder=\"0\" alt=\"the existence ofDemocratic Party\" style=\"margin-For this reason,.js\"></script>\n\tsByTagName(s)[0]js\"></script>\r\n<.js\"></script>\r\nlink rel=\"icon\" ' alt='' class='formation of theversions of the </a></div></div>/page>\n <page>\n<div class=\"contbecame the firstbahasa Indonesiaenglish (simple)N\u0015N;N;N7N=N9N:N,Q\u0005Q\u0000P2P0Q\u0002Q\u0001P:P8P:P>P<P?P0P=P8P8Q\u000FP2P;Q\u000FP5Q\u0002Q\u0001Q\u000FP\u0014P>P1P0P2P8Q\u0002Q\u000CQ\u0007P5P;P>P2P5P:P0Q\u0000P0P7P2P8Q\u0002P8Q\u000FP\u0018P=Q\u0002P5Q\u0000P=P5Q\u0002P\u001EQ\u0002P2P5Q\u0002P8Q\u0002Q\u000CP=P0P?Q\u0000P8P<P5Q\u0000P8P=Q\u0002P5Q\u0000P=P5Q\u0002P:P>Q\u0002P>Q\u0000P>P3P>Q\u0001Q\u0002Q\u0000P0P=P8Q\u0006Q\u000BP:P0Q\u0007P5Q\u0001Q\u0002P2P5Q\u0003Q\u0001P;P>P2P8Q\u000FQ\u0005P?Q\u0000P>P1P;P5P<Q\u000BP?P>P;Q\u0003Q\u0007P8Q\u0002Q\u000CQ\u000FP2P;Q\u000FQ\u000EQ\u0002Q\u0001Q\u000FP=P0P8P1P>P;P5P5P:P>P<P?P0P=P8Q\u000FP2P=P8P<P0P=P8P5Q\u0001Q\u0000P5P4Q\u0001Q\u0002P2P0X'Y\u0004Y\u0005Y\u0008X'X6Y\nX9X'Y\u0004X1X&Y\nX3Y\nX)X'Y\u0004X'Y\u0006X*Y\u0002X'Y\u0004Y\u0005X4X'X1Y\u0003X'X*Y\u0003X'Y\u0004X3Y\nX'X1X'X*X'Y\u0004Y\u0005Y\u0003X*Y\u0008X(X)X'Y\u0004X3X9Y\u0008X/Y\nX)X'X-X5X'X&Y\nX'X*X'Y\u0004X9X'Y\u0004Y\u0005Y\nX)X'Y\u0004X5Y\u0008X*Y\nX'X*X'Y\u0004X'Y\u0006X*X1Y\u0006X*X'Y\u0004X*X5X'Y\u0005Y\nY\u0005X'Y\u0004X%X3Y\u0004X'Y\u0005Y\nX'Y\u0004Y\u0005X4X'X1Y\u0003X)X'Y\u0004Y\u0005X1X&Y\nX'X*robots\" content=\"<div id=\"footer\">the United States<img src=\"http://.jpg|right|thumb|.js\"></script>\r\n<location.protocolframeborder=\"0\" s\" />\n<meta name=\"</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:\" rel=\"nofollow\" President of the twentieth centuryevision>\n </pageInternet Explorera.async = true;\r\ninformation about<div id=\"header\">\" action=\"http://<a href=\"https://<div id=\"content\"</div>\r\n</div>\r\n<derived from the <img src='http://according to the \n</body>\n</html>\nstyle=\"font-size:script language=\"Arial, Helvetica,</a><span class=\"</script><script political partiestd></tr></table><href=\"http://www.interpretation ofrel=\"stylesheet\" document.write('<charset=\"utf-8\">\nbeginning of the revealed that thetelevision series\" rel=\"nofollow\"> target=\"_blank\">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass=\"clearfix\">/div>\r\n</div>\r\n\r\nthree-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class=\"in some countriesmin.js\"></script>of the populationofficial language<img src=\"images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>\r\n</html>\rN\u0015N;N;N7N=N9N:N,\ntake advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class=\"headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype=\"text/css\">\nthe InternationalAccording to the pe=\"text/css\" />\ncoincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;\" target=\"_blank\" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type=\"application/anguage\" content=\"<meta http-equiv=\"Privacy Policy</a>e(\"%3Cscript src='\" target=\"_blank\">On the other hand,.jpg|thumb|right|2</div><div class=\"<div style=\"float:nineteenth century</body>\r\n</html>\r\n<img src=\"http://s;text-align:centerfont-weight: bold; According to the difference between\" frameborder=\"0\" \" style=\"position:link href=\"http://html4/loose.dtd\">\nduring this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type=\"text\" <span style=\"font-onreadystatechange\t<div class=\"cleardocument.location. For example, the a wide variety of <!DOCTYPE html>\r\n<&nbsp;&nbsp;&nbsp;\"><a href=\"http://style=\"float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype=\"text/css\" />it is possible to Harvard Universitytylesheet\" href=\"/the main characterOxford University name=\"keywords\" cstyle=\"text-align:the United Kingdomfederal government<div style=\"margin depending on the description of the<div class=\"header.min.js\"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc=\"http://staticsuggested that the\" src=\"http://www.a large number of Telecommunications\" rel=\"nofollow\" tHoly Roman Emperoralmost exclusively\" border=\"0\" alt=\"Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle=\"background-<li><em><a href=\"/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src=\"http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref=\"https://www.recent developmentBoard of Directors<div class=\"search| <a href=\"http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>\r\n</div>\r\n\r\n<a href=\"index.phpwas established inmin.js\"></script>\nparticipate in thea strong influencestyle=\"margin-top:represented by thegraduated from theTraditionally, theElement(\"script\");However, since the/div>\n</div>\n<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype=\"image/x-icon/div>\n<div class=\" class=\"clearfix\"><div class=\"footer\t\t</div>\n\t\t</div>\nthe motion pictureP\u0011Q\nP;P3P0Q\u0000Q\u0001P:P8P1Q\nP;P3P0Q\u0000Q\u0001P:P8P$P5P4P5Q\u0000P0Q\u0006P8P8P=P5Q\u0001P:P>P;Q\u000CP:P>Q\u0001P>P>P1Q\tP5P=P8P5Q\u0001P>P>P1Q\tP5P=P8Q\u000FP?Q\u0000P>P3Q\u0000P0P<P<Q\u000BP\u001EQ\u0002P?Q\u0000P0P2P8Q\u0002Q\u000CP1P5Q\u0001P?P;P0Q\u0002P=P>P<P0Q\u0002P5Q\u0000P8P0P;Q\u000BP?P>P7P2P>P;Q\u000FP5Q\u0002P?P>Q\u0001P;P5P4P=P8P5Q\u0000P0P7P;P8Q\u0007P=Q\u000BQ\u0005P?Q\u0000P>P4Q\u0003P:Q\u0006P8P8P?Q\u0000P>P3Q\u0000P0P<P<P0P?P>P;P=P>Q\u0001Q\u0002Q\u000CQ\u000EP=P0Q\u0005P>P4P8Q\u0002Q\u0001Q\u000FP8P7P1Q\u0000P0P=P=P>P5P=P0Q\u0001P5P;P5P=P8Q\u000FP8P7P<P5P=P5P=P8Q\u000FP:P0Q\u0002P5P3P>Q\u0000P8P8P\u0010P;P5P:Q\u0001P0P=P4Q\u0000`$&`%\r`$5`$>`$0`$>`$.`%\u0008`$(`%\u0001`$\u0005`$2`$*`%\r`$0`$&`$>`$(`$-`$>`$0`$$`%\u0000`$/`$\u0005`$(`%\u0001`$&`%\u0007`$6`$9`$?`$(`%\r`$&`%\u0000`$\u0007`$\u0002`$!`$?`$/`$>`$&`$?`$2`%\r`$2`%\u0000`$\u0005`$'`$?`$\u0015`$>`$0`$5`%\u0000`$!`$?`$/`%\u000B`$\u001A`$?`$\u001F`%\r`$ `%\u0007`$8`$.`$>`$\u001A`$>`$0`$\u001C`$\u0002`$\u0015`%\r`$6`$(`$&`%\u0001`$(`$?`$/`$>`$*`%\r`$0`$/`%\u000B`$\u0017`$\u0005`$(`%\u0001`$8`$>`$0`$\u0011`$(`$2`$>`$\u0007`$(`$*`$>`$0`%\r`$\u001F`%\u0000`$6`$0`%\r`$$`%\u000B`$\u0002`$2`%\u000B`$\u0015`$8`$-`$>`$+`$<`%\r`$2`%\u0008`$6`$6`$0`%\r`$$`%\u0007`$\u0002`$*`%\r`$0`$&`%\u0007`$6`$*`%\r`$2`%\u0007`$/`$0`$\u0015`%\u0007`$\u0002`$&`%\r`$0`$8`%\r`$%`$?`$$`$?`$\t`$$`%\r`$*`$>`$&`$\t`$(`%\r`$9`%\u0007`$\u0002`$\u001A`$?`$\u001F`%\r`$ `$>`$/`$>`$$`%\r`$0`$>`$\u001C`%\r`$/`$>`$&`$>`$*`%\u0001`$0`$>`$(`%\u0007`$\u001C`%\u000B`$!`$<`%\u0007`$\u0002`$\u0005`$(`%\u0001`$5`$>`$&`$6`%\r`$0`%\u0007`$#`%\u0000`$6`$?`$\u0015`%\r`$7`$>`$8`$0`$\u0015`$>`$0`%\u0000`$8`$\u0002`$\u0017`%\r`$0`$9`$*`$0`$?`$#`$>`$.`$,`%\r`$0`$>`$\u0002`$!`$,`$\u001A`%\r`$\u001A`%\u000B`$\u0002`$\t`$*`$2`$,`%\r`$'`$.`$\u0002`$$`%\r`$0`%\u0000`$8`$\u0002`$*`$0`%\r`$\u0015`$\t`$.`%\r`$.`%\u0000`$&`$.`$>`$'`%\r`$/`$.`$8`$9`$>`$/`$$`$>`$6`$,`%\r`$&`%\u000B`$\u0002`$.`%\u0000`$!`$?`$/`$>`$\u0006`$\u0008`$*`%\u0000`$\u000F`$2`$.`%\u000B`$,`$>`$\u0007`$2`$8`$\u0002`$\u0016`%\r`$/`$>`$\u0006`$*`$0`%\u0007`$6`$(`$\u0005`$(`%\u0001`$,`$\u0002`$'`$,`$>`$\u001C`$<`$>`$0`$(`$5`%\u0000`$(`$$`$.`$*`%\r`$0`$.`%\u0001`$\u0016`$*`%\r`$0`$6`%\r`$(`$*`$0`$?`$5`$>`$0`$(`%\u0001`$\u0015`$8`$>`$(`$8`$.`$0`%\r`$%`$(`$\u0006`$/`%\u000B`$\u001C`$?`$$`$8`%\u000B`$.`$5`$>`$0X'Y\u0004Y\u0005X4X'X1Y\u0003X'X*X'Y\u0004Y\u0005Y\u0006X*X/Y\nX'X*X'Y\u0004Y\u0003Y\u0005X(Y\nY\u0008X*X1X'Y\u0004Y\u0005X4X'Y\u0007X/X'X*X9X/X/X'Y\u0004X2Y\u0008X'X1X9X/X/X'Y\u0004X1X/Y\u0008X/X'Y\u0004X%X3Y\u0004X'Y\u0005Y\nX)X'Y\u0004Y\u0001Y\u0008X*Y\u0008X4Y\u0008X(X'Y\u0004Y\u0005X3X'X(Y\u0002X'X*X'Y\u0004Y\u0005X9Y\u0004Y\u0008Y\u0005X'X*X'Y\u0004Y\u0005X3Y\u0004X3Y\u0004X'X*X'Y\u0004X,X1X'Y\u0001Y\nY\u0003X3X'Y\u0004X'X3Y\u0004X'Y\u0005Y\nX)X'Y\u0004X'X*X5X'Y\u0004X'X*keywords\" content=\"w3.org/1999/xhtml\"><a target=\"_blank\" text/html; charset=\" target=\"_blank\"><table cellpadding=\"autocomplete=\"off\" text-align: center;to last version by background-color: #\" href=\"http://www./div></div><div id=<a href=\"#\" class=\"\"><img src=\"http://cript\" src=\"http://\n<script language=\"//EN\" \"http://www.wencodeURIComponent(\" href=\"javascript:<div class=\"contentdocument.write('<scposition: absolute;script src=\"http:// style=\"margin-top:.min.js\"></script>\n</div>\n<div class=\"w3.org/1999/xhtml\" \n\r\n</body>\r\n</html>distinction between/\" target=\"_blank\"><link href=\"http://encoding=\"utf-8\"?>\nw.addEventListener?action=\"http://www.icon\" href=\"http:// style=\"background:type=\"text/css\" />\nmeta property=\"og:t<input type=\"text\" style=\"text-align:the development of tylesheet\" type=\"tehtml; charset=utf-8is considered to betable width=\"100%\" In addition to the contributed to the differences betweendevelopment of the It is important to </script>\n\n<script style=\"font-size:1></span><span id=gbLibrary of Congress<img src=\"http://imEnglish translationAcademy of Sciencesdiv style=\"display:construction of the.getElementById(id)in conjunction withElement('script'); <meta property=\"og:P\u0011Q\nP;P3P0Q\u0000Q\u0001P:P8\n type=\"text\" name=\">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src=\"http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style=\"background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet\" href=\"/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland\n</script>\n<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv=\"X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0\" cellpadding=\"0\" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E\"));<a href=\"http://www.<li><a href=\"http://site_name\" content=\"text-decoration:nonestyle=\"display: none<meta http-equiv=\"X-new Date().getTime() type=\"image/x-icon\"</span><span class=\"language=\"javascriptwindow.location.href<a href=\"javascript:-->\r\n<script type=\"t<a href='http://www.hortcut icon\" href=\"</div>\r\n<div class=\"<script src=\"http://\" rel=\"stylesheet\" t</div>\n<script type=/a> <a href=\"http:// allowTransparency=\"X-UA-Compatible\" conrelationship between\n</script>\r\n<script </a></li></ul></div>associated with the programming language</a><a href=\"http://</a></li><li class=\"form action=\"http://<div style=\"display:type=\"text\" name=\"q\"<table width=\"100%\" background-position:\" border=\"0\" width=\"rel=\"shortcut icon\" h6><ul><li><a href=\" <meta http-equiv=\"css\" media=\"screen\" responsible for the \" type=\"application/\" style=\"background-html; charset=utf-8\" allowtransparency=\"stylesheet\" type=\"te\r\n<meta http-equiv=\"></span><span class=\"0\" cellspacing=\"0\">;\n</script>\n<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type=\"hidden\" name=\"javascript:void(0);\"effectiveness of the autocomplete=\"off\" generally considered><input type=\"text\" \"></script>\r\n<scriptthroughout the worldcommon misconceptionassociation with the</div>\n</div>\n<div cduring his lifetime,corresponding to thetype=\"image/x-icon\" an increasing numberdiplomatic relationsare often consideredmeta charset=\"utf-8\" <input type=\"text\" examples include the\"><img src=\"http://iparticipation in thethe establishment of\n</div>\n<div class=\"&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset=\"utf-8\"> type=\"text/css\" />\ninterchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type=\"text/csstype=\"submit\" name=\"families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguC*s (Europeu)P#P:Q\u0000P0Q\u0017P=Q\u0001Q\u000CP:P0Q\u0003P:Q\u0000P0Q\u0017P=Q\u0001Q\u000CP:P0P P>Q\u0001Q\u0001P8P9Q\u0001P:P>P9P<P0Q\u0002P5Q\u0000P8P0P;P>P2P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8P8Q\u0003P?Q\u0000P0P2P;P5P=P8Q\u000FP=P5P>P1Q\u0005P>P4P8P<P>P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000FP\u0018P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000FP P5Q\u0001P?Q\u0003P1P;P8P:P8P:P>P;P8Q\u0007P5Q\u0001Q\u0002P2P>P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000EQ\u0002P5Q\u0000Q\u0000P8Q\u0002P>Q\u0000P8P8P4P>Q\u0001Q\u0002P0Q\u0002P>Q\u0007P=P>X'Y\u0004Y\u0005X*Y\u0008X'X,X/Y\u0008Y\u0006X'Y\u0004X'X4X*X1X'Y\u0003X'X*X'Y\u0004X'Y\u0002X*X1X'X-X'X*html; charset=UTF-8\" setTimeout(function()display:inline-block;<input type=\"submit\" type = 'text/javascri<img src=\"http://www.\" \"http://www.w3.org/shortcut icon\" href=\"\" autocomplete=\"off\" </a></div><div class=</a></li>\n<li class=\"css\" type=\"text/css\" <form action=\"http://xt/css\" href=\"http://link rel=\"alternate\" \r\n<script type=\"text/ onclick=\"javascript:(new Date).getTime()}height=\"1\" width=\"1\" People's Republic of <a href=\"http://www.text-decoration:underthe beginning of the </div>\n</div>\n</div>\nestablishment of the </div></div></div></d#viewport{min-height:\n<script src=\"http://option><option value=often referred to as /option>\n<option valu<!DOCTYPE html>\n<!--[International Airport>\n<a href=\"http://www</a><a href=\"http://w`8 `82`8)`82`9\u0004`8\u0017`8\"a\u0003%a\u0003\u0010a\u0003 a\u0003\u0017a\u0003#a\u0003\u001Aa\u0003\u0018f-#i+\u0014d8-f\u0016\u0007 (g9\u0001i+\u0014)`$(`$?`$0`%\r`$&`%\u0007`$6`$!`$>`$\t`$(`$2`%\u000B`$!`$\u0015`%\r`$7`%\u0007`$$`%\r`$0`$\u001C`$>`$(`$\u0015`$>`$0`%\u0000`$8`$\u0002`$,`$\u0002`$'`$?`$$`$8`%\r`$%`$>`$*`$(`$>`$8`%\r`$5`%\u0000`$\u0015`$>`$0`$8`$\u0002`$8`%\r`$\u0015`$0`$#`$8`$>`$.`$\u0017`%\r`$0`%\u0000`$\u001A`$?`$\u001F`%\r`$ `%\u000B`$\u0002`$5`$?`$\u001C`%\r`$\u001E`$>`$(`$\u0005`$.`%\u0007`$0`$?`$\u0015`$>`$5`$?`$-`$?`$(`%\r`$(`$\u0017`$>`$!`$?`$/`$>`$\u0001`$\u0015`%\r`$/`%\u000B`$\u0002`$\u0015`$?`$8`%\u0001`$0`$\u0015`%\r`$7`$>`$*`$9`%\u0001`$\u0001`$\u001A`$$`%\u0000`$*`%\r`$0`$,`$\u0002`$'`$(`$\u001F`$?`$*`%\r`$*`$#`%\u0000`$\u0015`%\r`$0`$?`$\u0015`%\u0007`$\u001F`$*`%\r`$0`$>`$0`$\u0002`$-`$*`%\r`$0`$>`$*`%\r`$$`$.`$>`$2`$?`$\u0015`%\u000B`$\u0002`$0`$+`$<`%\r`$$`$>`$0`$(`$?`$0`%\r`$.`$>`$#`$2`$?`$.`$?`$\u001F`%\u0007`$!description\" content=\"document.location.prot.getElementsByTagName(<!DOCTYPE html>\n<html <meta charset=\"utf-8\">:url\" content=\"http://.css\" rel=\"stylesheet\"style type=\"text/css\">type=\"text/css\" href=\"w3.org/1999/xhtml\" xmltype=\"text/javascript\" method=\"get\" action=\"link rel=\"stylesheet\" = document.getElementtype=\"image/x-icon\" />cellpadding=\"0\" cellsp.css\" type=\"text/css\" </a></li><li><a href=\"\" width=\"1\" height=\"1\"\"><a href=\"http://www.style=\"display:none;\">alternate\" type=\"appli-//W3C//DTD XHTML 1.0 ellspacing=\"0\" cellpad type=\"hidden\" value=\"/a>&nbsp;<span role=\"s\n<input type=\"hidden\" language=\"JavaScript\" document.getElementsBg=\"0\" cellspacing=\"0\" ype=\"text/css\" media=\"type='text/javascript'with the exception of ype=\"text/css\" rel=\"st height=\"1\" width=\"1\" ='+encodeURIComponent(<link rel=\"alternate\" \nbody, tr, input, textmeta name=\"robots\" conmethod=\"post\" action=\">\n<a href=\"http://www.css\" rel=\"stylesheet\" </div></div><div classlanguage=\"javascript\">aria-hidden=\"true\">B7<ript\" type=\"text/javasl=0;})();\n(function(){background-image: url(/a></li><li><a href=\"h\t\t<li><a href=\"http://ator\" aria-hidden=\"tru> <a href=\"http://www.language=\"javascript\" /option>\n<option value/div></div><div class=rator\" aria-hidden=\"tre=(new Date).getTime()portuguC*s (do Brasil)P>Q\u0000P3P0P=P8P7P0Q\u0006P8P8P2P>P7P<P>P6P=P>Q\u0001Q\u0002Q\u000CP>P1Q\u0000P0P7P>P2P0P=P8Q\u000FQ\u0000P5P3P8Q\u0001Q\u0002Q\u0000P0Q\u0006P8P8P2P>P7P<P>P6P=P>Q\u0001Q\u0002P8P>P1Q\u000FP7P0Q\u0002P5P;Q\u000CP=P0<!DOCTYPE html PUBLIC \"nt-Type\" content=\"text/<meta http-equiv=\"Conteransitional//EN\" \"http:<html xmlns=\"http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = 'text/javascript';<meta name=\"descriptionparentNode.insertBefore<input type=\"hidden\" najs\" type=\"text/javascri(document).ready(functiscript type=\"text/javasimage\" content=\"http://UA-Compatible\" content=tml; charset=utf-8\" />\nlink rel=\"shortcut icon<link rel=\"stylesheet\" </script>\n<script type== document.createElemen<a target=\"_blank\" href= document.getElementsBinput type=\"text\" name=a.type = 'text/javascrinput type=\"hidden\" namehtml; charset=utf-8\" />dtd\">\n<html xmlns=\"http-//W3C//DTD HTML 4.01 TentsByTagName('script')input type=\"hidden\" nam<script type=\"text/javas\" style=\"display:none;\">document.getElementById(=document.createElement(' type='text/javascript'input type=\"text\" name=\"d.getElementsByTagName(snical\" href=\"http://www.C//DTD HTML 4.01 Transit<style type=\"text/css\">\n\n<style type=\"text/css\">ional.dtd\">\n<html xmlns=http-equiv=\"Content-Typeding=\"0\" cellspacing=\"0\"html; charset=utf-8\" />\n style=\"display:none;\"><<li><a href=\"http://www. type='text/javascript'>P4P5Q\u000FQ\u0002P5P;Q\u000CP=P>Q\u0001Q\u0002P8Q\u0001P>P>Q\u0002P2P5Q\u0002Q\u0001Q\u0002P2P8P8P?Q\u0000P>P8P7P2P>P4Q\u0001Q\u0002P2P0P1P5P7P>P?P0Q\u0001P=P>Q\u0001Q\u0002P8`$*`%\u0001`$8`%\r`$$`$?`$\u0015`$>`$\u0015`$>`$\u0002`$\u0017`%\r`$0`%\u0007`$8`$\t`$(`%\r`$9`%\u000B`$\u0002`$(`%\u0007`$5`$?`$'`$>`$(`$8`$-`$>`$+`$?`$\u0015`%\r`$8`$?`$\u0002`$\u0017`$8`%\u0001`$0`$\u0015`%\r`$7`$?`$$`$\u0015`%\t`$*`%\u0000`$0`$>`$\u0007`$\u001F`$5`$?`$\u001C`%\r`$\u001E`$>`$*`$(`$\u0015`$>`$0`%\r`$0`$5`$>`$\u0008`$8`$\u0015`%\r`$0`$?`$/`$$`$>";
+
+ /**
+ * Encoded interval lengths, where 7-th bit is constant.
+ *
+ * To avoid multibyte UTF-8 runes, DATAx literals contain only 7-bit characters.
+ * 7-th bit of original data is well compressed with RLE. As there are only 2 alterating values,
+ * only the lengths of the series are stored.
+ */
private static final String SKIP_FLIP = "\u06F7%\u018C'T%\u0085'W%\u00D7%O%g%\u00A6&\u0193%\u01E5&>&*&'&^&\u0088\u0178\u0C3E&\u01AD&\u0192&)&^&%&'&\u0082&P&1&\u00B1&3&]&m&u&E&t&C&\u00CF&V&V&/&>&6&\u0F76\u177Co&p&@&E&M&P&x&@&F&e&\u00CC&7&:&(&D&0&C&)&.&F&-&1&(&L&F&1\u025E*\u03EA\u21F3&\u1372&K&;&)&E&H&P&0&?&9&V&\u0081&-&v&a&,&E&)&?&=&'&'&B&\u0D2E&\u0503&\u0316*&*8&%&%&&&%,)&\u009A&>&\u0086&7&]&F&2&>&J&6&n&2&%&?&\u008E&2&6&J&g&-&0&,&*&J&*&O&)&6&(&<&B&N&.&P&@&2&.&W&M&%\u053C\u0084(,(<&,&\u03DA&\u18C7&-&,(%&(&%&(\u013B0&X&D&\u0081&j&'&J&(&.&B&3&Z&R&h&3&E&E&<\u00C6-\u0360\u1EF3&%8?&@&,&Z&@&0&J&,&^&x&_&6&C&6&C\u072C\u2A25&f&-&-&-&-&,&J&2&8&z&8&C&Y&8&-&d&\u1E78\u00CC-&7&1&F&7&t&W&7&I&.&.&^&=\u0F9C\u19D3&8(>&/&/&\u077B')'\u1065')'%@/&0&%\u043E\u09C0*&*@&C\u053D\u05D4\u0274\u05EB4\u0DD7\u071A\u04D16\u0D84&/\u0178\u0303Z&*%\u0246\u03FF&\u0134&1\u00A8\u04B4\u0174";
- private static void unpackDictionaryData(
- ByteBuffer dictionary, String data0, String data1, String skipFlip) {
+ /**
+ * Encoded sizeBits array.
+ *
+ * Values: 0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10, 9, 9, 8, 7, 7, 8, 7, 7, 6, 6, 5, 5
+ */
+ private static final String SIZE_BITS_DATA = "AAAAKKLLKKKKKJJIHHIHHGGFF";
+
+ private static void unpackDictionaryData(ByteBuffer dictionary, String data0, String data1,
+ String skipFlip, int[] sizeBits, String sizeBitsData) {
// Initialize lower 7 bits of every byte in the dictionary.
byte[] dict = Utils.toUsAsciiBytes(data0 + data1);
if (dict.length != dictionary.capacity()) {
@@ -39,13 +54,18 @@ final class DictionaryData {
}
}
+ for (int i = 0; i < sizeBitsData.length(); ++i) {
+ sizeBits[i] = sizeBitsData.charAt(i) - 65;
+ }
+
dictionary.put(dict);
}
static {
ByteBuffer dictionary = ByteBuffer.allocateDirect(122784);
- unpackDictionaryData(dictionary, DATA0, DATA1, SKIP_FLIP);
+ int[] sizeBits = new int[25];
+ unpackDictionaryData(dictionary, DATA0, DATA1, SKIP_FLIP, sizeBits, SIZE_BITS_DATA);
Utils.flipBuffer(dictionary);
- Dictionary.setData(dictionary.asReadOnlyBuffer());
+ Dictionary.setData(dictionary.asReadOnlyBuffer(), sizeBits);
}
}
diff --git a/java/org/brotli/dec/EagerStreamTest.java b/java/org/brotli/dec/EagerStreamTest.java
index 069ae34..8e079c0 100755..100644
--- a/java/org/brotli/dec/EagerStreamTest.java
+++ b/java/org/brotli/dec/EagerStreamTest.java
@@ -375,7 +375,7 @@ public class EagerStreamTest {
ps = new ProxyStream(new ByteArrayInputStream(DATA));
reader = new BrotliInputStream(ps, 1);
- reader.setEager(true);
+ reader.enableEagerOutput();
reader.read(buffer);
reader.close();
int eagerReadBytes = ps.readBytes;
diff --git a/java/org/brotli/dec/Huffman.java b/java/org/brotli/dec/Huffman.java
index 868701a..38f7f29 100644
--- a/java/org/brotli/dec/Huffman.java
+++ b/java/org/brotli/dec/Huffman.java
@@ -58,9 +58,12 @@ final class Huffman {
/**
* Builds Huffman lookup table assuming code lengths are in symbol order.
+ *
+ * @return number of slots used by resulting Huffman table
*/
- static void buildHuffmanTable(int[] rootTable, int tableOffset, int rootBits, int[] codeLengths,
+ static int buildHuffmanTable(int[] tableGroup, int tableIdx, int rootBits, int[] codeLengths,
int codeLengthsSize) {
+ int tableOffset = tableGroup[tableIdx];
int key; // Reversed prefix code.
int[] sorted = new int[codeLengthsSize]; // Symbols sorted by code length.
// TODO: fill with zeroes?
@@ -93,9 +96,9 @@ final class Huffman {
// Special case code with only one value.
if (offset[MAX_LENGTH] == 1) {
for (key = 0; key < totalSize; key++) {
- rootTable[tableOffset + key] = sorted[0];
+ tableGroup[tableOffset + key] = sorted[0];
}
- return;
+ return totalSize;
}
// Fill in root table.
@@ -103,7 +106,8 @@ final class Huffman {
symbol = 0;
for (int len = 1, step = 2; len <= rootBits; len++, step <<= 1) {
for (; count[len] > 0; count[len]--) {
- replicateValue(rootTable, tableOffset + key, step, tableSize, len << 16 | sorted[symbol++]);
+ replicateValue(tableGroup, tableOffset + key, step, tableSize,
+ len << 16 | sorted[symbol++]);
key = getNextKey(key, len);
}
}
@@ -120,13 +124,14 @@ final class Huffman {
tableSize = 1 << tableBits;
totalSize += tableSize;
low = key & mask;
- rootTable[tableOffset + low] =
+ tableGroup[tableOffset + low] =
(tableBits + rootBits) << 16 | (currentOffset - tableOffset - low);
}
- replicateValue(rootTable, currentOffset + (key >> rootBits), step, tableSize,
+ replicateValue(tableGroup, currentOffset + (key >> rootBits), step, tableSize,
(len - rootBits) << 16 | sorted[symbol++]);
key = getNextKey(key, len);
}
}
+ return totalSize;
}
}
diff --git a/java/org/brotli/dec/SetDictionaryTest.java b/java/org/brotli/dec/SetDictionaryTest.java
index f462c49..d49a8f0 100644
--- a/java/org/brotli/dec/SetDictionaryTest.java
+++ b/java/org/brotli/dec/SetDictionaryTest.java
@@ -65,7 +65,10 @@ public class SetDictionaryTest {
FileChannel dictionaryChannel =
new FileInputStream(System.getProperty("RFC_DICTIONARY")).getChannel();
ByteBuffer dictionary = dictionaryChannel.map(FileChannel.MapMode.READ_ONLY, 0, 122784).load();
- Dictionary.setData(dictionary);
+ int[] sizeBits = {
+ 0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10, 9, 9, 8, 7, 7, 8, 7, 7, 6, 6, 5, 5
+ };
+ Dictionary.setData(dictionary, sizeBits);
// Retry decoding of dictionary item.
decoder = new BrotliInputStream(new ByteArrayInputStream(BASE_DICT_WORD));
diff --git a/java/org/brotli/dec/State.java b/java/org/brotli/dec/State.java
index 2dc46d5..7bcf070 100644
--- a/java/org/brotli/dec/State.java
+++ b/java/org/brotli/dec/State.java
@@ -13,6 +13,7 @@ final class State {
byte[] contextModes;
byte[] contextMap;
byte[] distContextMap;
+ byte[] distExtraBits;
byte[] output;
byte[] byteBuffer; // BitReader
@@ -21,9 +22,10 @@ final class State {
int[] intBuffer; // BitReader
int[] rings;
int[] blockTrees;
- int[] hGroup0;
- int[] hGroup1;
- int[] hGroup2;
+ int[] literalTreeGroup;
+ int[] commandTreeGroup;
+ int[] distanceTreeGroup;
+ int[] distOffset;
long accumulator64; // BitReader: pre-fetched bits.
@@ -48,18 +50,16 @@ final class State {
int maxDistance;
int distRbIdx;
int trivialLiteralContext;
- int literalTreeIndex;
- int literalTree;
+ int literalTreeIdx;
+ int commandTreeIdx;
int j;
int insertLength;
int contextMapSlice;
int distContextMapSlice;
int contextLookupOffset1;
int contextLookupOffset2;
- int treeCommandOffset;
int distanceCode;
int numDirectDistanceCodes;
- int distancePostfixMask;
int distancePostfixBits;
int distance;
int copyLength;
@@ -73,6 +73,19 @@ final class State {
int ringBufferBytesWritten;
int ringBufferBytesReady;
int isEager;
+ int isLargeWindow;
+
+ // Compound dictionary
+ int cdNumChunks;
+ int cdTotalSize;
+ int cdBrIndex;
+ int cdBrOffset;
+ int cdBrLength;
+ int cdBrCopied;
+ byte[][] cdChunks;
+ int[] cdChunkOffsets;
+ int cdBlockBits;
+ byte[] cdBlockMap;
InputStream input; // BitReader
diff --git a/java/org/brotli/dec/SynthTest.java b/java/org/brotli/dec/SynthTest.java
index c95a3c9..e269e6b 100644
--- a/java/org/brotli/dec/SynthTest.java
+++ b/java/org/brotli/dec/SynthTest.java
@@ -12,6 +12,7 @@ import static org.junit.Assert.fail;
import java.io.ByteArrayInputStream;
import java.io.ByteArrayOutputStream;
import java.io.IOException;
+import java.util.Arrays;
import org.junit.Test;
import org.junit.runner.RunWith;
import org.junit.runners.JUnit4;
@@ -65,6 +66,474 @@ public class SynthTest {
/* GENERATED CODE START */
@Test
+ public void testAllTransforms10() {
+ byte[] compressed = {
+ (byte) 0x1b, (byte) 0xfc, (byte) 0x05, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x80,
+ (byte) 0xe3, (byte) 0xb4, (byte) 0x0d, (byte) 0x00, (byte) 0x00, (byte) 0x07, (byte) 0x5b,
+ (byte) 0x26, (byte) 0x31, (byte) 0x40, (byte) 0x02, (byte) 0x00, (byte) 0xe0, (byte) 0x4e,
+ (byte) 0x1b, (byte) 0x13, (byte) 0x7c, (byte) 0x84, (byte) 0x26, (byte) 0xf8, (byte) 0x04,
+ (byte) 0x10, (byte) 0x4c, (byte) 0xf0, (byte) 0x89, (byte) 0x38, (byte) 0x30, (byte) 0xc1,
+ (byte) 0x27, (byte) 0x4e, (byte) 0xc1, (byte) 0x04, (byte) 0x9f, (byte) 0x64, (byte) 0x06,
+ (byte) 0x26, (byte) 0xf8, (byte) 0x24, (byte) 0x3f, (byte) 0x34, (byte) 0xc1, (byte) 0x27,
+ (byte) 0x7d, (byte) 0x82, (byte) 0x09, (byte) 0x3e, (byte) 0xe9, (byte) 0x16, (byte) 0x4d,
+ (byte) 0xf0, (byte) 0xc9, (byte) 0xd2, (byte) 0xc0, (byte) 0x04, (byte) 0x9f, (byte) 0x0c,
+ (byte) 0x8f, (byte) 0x4c, (byte) 0xf0, (byte) 0xc9, (byte) 0x06, (byte) 0xd1, (byte) 0x04,
+ (byte) 0x9f, (byte) 0x6c, (byte) 0x92, (byte) 0x4d, (byte) 0xf0, (byte) 0xc9, (byte) 0x39,
+ (byte) 0xc1, (byte) 0x04, (byte) 0x9f, (byte) 0xdc, (byte) 0x94, (byte) 0x4c, (byte) 0xf0,
+ (byte) 0xc9, (byte) 0x69, (byte) 0xd1, (byte) 0x04, (byte) 0x9f, (byte) 0x3c, (byte) 0x98,
+ (byte) 0x4d, (byte) 0xf0, (byte) 0x29, (byte) 0x9c, (byte) 0x81, (byte) 0x09, (byte) 0x3e,
+ (byte) 0x45, (byte) 0x37, (byte) 0x31, (byte) 0xc1, (byte) 0xa7, (byte) 0x60, (byte) 0x47,
+ (byte) 0x26, (byte) 0xf8, (byte) 0x14, (byte) 0xfa, (byte) 0xcc, (byte) 0x04, (byte) 0x9f,
+ (byte) 0xc2, (byte) 0x20, (byte) 0x9a, (byte) 0xe0, (byte) 0x53, (byte) 0x48, (byte) 0x54,
+ (byte) 0x13, (byte) 0x7c, (byte) 0x8a, (byte) 0x8f, (byte) 0x6c, (byte) 0x82, (byte) 0x4f,
+ (byte) 0xb1, (byte) 0xd2, (byte) 0x4d, (byte) 0xf0, (byte) 0x29, (byte) 0x67, (byte) 0x82,
+ (byte) 0x09, (byte) 0x3e, (byte) 0xe5, (byte) 0x4f, (byte) 0x31, (byte) 0xc1, (byte) 0xa7,
+ (byte) 0x7c, (byte) 0x4a, (byte) 0x26, (byte) 0xf8, (byte) 0x94, (byte) 0x57, (byte) 0xcd,
+ (byte) 0x04, (byte) 0x9f, (byte) 0x12, (byte) 0x2c, (byte) 0x9a, (byte) 0xe0, (byte) 0x53,
+ (byte) 0xba, (byte) 0x55, (byte) 0x13, (byte) 0x7c, (byte) 0xca, (byte) 0xbf, (byte) 0x6c,
+ (byte) 0x82, (byte) 0x4f, (byte) 0xb9, (byte) 0xd8, (byte) 0x4d, (byte) 0xf0, (byte) 0xa9,
+ (byte) 0x30, (byte) 0x03, (byte) 0x13, (byte) 0x7c, (byte) 0x2a, (byte) 0xd2, (byte) 0xc2,
+ (byte) 0x04, (byte) 0x9f, (byte) 0x4a, (byte) 0x36, (byte) 0x31, (byte) 0xc1, (byte) 0xa7,
+ (byte) 0xca, (byte) 0x6d, (byte) 0x4c, (byte) 0xf0, (byte) 0xa9, (byte) 0x94, (byte) 0x23,
+ (byte) 0x13, (byte) 0x7c, (byte) 0x2a, (byte) 0xeb, (byte) 0xca, (byte) 0x04, (byte) 0x9f,
+ (byte) 0xea, (byte) 0x3c, (byte) 0x33, (byte) 0xc1, (byte) 0xa7, (byte) 0xb2, (byte) 0xef,
+ (byte) 0x4c, (byte) 0xf0, (byte) 0xa9, (byte) 0xf8, (byte) 0x43, (byte) 0x13, (byte) 0x7c,
+ (byte) 0xaa, (byte) 0x00, (byte) 0xd3, (byte) 0x04, (byte) 0x9f, (byte) 0x2a, (byte) 0x42,
+ (byte) 0x35, (byte) 0xc1, (byte) 0xa7, (byte) 0xc2, (byte) 0x70, (byte) 0x4d, (byte) 0xf0,
+ (byte) 0xa9, (byte) 0x52, (byte) 0x64, (byte) 0x13, (byte) 0x7c, (byte) 0x2a, (byte) 0x1a,
+ (byte) 0xdb, (byte) 0x04, (byte) 0x9f, (byte) 0x6a, (byte) 0x48, (byte) 0x37, (byte) 0xc1,
+ (byte) 0xa7, (byte) 0x92, (byte) 0xf2, (byte) 0x4d, (byte) 0xf0, (byte) 0xa9, (byte) 0xc3,
+ (byte) 0x04, (byte) 0x13, (byte) 0x7c, (byte) 0xea, (byte) 0x32, (byte) 0xc3, (byte) 0x04,
+ (byte) 0x9f, (byte) 0x7a, (byte) 0x4e, (byte) 0x31, (byte) 0xc1, (byte) 0xa7, (byte) 0x06,
+ (byte) 0x74, (byte) 0x4c, (byte) 0xf0, (byte) 0xa9, (byte) 0x19, (byte) 0x25, (byte) 0x13,
+ (byte) 0x7c, (byte) 0x6a, (byte) 0x4d, (byte) 0xcb, (byte) 0x04, (byte) 0x9f, (byte) 0x1a,
+ (byte) 0x55, (byte) 0x33, (byte) 0xc1, (byte) 0xa7, (byte) 0x56, (byte) 0xf5, (byte) 0x4c,
+ (byte) 0xf0, (byte) 0xa9, (byte) 0x5d, (byte) 0x45, (byte) 0x13, (byte) 0x7c, (byte) 0xea,
+ (byte) 0x59, (byte) 0xd3, (byte) 0x04, (byte) 0x9f, (byte) 0xfa, (byte) 0x57, (byte) 0x35,
+ (byte) 0xc1, (byte) 0xa7, (byte) 0x66, (byte) 0x76, (byte) 0x4d, (byte) 0xf0, (byte) 0xa9,
+ (byte) 0x9f, (byte) 0x65, (byte) 0x13, (byte) 0x7c, (byte) 0x6a, (byte) 0x6f, (byte) 0xdb,
+ (byte) 0x04, (byte) 0x9f, (byte) 0x9a, (byte) 0x5d, (byte) 0x37, (byte) 0xc1, (byte) 0xa7,
+ (byte) 0x06, (byte) 0xf8, (byte) 0x4d, (byte) 0xf0, (byte) 0x69, (byte) 0x0c, (byte) 0x06,
+ (byte) 0x26, (byte) 0xf8, (byte) 0x34, (byte) 0x08, (byte) 0x07, (byte) 0x13, (byte) 0x7c,
+ (byte) 0x1a, (byte) 0x8b, (byte) 0x85, (byte) 0x09, (byte) 0x3e, (byte) 0x8d, (byte) 0xc8,
+ (byte) 0xc3, (byte) 0x04, (byte) 0x9f, (byte) 0xe6, (byte) 0x65, (byte) 0x62, (byte) 0x82,
+ (byte) 0x4f, (byte) 0xb3, (byte) 0x73, (byte) 0x31, (byte) 0xc1, (byte) 0xa7, (byte) 0x41,
+ (byte) 0xda, (byte) 0x98, (byte) 0xe0, (byte) 0xd3, (byte) 0x54, (byte) 0x7d, (byte) 0x4c,
+ (byte) 0xf0, (byte) 0x69, (byte) 0xc4, (byte) 0x46, (byte) 0x26, (byte) 0xf8, (byte) 0x34,
+ (byte) 0x72, (byte) 0x27, (byte) 0x13, (byte) 0x7c, (byte) 0x1a, (byte) 0xc5, (byte) 0x95,
+ (byte) 0x09, (byte) 0x3e, (byte) 0x8d, (byte) 0xe5, (byte) 0xcb, (byte) 0x04, (byte) 0x9f,
+ (byte) 0x06, (byte) 0x75, (byte) 0x66, (byte) 0x82, (byte) 0x4f, (byte) 0x43, (byte) 0x7b,
+ (byte) 0x33, (byte) 0xc1, (byte) 0xa7, (byte) 0x09, (byte) 0xde, (byte) 0x99, (byte) 0xe0,
+ (byte) 0xd3, (byte) 0x34, (byte) 0xff, (byte) 0x4c, (byte) 0xf0, (byte) 0x69, (byte) 0xb2,
+ (byte) 0x87, (byte) 0x26, (byte) 0xf8, (byte) 0x34, (byte) 0xe9, (byte) 0x47, (byte) 0x13,
+ (byte) 0x7c, (byte) 0x9a, (byte) 0xfb, (byte) 0xa5, (byte) 0x09, (byte) 0x3e, (byte) 0x4d,
+ (byte) 0x01, (byte) 0xd4, (byte) 0x04, (byte) 0x9f, (byte) 0x46, (byte) 0x82, (byte) 0x6a,
+ (byte) 0x82, (byte) 0x4f, (byte) 0x03, (byte) 0x82, (byte) 0x35, (byte) 0xc1, (byte) 0xa7,
+ (byte) 0x61, (byte) 0xe1, (byte) 0x9a, (byte) 0xe0, (byte) 0xd3, (byte) 0xe4, (byte) 0x80,
+ (byte) 0x4d, (byte) 0xf0, (byte) 0x69, (byte) 0x8a, (byte) 0xc8, (byte) 0x26, (byte) 0xf8,
+ (byte) 0x34, (byte) 0x52, (byte) 0x68, (byte) 0x13, (byte) 0x7c, (byte) 0x9a, (byte) 0x2f,
+ (byte) 0xb6, (byte) 0x09, (byte) 0x3e, (byte) 0x8d, (byte) 0x1b, (byte) 0xdc, (byte) 0x04,
+ (byte) 0x9f, (byte) 0x86, (byte) 0x8f, (byte) 0x6e, (byte) 0x82, (byte) 0x4f, (byte) 0xb3,
+ (byte) 0x88, (byte) 0x37, (byte) 0xc1, (byte) 0xa7, (byte) 0xd9, (byte) 0xe4, (byte) 0x9b,
+ (byte) 0xe0, (byte) 0xd3, (byte) 0x9e, (byte) 0x02, (byte) 0x4c, (byte) 0xf0, (byte) 0x69,
+ (byte) 0x6d, (byte) 0x09, (byte) 0x26, (byte) 0xf8, (byte) 0xb4, (byte) 0xc3, (byte) 0x08,
+ (byte) 0x13, (byte) 0x7c, (byte) 0x5a, (byte) 0x68, (byte) 0x86, (byte) 0x09, (byte) 0x3e,
+ (byte) 0xad, (byte) 0x37, (byte) 0xc4, (byte) 0x04, (byte) 0x9f, (byte) 0x56, (byte) 0x9d,
+ (byte) 0x62, (byte) 0x82, (byte) 0x4f, (byte) 0x9b, (byte) 0x8f, (byte) 0x31, (byte) 0xc1,
+ (byte) 0xa7, (byte) 0x2d, (byte) 0xe8, (byte) 0x98, (byte) 0xe0, (byte) 0xd3, (byte) 0x4a,
+ (byte) 0x84, (byte) 0x4c, (byte) 0xf0, (byte) 0x69, (byte) 0x3f, (byte) 0x4a, (byte) 0x26,
+ (byte) 0xf8, (byte) 0xb4, (byte) 0x2c, (byte) 0x29, (byte) 0x13, (byte) 0x7c, (byte) 0xda,
+ (byte) 0x9c, (byte) 0x96, (byte) 0x09, (byte) 0x3e, (byte) 0x2d, (byte) 0x52, (byte) 0xcc,
+ (byte) 0x04, (byte) 0x9f, (byte) 0xb6, (byte) 0xaa, (byte) 0x66, (byte) 0x82, (byte) 0x4f,
+ (byte) 0x2b, (byte) 0x96, (byte) 0x33, (byte) 0xc1, (byte) 0xa7, (byte) 0x7d, (byte) 0xeb,
+ (byte) 0x99, (byte) 0xe0, (byte) 0xd3, (byte) 0xf6, (byte) 0x05, (byte) 0x4d, (byte) 0xf0,
+ (byte) 0x69, (byte) 0x17, (byte) 0x8b, (byte) 0x26, (byte) 0xf8, (byte) 0xb4, (byte) 0x97,
+ (byte) 0x49, (byte) 0x13, (byte) 0x7c, (byte) 0xda, (byte) 0xd1, (byte) 0xa6, (byte) 0x09,
+ (byte) 0x3e, (byte) 0x2d, (byte) 0x6c, (byte) 0xd4, (byte) 0x04, (byte) 0x9f, (byte) 0xb6,
+ (byte) 0xb7, (byte) 0x6a, (byte) 0x82, (byte) 0x4f, (byte) 0xab, (byte) 0x9c, (byte) 0x35,
+ (byte) 0xc1, (byte) 0xa7, (byte) 0xc5, (byte) 0xee, (byte) 0x9a, (byte) 0xe0, (byte) 0xd3,
+ (byte) 0x9a, (byte) 0x87, (byte) 0x4d, (byte) 0xf0, (byte) 0x69, (byte) 0xe9, (byte) 0xcb
+ };
+ checkSynth(
+ /*
+ * // The stream consists of word "time" with all possible transforms.
+ * main_header
+ * metablock_header_easy: 1533, 1
+ * command_easy: 10, "|", 2 // = 0 << 10 + 1 + 1
+ * command_easy: 10, "|", 1037 // = 1 << 10 + 1 + 12
+ * command_easy: 10, "|", 2073 // = 2 << 10 + 1 + 24
+ * command_easy: 10, "|", 3110 // = 3 << 10 + 1 + 37
+ * command_easy: 10, "|", 4144 // = 4 << 10 + 1 + 47
+ * command_easy: 10, "|", 5180 // = 5 << 10 + 1 + 59
+ * command_easy: 10, "|", 6220 // = 6 << 10 + 1 + 75
+ * command_easy: 10, "|", 7256 // = 7 << 10 + 1 + 87
+ * command_easy: 10, "|", 8294 // = 8 << 10 + 1 + 101
+ * command_easy: 10, "|", 9333 // = 9 << 10 + 1 + 116
+ * command_easy: 10, "|", 10368 // = 10 << 10 + 1 + 127
+ * command_easy: 10, "|", 11408 // = 11 << 10 + 1 + 143
+ * command_easy: 10, "|", 12441 // = 12 << 10 + 1 + 152
+ * command_easy: 10, "|", 13475 // = 13 << 10 + 1 + 162
+ * command_easy: 10, "|", 14513 // = 14 << 10 + 1 + 176
+ * command_easy: 10, "|", 15550 // = 15 << 10 + 1 + 189
+ * command_easy: 10, "|", 16587 // = 16 << 10 + 1 + 202
+ * command_easy: 10, "|", 17626 // = 17 << 10 + 1 + 217
+ * command_easy: 10, "|", 18665 // = 18 << 10 + 1 + 232
+ * command_easy: 10, "|", 19703 // = 19 << 10 + 1 + 246
+ * command_easy: 10, "|", 20739 // = 20 << 10 + 1 + 258
+ * command_easy: 10, "|", 21775 // = 21 << 10 + 1 + 270
+ * command_easy: 10, "|", 22812 // = 22 << 10 + 1 + 283
+ * command_easy: 10, "|", 23848 // = 23 << 10 + 1 + 295
+ * command_easy: 10, "|", 24880 // = 24 << 10 + 1 + 303
+ * command_easy: 10, "|", 25916 // = 25 << 10 + 1 + 315
+ * command_easy: 10, "|", 26956 // = 26 << 10 + 1 + 331
+ * command_easy: 10, "|", 27988 // = 27 << 10 + 1 + 339
+ * command_easy: 10, "|", 29021 // = 28 << 10 + 1 + 348
+ * command_easy: 10, "|", 30059 // = 29 << 10 + 1 + 362
+ * command_easy: 10, "|", 31100 // = 30 << 10 + 1 + 379
+ * command_easy: 10, "|", 32136 // = 31 << 10 + 1 + 391
+ * command_easy: 10, "|", 33173 // = 32 << 10 + 1 + 404
+ * command_easy: 10, "|", 34209 // = 33 << 10 + 1 + 416
+ * command_easy: 10, "|", 35247 // = 34 << 10 + 1 + 430
+ * command_easy: 10, "|", 36278 // = 35 << 10 + 1 + 437
+ * command_easy: 10, "|", 37319 // = 36 << 10 + 1 + 454
+ * command_easy: 10, "|", 38355 // = 37 << 10 + 1 + 466
+ * command_easy: 10, "|", 39396 // = 38 << 10 + 1 + 483
+ * command_easy: 10, "|", 40435 // = 39 << 10 + 1 + 498
+ * command_easy: 10, "|", 41465 // = 40 << 10 + 1 + 504
+ * command_easy: 10, "|", 42494 // = 41 << 10 + 1 + 509
+ * command_easy: 10, "|", 43534 // = 42 << 10 + 1 + 525
+ * command_easy: 10, "|", 44565 // = 43 << 10 + 1 + 532
+ * command_easy: 10, "|", 45606 // = 44 << 10 + 1 + 549
+ * command_easy: 10, "|", 46641 // = 45 << 10 + 1 + 560
+ * command_easy: 10, "|", 47680 // = 46 << 10 + 1 + 575
+ * command_easy: 10, "|", 48719 // = 47 << 10 + 1 + 590
+ * command_easy: 10, "|", 49758 // = 48 << 10 + 1 + 605
+ * command_easy: 10, "|", 50786 // = 49 << 10 + 1 + 609
+ * command_easy: 10, "|", 51824 // = 50 << 10 + 1 + 623
+ * command_easy: 10, "|", 52861 // = 51 << 10 + 1 + 636
+ * command_easy: 10, "|", 53897 // = 52 << 10 + 1 + 648
+ * command_easy: 10, "|", 54935 // = 53 << 10 + 1 + 662
+ * command_easy: 10, "|", 55973 // = 54 << 10 + 1 + 676
+ * command_easy: 10, "|", 56999 // = 55 << 10 + 1 + 678
+ * command_easy: 10, "|", 58027 // = 56 << 10 + 1 + 682
+ * command_easy: 10, "|", 59056 // = 57 << 10 + 1 + 687
+ * command_easy: 10, "|", 60092 // = 58 << 10 + 1 + 699
+ * command_easy: 10, "|", 61129 // = 59 << 10 + 1 + 712
+ * command_easy: 10, "|", 62156 // = 60 << 10 + 1 + 715
+ * command_easy: 10, "|", 63195 // = 61 << 10 + 1 + 730
+ * command_easy: 10, "|", 64233 // = 62 << 10 + 1 + 744
+ * command_easy: 10, "|", 65277 // = 63 << 10 + 1 + 764
+ * command_easy: 10, "|", 66307 // = 64 << 10 + 1 + 770
+ * command_easy: 10, "|", 67333 // = 65 << 10 + 1 + 772
+ * command_easy: 10, "|", 68371 // = 66 << 10 + 1 + 786
+ * command_easy: 10, "|", 69407 // = 67 << 10 + 1 + 798
+ * command_easy: 10, "|", 70444 // = 68 << 10 + 1 + 811
+ * command_easy: 10, "|", 71480 // = 69 << 10 + 1 + 823
+ * command_easy: 10, "|", 72517 // = 70 << 10 + 1 + 836
+ * command_easy: 10, "|", 73554 // = 71 << 10 + 1 + 849
+ * command_easy: 10, "|", 74591 // = 72 << 10 + 1 + 862
+ * command_easy: 10, "|", 75631 // = 73 << 10 + 1 + 878
+ * command_easy: 10, "|", 76679 // = 74 << 10 + 1 + 902
+ * command_easy: 10, "|", 77715 // = 75 << 10 + 1 + 914
+ * command_easy: 10, "|", 78757 // = 76 << 10 + 1 + 932
+ * command_easy: 10, "|", 79793 // = 77 << 10 + 1 + 944
+ * command_easy: 10, "|", 80830 // = 78 << 10 + 1 + 957
+ * command_easy: 10, "|", 81866 // = 79 << 10 + 1 + 969
+ * command_easy: 10, "|", 82902 // = 80 << 10 + 1 + 981
+ * command_easy: 10, "|", 83942 // = 81 << 10 + 1 + 997
+ * command_easy: 10, "|", 84980 // = 82 << 10 + 1 + 1011
+ * command_easy: 10, "|", 86018 // = 83 << 10 + 1 + 1025
+ * command_easy: 10, "|", 87055 // = 84 << 10 + 1 + 1038
+ * command_easy: 10, "|", 88093 // = 85 << 10 + 1 + 1052
+ * command_easy: 10, "|", 89129 // = 86 << 10 + 1 + 1064
+ * command_easy: 10, "|", 90166 // = 87 << 10 + 1 + 1077
+ * command_easy: 10, "|", 91202 // = 88 << 10 + 1 + 1089
+ * command_easy: 10, "|", 92239 // = 89 << 10 + 1 + 1102
+ * command_easy: 10, "|", 93276 // = 90 << 10 + 1 + 1115
+ * command_easy: 10, "|", 94315 // = 91 << 10 + 1 + 1130
+ * command_easy: 10, "|", 95353 // = 92 << 10 + 1 + 1144
+ * command_easy: 10, "|", 96392 // = 93 << 10 + 1 + 1159
+ * command_easy: 10, "|", 97432 // = 94 << 10 + 1 + 1175
+ * command_easy: 10, "|", 98468 // = 95 << 10 + 1 + 1187
+ * command_easy: 10, "|", 99507 // = 96 << 10 + 1 + 1202
+ * command_easy: 10, "|", 100544 // = 97 << 10 + 1 + 1215
+ * command_easy: 10, "|", 101581 // = 98 << 10 + 1 + 1228
+ * command_easy: 10, "|", 102619 // = 99 << 10 + 1 + 1242
+ * command_easy: 10, "|", 103655 // = 100 << 10 + 1 + 1254
+ * command_easy: 10, "|", 104694 // = 101 << 10 + 1 + 1269
+ * command_easy: 10, "|", 105730 // = 102 << 10 + 1 + 1281
+ * command_easy: 10, "|", 106767 // = 103 << 10 + 1 + 1294
+ * command_easy: 10, "|", 107804 // = 104 << 10 + 1 + 1307
+ * command_easy: 10, "|", 108841 // = 105 << 10 + 1 + 1320
+ * command_easy: 10, "|", 109878 // = 106 << 10 + 1 + 1333
+ * command_easy: 10, "|", 110917 // = 107 << 10 + 1 + 1348
+ * command_easy: 10, "|", 111954 // = 108 << 10 + 1 + 1361
+ * command_easy: 10, "|", 112991 // = 109 << 10 + 1 + 1374
+ * command_easy: 10, "|", 114028 // = 110 << 10 + 1 + 1387
+ * command_easy: 10, "|", 115066 // = 111 << 10 + 1 + 1401
+ * command_easy: 10, "|", 116104 // = 112 << 10 + 1 + 1415
+ * command_easy: 10, "|", 117140 // = 113 << 10 + 1 + 1427
+ * command_easy: 10, "|", 118176 // = 114 << 10 + 1 + 1439
+ * command_easy: 10, "|", 119213 // = 115 << 10 + 1 + 1452
+ * command_easy: 10, "|", 120250 // = 116 << 10 + 1 + 1465
+ * command_easy: 10, "|", 121287 // = 117 << 10 + 1 + 1478
+ * command_easy: 10, "|", 122325 // = 118 << 10 + 1 + 1492
+ * command_easy: 10, "|", 123363 // = 119 << 10 + 1 + 1506
+ * command_easy: 10, "|", 124401 // = 120 << 10 + 1 + 1520
+ */
+ compressed,
+ true,
+ "|categories|categories | categories |ategories|Categories |categories the | categories|s cat"
+ + "egories |categories of |Categories|categories and |tegories|categorie|, categories |catego"
+ + "ries, | Categories |categories in |categories to |e categories |categories\"|categories.|c"
+ + "ategories\">|categories\n|categor|categories]|categories for |egories|categori|categories "
+ + "a |categories that | Categories|categories. |.categories| categories, |gories|categories w"
+ + "ith |categories'|categories from |categories by |ories|ries| the categories|catego|categor"
+ + "ies. The |CATEGORIES|categories on |categories as |categories is |cat|categorieing |catego"
+ + "ries\n\t|categories:| categories. |categoriesed |s|ies|cate|categories(|Categories, |ca|ca"
+ + "tegories at |categoriesly | the categories of |categ|c| Categories, |Categories\"|.categor"
+ + "ies(|CATEGORIES |Categories\">|categories=\"| categories.|.com/categories| the categories "
+ + "of the |Categories'|categories. This |categories,|.categories |Categories(|Categories.|cat"
+ + "egories not | categories=\"|categorieser | CATEGORIES |categoriesal | CATEGORIES|categorie"
+ + "s='|CATEGORIES\"|Categories. | categories(|categoriesful | Categories. |categoriesive |cat"
+ + "egoriesless |CATEGORIES'|categoriesest | Categories.|CATEGORIES\">| categories='|Categorie"
+ + "s,|categoriesize |CATEGORIES.|\302\240categories| categories,|Categories=\"|CATEGORIES="
+ + "\"|categoriesous |CATEGORIES, |Categories='| Categories,| CATEGORIES=\"| CATEGORIES, |CATE"
+ + "GORIES,|CATEGORIES(|CATEGORIES. | CATEGORIES.|CATEGORIES='| CATEGORIES. | Categories=\"| C"
+ + "ATEGORIES='| Categories='"
+ );
+ }
+
+ @Test
+ public void testAllTransforms4() {
+ byte[] compressed = {
+ (byte) 0x1b, (byte) 0x40, (byte) 0x03, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x80,
+ (byte) 0xe3, (byte) 0xb4, (byte) 0x0d, (byte) 0x00, (byte) 0x00, (byte) 0x07, (byte) 0x5b,
+ (byte) 0x26, (byte) 0x31, (byte) 0x40, (byte) 0x02, (byte) 0x00, (byte) 0xe0, (byte) 0x4e,
+ (byte) 0x1b, (byte) 0x51, (byte) 0x3e, (byte) 0x42, (byte) 0x51, (byte) 0x3e, (byte) 0x81,
+ (byte) 0x02, (byte) 0x51, (byte) 0x3e, (byte) 0x11, (byte) 0x04, (byte) 0xa2, (byte) 0x7c,
+ (byte) 0xe2, (byte) 0x0b, (byte) 0x44, (byte) 0xf9, (byte) 0x24, (byte) 0x1b, (byte) 0x10,
+ (byte) 0xe5, (byte) 0x93, (byte) 0x84, (byte) 0x50, (byte) 0x94, (byte) 0x4f, (byte) 0xba,
+ (byte) 0x02, (byte) 0x51, (byte) 0x3e, (byte) 0x69, (byte) 0x0c, (byte) 0x45, (byte) 0xf9,
+ (byte) 0x64, (byte) 0x39, (byte) 0x20, (byte) 0xca, (byte) 0x27, (byte) 0x13, (byte) 0x22,
+ (byte) 0x51, (byte) 0x3e, (byte) 0xd9, (byte) 0x11, (byte) 0x8a, (byte) 0xf2, (byte) 0xc9,
+ (byte) 0xa2, (byte) 0x58, (byte) 0x94, (byte) 0x4f, (byte) 0x4e, (byte) 0x05, (byte) 0xa2,
+ (byte) 0x7c, (byte) 0x72, (byte) 0x2c, (byte) 0x12, (byte) 0xe5, (byte) 0x93, (byte) 0x83,
+ (byte) 0xa1, (byte) 0x28, (byte) 0x9f, (byte) 0xfc, (byte) 0x8c, (byte) 0x45, (byte) 0xf9,
+ (byte) 0x14, (byte) 0x6e, (byte) 0x40, (byte) 0x94, (byte) 0x4f, (byte) 0x71, (byte) 0x47,
+ (byte) 0x44, (byte) 0xf9, (byte) 0x14, (byte) 0x80, (byte) 0x48, (byte) 0x94, (byte) 0x4f,
+ (byte) 0x81, (byte) 0xc8, (byte) 0x44, (byte) 0xf9, (byte) 0x14, (byte) 0x8e, (byte) 0x50,
+ (byte) 0x94, (byte) 0x4f, (byte) 0x41, (byte) 0x49, (byte) 0x45, (byte) 0xf9, (byte) 0x14,
+ (byte) 0x9b, (byte) 0x58, (byte) 0x94, (byte) 0x4f, (byte) 0x11, (byte) 0xca, (byte) 0x45,
+ (byte) 0xf9, (byte) 0x94, (byte) 0xa3, (byte) 0x40, (byte) 0x94, (byte) 0x4f, (byte) 0x99,
+ (byte) 0x4a, (byte) 0x44, (byte) 0xf9, (byte) 0x94, (byte) 0xb3, (byte) 0x48, (byte) 0x94,
+ (byte) 0x4f, (byte) 0x59, (byte) 0xcb, (byte) 0x44, (byte) 0xf9, (byte) 0x94, (byte) 0xb8,
+ (byte) 0x50, (byte) 0x94, (byte) 0x4f, (byte) 0x09, (byte) 0x4c, (byte) 0x45, (byte) 0xf9,
+ (byte) 0x94, (byte) 0xcb, (byte) 0x58, (byte) 0x94, (byte) 0x4f, (byte) 0x19, (byte) 0xcd,
+ (byte) 0x45, (byte) 0xf9, (byte) 0x54, (byte) 0xd8, (byte) 0x80, (byte) 0x28, (byte) 0x9f,
+ (byte) 0xca, (byte) 0x9b, (byte) 0x10, (byte) 0xe5, (byte) 0x53, (byte) 0x99, (byte) 0x23,
+ (byte) 0xa2, (byte) 0x7c, (byte) 0xaa, (byte) 0x73, (byte) 0x46, (byte) 0x94, (byte) 0x4f,
+ (byte) 0x25, (byte) 0x0f, (byte) 0x89, (byte) 0xf2, (byte) 0xa9, (byte) 0xf0, (byte) 0x29,
+ (byte) 0x51, (byte) 0x3e, (byte) 0xd5, (byte) 0x40, (byte) 0x26, (byte) 0xca, (byte) 0xa7,
+ (byte) 0x62, (byte) 0xe8, (byte) 0x44, (byte) 0xf9, (byte) 0x54, (byte) 0x0d, (byte) 0xa1,
+ (byte) 0x28, (byte) 0x9f, (byte) 0xca, (byte) 0xa1, (byte) 0x14, (byte) 0xe5, (byte) 0x53,
+ (byte) 0x61, (byte) 0xa4, (byte) 0xa2, (byte) 0x7c, (byte) 0xaa, (byte) 0x8c, (byte) 0x56,
+ (byte) 0x94, (byte) 0x4f, (byte) 0x45, (byte) 0x12, (byte) 0x8b, (byte) 0xf2, (byte) 0xa9,
+ (byte) 0x52, (byte) 0x6a, (byte) 0x51, (byte) 0x3e, (byte) 0x95, (byte) 0x4c, (byte) 0x2e,
+ (byte) 0xca, (byte) 0xa7, (byte) 0xda, (byte) 0xe9, (byte) 0x45, (byte) 0xf9, (byte) 0xd4,
+ (byte) 0x44, (byte) 0x81, (byte) 0x28, (byte) 0x9f, (byte) 0xba, (byte) 0xa8, (byte) 0x10,
+ (byte) 0xe5, (byte) 0x53, (byte) 0x37, (byte) 0x25, (byte) 0xa2, (byte) 0x7c, (byte) 0x6a,
+ (byte) 0xaa, (byte) 0x46, (byte) 0x94, (byte) 0x4f, (byte) 0xad, (byte) 0x15, (byte) 0x89,
+ (byte) 0xf2, (byte) 0xa9, (byte) 0xc5, (byte) 0x2a, (byte) 0x51, (byte) 0x3e, (byte) 0xb5,
+ (byte) 0x5a, (byte) 0x26, (byte) 0xca, (byte) 0xa7, (byte) 0x5e, (byte) 0xeb, (byte) 0x44,
+ (byte) 0xf9, (byte) 0xd4, (byte) 0x6c, (byte) 0xa1, (byte) 0x28, (byte) 0x9f, (byte) 0xba,
+ (byte) 0xad, (byte) 0x14, (byte) 0xe5, (byte) 0x53, (byte) 0xcf, (byte) 0xa5, (byte) 0xa2,
+ (byte) 0x7c, (byte) 0x6a, (byte) 0xbd, (byte) 0x56, (byte) 0x94, (byte) 0x4f, (byte) 0xbd,
+ (byte) 0x17, (byte) 0x8b, (byte) 0xf2, (byte) 0xa9, (byte) 0x09, (byte) 0x6b, (byte) 0x51,
+ (byte) 0x3e, (byte) 0x35, (byte) 0x63, (byte) 0x2e, (byte) 0xca, (byte) 0xa7, (byte) 0xd6,
+ (byte) 0xec, (byte) 0x45, (byte) 0xf9, (byte) 0x34, (byte) 0x9b, (byte) 0x01, (byte) 0x51,
+ (byte) 0x3e, (byte) 0x0d, (byte) 0x67, (byte) 0x41, (byte) 0x94, (byte) 0x4f, (byte) 0x43,
+ (byte) 0x9a, (byte) 0x10, (byte) 0xe5, (byte) 0xd3, (byte) 0xa8, (byte) 0x36, (byte) 0x44,
+ (byte) 0xf9, (byte) 0x34, (byte) 0xb1, (byte) 0x11, (byte) 0x51, (byte) 0x3e, (byte) 0xcd,
+ (byte) 0x6d, (byte) 0x45, (byte) 0x94, (byte) 0x4f, (byte) 0xe3, (byte) 0x9b, (byte) 0x11,
+ (byte) 0xe5, (byte) 0xd3, (byte) 0x14, (byte) 0x77, (byte) 0x44, (byte) 0xf9, (byte) 0x34,
+ (byte) 0xcc, (byte) 0x21, (byte) 0x51, (byte) 0x3e, (byte) 0x8d, (byte) 0x75, (byte) 0x49,
+ (byte) 0x94, (byte) 0x4f, (byte) 0x83, (byte) 0x9e, (byte) 0x12, (byte) 0xe5, (byte) 0xd3,
+ (byte) 0xb8, (byte) 0xb7, (byte) 0x44, (byte) 0xf9, (byte) 0x34, (byte) 0xfa, (byte) 0x31,
+ (byte) 0x51, (byte) 0x3e, (byte) 0x0d, (byte) 0x80, (byte) 0x4d, (byte) 0x94, (byte) 0x4f,
+ (byte) 0x73, (byte) 0xa0, (byte) 0x13, (byte) 0xe5, (byte) 0xd3, (byte) 0x34, (byte) 0xf8,
+ (byte) 0x44, (byte) 0xf9, (byte) 0x34, (byte) 0x13, (byte) 0x42, (byte) 0x51, (byte) 0x3e,
+ (byte) 0x4d, (byte) 0x87, (byte) 0x51, (byte) 0x94, (byte) 0x4f, (byte) 0x53, (byte) 0xa2,
+ (byte) 0x14, (byte) 0xe5, (byte) 0xd3, (byte) 0xb4, (byte) 0x38, (byte) 0x45, (byte) 0xf9,
+ (byte) 0x34, (byte) 0x34, (byte) 0x52, (byte) 0x51, (byte) 0x3e, (byte) 0x0d, (byte) 0x8f,
+ (byte) 0x55, (byte) 0x94, (byte) 0x4f, (byte) 0x23, (byte) 0xa4, (byte) 0x15, (byte) 0xe5,
+ (byte) 0xd3, (byte) 0x24, (byte) 0x79, (byte) 0x45, (byte) 0xf9, (byte) 0x34, (byte) 0x4f,
+ (byte) 0x62, (byte) 0x51, (byte) 0x3e, (byte) 0x8d, (byte) 0x95, (byte) 0x59, (byte) 0x94,
+ (byte) 0x4f, (byte) 0xd3, (byte) 0xa5, (byte) 0x16, (byte) 0xe5, (byte) 0xd3, (byte) 0x98,
+ (byte) 0xb9, (byte) 0x45, (byte) 0xf9, (byte) 0x34, (byte) 0x6e, (byte) 0x72, (byte) 0x51,
+ (byte) 0x3e, (byte) 0xcd, (byte) 0x9d, (byte) 0x5d, (byte) 0x94, (byte) 0x4f, (byte) 0x13,
+ (byte) 0xa8, (byte) 0x17, (byte) 0xe5, (byte) 0xd3, (byte) 0x1c, (byte) 0xfa, (byte) 0x45,
+ (byte) 0xf9, (byte) 0xb4, (byte) 0x90, (byte) 0x02, (byte) 0x51, (byte) 0x3e, (byte) 0xed,
+ (byte) 0xa5, (byte) 0x41, (byte) 0x94, (byte) 0x4f, (byte) 0xeb, (byte) 0xa9, (byte) 0x10,
+ (byte) 0xe5, (byte) 0xd3, (byte) 0x9a, (byte) 0x3a, (byte) 0x44, (byte) 0xf9, (byte) 0xb4,
+ (byte) 0xac, (byte) 0x12, (byte) 0x51, (byte) 0x3e, (byte) 0x6d, (byte) 0xad, (byte) 0x45,
+ (byte) 0x94, (byte) 0x4f, (byte) 0xbb, (byte) 0xab, (byte) 0x11, (byte) 0xe5, (byte) 0xd3,
+ (byte) 0x0a, (byte) 0x7b, (byte) 0x44, (byte) 0xf9, (byte) 0xb4, (byte) 0xc9, (byte) 0x22,
+ (byte) 0x51, (byte) 0x3e, (byte) 0x2d, (byte) 0xb4, (byte) 0x49, (byte) 0x94, (byte) 0x4f,
+ (byte) 0x7b, (byte) 0xad, (byte) 0x12, (byte) 0xe5, (byte) 0xd3, (byte) 0x82, (byte) 0xbb,
+ (byte) 0x44, (byte) 0xf9, (byte) 0xb4, (byte) 0xe7, (byte) 0x32, (byte) 0x51, (byte) 0x3e,
+ (byte) 0xad, (byte) 0xbb, (byte) 0x4d, (byte) 0x94, (byte) 0x4f, (byte) 0x5b, (byte) 0xaf,
+ (byte) 0x13, (byte) 0xe5, (byte) 0xd3, (byte) 0xf6, (byte) 0xfb, (byte) 0x44, (byte) 0xf9,
+ (byte) 0xb4, (byte) 0x05, (byte) 0x43, (byte) 0x51, (byte) 0x3e, (byte) 0xed, (byte) 0xc2,
+ (byte) 0x51, (byte) 0x94, (byte) 0x4f, (byte) 0x1b, (byte) 0xb1, (byte) 0x14, (byte) 0xe5,
+ (byte) 0xd3, (byte) 0x62, (byte) 0x3c, (byte) 0x45, (byte) 0xf9, (byte) 0xb4, (byte) 0x1f,
+ (byte) 0x53, (byte) 0x51, (byte) 0x3e, (byte) 0xad, (byte) 0xc9, (byte) 0x55, (byte) 0x94,
+ (byte) 0x4f, (byte) 0xeb, (byte) 0xb2, (byte) 0x15, (byte) 0xe5, (byte) 0xd3, (byte) 0xda,
+ (byte) 0x7c, (byte) 0x45, (byte) 0xf9, (byte) 0xb4, (byte) 0x3e, (byte) 0x63
+ };
+ checkSynth(
+ /*
+ * // The stream consists of word "time" with all possible transforms.
+ * main_header
+ * metablock_header_easy: 833, 1
+ * command_easy: 4, "|", 2 // = 0 << 10 + 1 + 1
+ * command_easy: 4, "|", 1031 // = 1 << 10 + 1 + 6
+ * command_easy: 4, "|", 2061 // = 2 << 10 + 1 + 12
+ * command_easy: 4, "|", 3092 // = 3 << 10 + 1 + 19
+ * command_easy: 4, "|", 4120 // = 4 << 10 + 1 + 23
+ * command_easy: 4, "|", 5150 // = 5 << 10 + 1 + 29
+ * command_easy: 4, "|", 6184 // = 6 << 10 + 1 + 39
+ * command_easy: 4, "|", 7214 // = 7 << 10 + 1 + 45
+ * command_easy: 4, "|", 8246 // = 8 << 10 + 1 + 53
+ * command_easy: 4, "|", 9279 // = 9 << 10 + 1 + 62
+ * command_easy: 4, "|", 10308 // = 10 << 10 + 1 + 67
+ * command_easy: 4, "|", 11342 // = 11 << 10 + 1 + 77
+ * command_easy: 4, "|", 12369 // = 12 << 10 + 1 + 80
+ * command_easy: 4, "|", 13397 // = 13 << 10 + 1 + 84
+ * command_easy: 4, "|", 14429 // = 14 << 10 + 1 + 92
+ * command_easy: 4, "|", 15460 // = 15 << 10 + 1 + 99
+ * command_easy: 4, "|", 16491 // = 16 << 10 + 1 + 106
+ * command_easy: 4, "|", 17524 // = 17 << 10 + 1 + 115
+ * command_easy: 4, "|", 18557 // = 18 << 10 + 1 + 124
+ * command_easy: 4, "|", 19589 // = 19 << 10 + 1 + 132
+ * command_easy: 4, "|", 20619 // = 20 << 10 + 1 + 138
+ * command_easy: 4, "|", 21649 // = 21 << 10 + 1 + 144
+ * command_easy: 4, "|", 22680 // = 22 << 10 + 1 + 151
+ * command_easy: 4, "|", 23710 // = 23 << 10 + 1 + 157
+ * command_easy: 4, "|", 24736 // = 24 << 10 + 1 + 159
+ * command_easy: 4, "|", 25766 // = 25 << 10 + 1 + 165
+ * command_easy: 4, "|", 26800 // = 26 << 10 + 1 + 175
+ * command_easy: 4, "|", 27826 // = 27 << 10 + 1 + 177
+ * command_easy: 4, "|", 28853 // = 28 << 10 + 1 + 180
+ * command_easy: 4, "|", 29885 // = 29 << 10 + 1 + 188
+ * command_easy: 4, "|", 30920 // = 30 << 10 + 1 + 199
+ * command_easy: 4, "|", 31950 // = 31 << 10 + 1 + 205
+ * command_easy: 4, "|", 32981 // = 32 << 10 + 1 + 212
+ * command_easy: 4, "|", 34011 // = 33 << 10 + 1 + 218
+ * command_easy: 4, "|", 35043 // = 34 << 10 + 1 + 226
+ * command_easy: 4, "|", 36068 // = 35 << 10 + 1 + 227
+ * command_easy: 4, "|", 37103 // = 36 << 10 + 1 + 238
+ * command_easy: 4, "|", 38133 // = 37 << 10 + 1 + 244
+ * command_easy: 4, "|", 39168 // = 38 << 10 + 1 + 255
+ * command_easy: 4, "|", 40201 // = 39 << 10 + 1 + 264
+ * command_easy: 4, "|", 41226 // = 40 << 10 + 1 + 265
+ * command_easy: 4, "|", 42251 // = 41 << 10 + 1 + 266
+ * command_easy: 4, "|", 43285 // = 42 << 10 + 1 + 276
+ * command_easy: 4, "|", 44310 // = 43 << 10 + 1 + 277
+ * command_easy: 4, "|", 45345 // = 44 << 10 + 1 + 288
+ * command_easy: 4, "|", 46374 // = 45 << 10 + 1 + 293
+ * command_easy: 4, "|", 47407 // = 46 << 10 + 1 + 302
+ * command_easy: 4, "|", 48440 // = 47 << 10 + 1 + 311
+ * command_easy: 4, "|", 49473 // = 48 << 10 + 1 + 320
+ * command_easy: 4, "|", 50498 // = 49 << 10 + 1 + 321
+ * command_easy: 4, "|", 51530 // = 50 << 10 + 1 + 329
+ * command_easy: 4, "|", 52561 // = 51 << 10 + 1 + 336
+ * command_easy: 4, "|", 53591 // = 52 << 10 + 1 + 342
+ * command_easy: 4, "|", 54623 // = 53 << 10 + 1 + 350
+ * command_easy: 4, "|", 55655 // = 54 << 10 + 1 + 358
+ * command_easy: 4, "|", 56680 // = 55 << 10 + 1 + 359
+ * command_easy: 4, "|", 57705 // = 56 << 10 + 1 + 360
+ * command_easy: 4, "|", 58730 // = 57 << 10 + 1 + 361
+ * command_easy: 4, "|", 59760 // = 58 << 10 + 1 + 367
+ * command_easy: 4, "|", 60791 // = 59 << 10 + 1 + 374
+ * command_easy: 4, "|", 61816 // = 60 << 10 + 1 + 375
+ * command_easy: 4, "|", 62849 // = 61 << 10 + 1 + 384
+ * command_easy: 4, "|", 63881 // = 62 << 10 + 1 + 392
+ * command_easy: 4, "|", 64919 // = 63 << 10 + 1 + 406
+ * command_easy: 4, "|", 65944 // = 64 << 10 + 1 + 407
+ * command_easy: 4, "|", 66969 // = 65 << 10 + 1 + 408
+ * command_easy: 4, "|", 68001 // = 66 << 10 + 1 + 416
+ * command_easy: 4, "|", 69031 // = 67 << 10 + 1 + 422
+ * command_easy: 4, "|", 70062 // = 68 << 10 + 1 + 429
+ * command_easy: 4, "|", 71092 // = 69 << 10 + 1 + 435
+ * command_easy: 4, "|", 72123 // = 70 << 10 + 1 + 442
+ * command_easy: 4, "|", 73154 // = 71 << 10 + 1 + 449
+ * command_easy: 4, "|", 74185 // = 72 << 10 + 1 + 456
+ * command_easy: 4, "|", 75219 // = 73 << 10 + 1 + 466
+ * command_easy: 4, "|", 76261 // = 74 << 10 + 1 + 484
+ * command_easy: 4, "|", 77291 // = 75 << 10 + 1 + 490
+ * command_easy: 4, "|", 78327 // = 76 << 10 + 1 + 502
+ * command_easy: 4, "|", 79357 // = 77 << 10 + 1 + 508
+ * command_easy: 4, "|", 80388 // = 78 << 10 + 1 + 515
+ * command_easy: 4, "|", 81418 // = 79 << 10 + 1 + 521
+ * command_easy: 4, "|", 82448 // = 80 << 10 + 1 + 527
+ * command_easy: 4, "|", 83482 // = 81 << 10 + 1 + 537
+ * command_easy: 4, "|", 84514 // = 82 << 10 + 1 + 545
+ * command_easy: 4, "|", 85546 // = 83 << 10 + 1 + 553
+ * command_easy: 4, "|", 86577 // = 84 << 10 + 1 + 560
+ * command_easy: 4, "|", 87609 // = 85 << 10 + 1 + 568
+ * command_easy: 4, "|", 88639 // = 86 << 10 + 1 + 574
+ * command_easy: 4, "|", 89670 // = 87 << 10 + 1 + 581
+ * command_easy: 4, "|", 90700 // = 88 << 10 + 1 + 587
+ * command_easy: 4, "|", 91731 // = 89 << 10 + 1 + 594
+ * command_easy: 4, "|", 92762 // = 90 << 10 + 1 + 601
+ * command_easy: 4, "|", 93795 // = 91 << 10 + 1 + 610
+ * command_easy: 4, "|", 94827 // = 92 << 10 + 1 + 618
+ * command_easy: 4, "|", 95860 // = 93 << 10 + 1 + 627
+ * command_easy: 4, "|", 96894 // = 94 << 10 + 1 + 637
+ * command_easy: 4, "|", 97924 // = 95 << 10 + 1 + 643
+ * command_easy: 4, "|", 98957 // = 96 << 10 + 1 + 652
+ * command_easy: 4, "|", 99988 // = 97 << 10 + 1 + 659
+ * command_easy: 4, "|", 101019 // = 98 << 10 + 1 + 666
+ * command_easy: 4, "|", 102051 // = 99 << 10 + 1 + 674
+ * command_easy: 4, "|", 103081 // = 100 << 10 + 1 + 680
+ * command_easy: 4, "|", 104114 // = 101 << 10 + 1 + 689
+ * command_easy: 4, "|", 105144 // = 102 << 10 + 1 + 695
+ * command_easy: 4, "|", 106175 // = 103 << 10 + 1 + 702
+ * command_easy: 4, "|", 107206 // = 104 << 10 + 1 + 709
+ * command_easy: 4, "|", 108237 // = 105 << 10 + 1 + 716
+ * command_easy: 4, "|", 109268 // = 106 << 10 + 1 + 723
+ * command_easy: 4, "|", 110301 // = 107 << 10 + 1 + 732
+ * command_easy: 4, "|", 111332 // = 108 << 10 + 1 + 739
+ * command_easy: 4, "|", 112363 // = 109 << 10 + 1 + 746
+ * command_easy: 4, "|", 113394 // = 110 << 10 + 1 + 753
+ * command_easy: 4, "|", 114426 // = 111 << 10 + 1 + 761
+ * command_easy: 4, "|", 115458 // = 112 << 10 + 1 + 769
+ * command_easy: 4, "|", 116488 // = 113 << 10 + 1 + 775
+ * command_easy: 4, "|", 117518 // = 114 << 10 + 1 + 781
+ * command_easy: 4, "|", 118549 // = 115 << 10 + 1 + 788
+ * command_easy: 4, "|", 119580 // = 116 << 10 + 1 + 795
+ * command_easy: 4, "|", 120611 // = 117 << 10 + 1 + 802
+ * command_easy: 4, "|", 121643 // = 118 << 10 + 1 + 810
+ * command_easy: 4, "|", 122675 // = 119 << 10 + 1 + 818
+ * command_easy: 4, "|", 123707 // = 120 << 10 + 1 + 826
+ */
+ compressed,
+ true,
+ "|time|time | time |ime|Time |time the | time|s time |time of |Time|time and |me|tim|, time |"
+ + "time, | Time |time in |time to |e time |time\"|time.|time\">|time\n|t|time]|time for |e|ti"
+ + "|time a |time that | Time|time. |.time| time, ||time with |time'|time from |time by ||| th"
+ + "e time||time. The |TIME|time on |time as |time is ||timing |time\n\t|time:| time. |timeed "
+ + "||||time(|Time, ||time at |timely | the time of ||| Time, |Time\"|.time(|TIME |Time\">|tim"
+ + "e=\"| time.|.com/time| the time of the |Time'|time. This |time,|.time |Time(|Time.|time no"
+ + "t | time=\"|timeer | TIME |timeal | TIME|time='|TIME\"|Time. | time(|timeful | Time. |time"
+ + "ive |timeless |TIME'|timeest | Time.|TIME\">| time='|Time,|timeize |TIME.|\302\240time| ti"
+ + "me,|Time=\"|TIME=\"|timeous |TIME, |Time='| Time,| TIME=\"| TIME, |TIME,|TIME(|TIME. | TIM"
+ + "E.|TIME='| TIME. | Time=\"| TIME='| Time='"
+ );
+ }
+
+ @Test
public void testBaseDictWord() {
byte[] compressed = {
(byte) 0x1b, (byte) 0x03, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x80,
@@ -156,7 +625,7 @@ public class SynthTest {
* // one ins/copy and dist block type
* vlq_blocktypes: 1
* vlq_blocktypes: 1
- * ndirect: 0 0
+ * ndirect: 0, 0
* // two MSB6 literal context modes
* bits: "00", "00"
* // two literal prefix codes
@@ -212,7 +681,7 @@ public class SynthTest {
* // one ins/copy and dist block type
* vlq_blocktypes: 1
* vlq_blocktypes: 1
- * ndirect: 0 0
+ * ndirect: 0, 0
* // two MSB6 literal context modes
* bits: "00", "00"
* // two literal prefix codes
@@ -447,6 +916,28 @@ public class SynthTest {
}
@Test
+ public void testCopyTooLong() {
+ byte[] compressed = {
+ (byte) 0xa1, (byte) 0x08, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x00,
+ (byte) 0x1c, (byte) 0xa7, (byte) 0x6d, (byte) 0x00, (byte) 0x00, (byte) 0x38, (byte) 0xd8,
+ (byte) 0x32, (byte) 0x89, (byte) 0x01, (byte) 0x12, (byte) 0x00, (byte) 0x00, (byte) 0x77,
+ (byte) 0xda, (byte) 0x34, (byte) 0xab, (byte) 0xdb, (byte) 0x50, (byte) 0x00
+ };
+ checkSynth(
+ /*
+ * // Has a copy length that goes over the end of the meta-block,
+ * // with a ringbuffer wrap.
+ * main_header: 10
+ * metablock_header_easy: 2, 1
+ * command_easy: 1024, "a", 1
+ */
+ compressed,
+ false,
+ ""
+ );
+ }
+
+ @Test
public void testCustomHuffmanCode() {
byte[] compressed = {
(byte) 0x1b, (byte) 0x03, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x01, (byte) 0x80,
@@ -494,6 +985,46 @@ public class SynthTest {
}
@Test
+ public void testDistanceLut() {
+ byte[] compressed = {
+ (byte) 0x8b, (byte) 0x02, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x00, (byte) 0x80,
+ (byte) 0xe3, (byte) 0xb4, (byte) 0x0d, (byte) 0x00, (byte) 0x00, (byte) 0x07, (byte) 0x5b,
+ (byte) 0x26, (byte) 0x31, (byte) 0x40, (byte) 0x02, (byte) 0x00, (byte) 0xe0, (byte) 0x4e,
+ (byte) 0x1b, (byte) 0x99, (byte) 0x86, (byte) 0x46, (byte) 0xc6, (byte) 0x22, (byte) 0x14,
+ (byte) 0x00, (byte) 0x00, (byte) 0x03, (byte) 0x00, (byte) 0x00, (byte) 0x1c, (byte) 0xa7,
+ (byte) 0x6d, (byte) 0x00, (byte) 0x00, (byte) 0x38, (byte) 0xd8, (byte) 0x32, (byte) 0x89,
+ (byte) 0x01, (byte) 0x12, (byte) 0x21, (byte) 0x91, (byte) 0x69, (byte) 0x62, (byte) 0x6a,
+ (byte) 0x36
+ };
+ checkSynth(
+ /*
+ * main_header
+ * metablock_header_easy: 6, 0 // implicit ndirect: 0, 0
+ * command_easy: 3, "abc", 3 // Insert "abc", copy "abc"
+ * metablock_header_begin: 0, 0, 6, 0
+ * vlq_blocktypes: 1 // num litetal block types
+ * vlq_blocktypes: 1 // num command block types
+ * vlq_blocktypes: 1 // num distance block types
+ * ndirect: 3, 0
+ * bits: "00" // literal context modes
+ * vlq_blocktypes: 1 // num literal Huffman trees
+ * // command has no context -> num trees == num block types
+ * vlq_blocktypes: 1 // num distance Huffman trees
+ * huffman_fixed: 256
+ * huffman_fixed: 704
+ * huffman_simple: 0,1,67, 18
+ * command_inscopy_easy: 3, 3 // Insert 3, copy 3
+ * command_literals_easy: "def"
+ * // 0-bit Huffman code : dcode = 18 -> third direct distance
+ * metablock_lastempty // make sure that no extra distance bits are read
+ */
+ compressed,
+ true,
+ "abcabcdefdef"
+ );
+ }
+
+ @Test
public void testEmpty() {
byte[] compressed = {
(byte) 0x3b
@@ -774,7 +1305,7 @@ public class SynthTest {
* // one ins/copy and dist block type
* vlq_blocktypes: 1
* vlq_blocktypes: 1
- * ndirect: 0 0
+ * ndirect: 0, 0
* // two MSB6 literal context modes
* bits: "00", "00"
* // two literal prefix codes
@@ -2199,6 +2730,104 @@ public class SynthTest {
);
}
+/* DISABLED: Java decoder does not tolerate extra input after the brotli stream.
+ @Test
+ public void testSimplePrefixPlusExtraData() {
+ byte[] compressed = {
+ (byte) 0x1b, (byte) 0x03, (byte) 0x00, (byte) 0x00, (byte) 0xa0, (byte) 0xc3, (byte) 0xc4,
+ (byte) 0xc6, (byte) 0xc8, (byte) 0x02, (byte) 0x00, (byte) 0x70, (byte) 0xb0, (byte) 0x65,
+ (byte) 0x12, (byte) 0x03, (byte) 0x24, (byte) 0x00, (byte) 0x00, (byte) 0xee, (byte) 0xb4,
+ (byte) 0x51, (byte) 0xa0, (byte) 0x1d, (byte) 0x55, (byte) 0xaa
+ };
+ checkSynth(
+ compressed,
+ true,
+ "abcd"
+ );
+ }
+*/
+
+ @Test
+ public void testStressReadDistanceExtraBits() {
+ byte[] compressed = {
+ (byte) 0x4f, (byte) 0xfe, (byte) 0xff, (byte) 0x3f, (byte) 0x00, (byte) 0x00, (byte) 0x00,
+ (byte) 0x80, (byte) 0xe3, (byte) 0xb4, (byte) 0x0d, (byte) 0x00, (byte) 0x00, (byte) 0x07,
+ (byte) 0x5b, (byte) 0x26, (byte) 0x31, (byte) 0x40, (byte) 0x02, (byte) 0x00, (byte) 0xe0,
+ (byte) 0x4e, (byte) 0x9b, (byte) 0xf6, (byte) 0x69, (byte) 0xef, (byte) 0xff, (byte) 0x0c,
+ (byte) 0x8d, (byte) 0x8c, (byte) 0x05, (byte) 0x10, (byte) 0x00, (byte) 0x00, (byte) 0x00,
+ (byte) 0x00, (byte) 0x00, (byte) 0x38, (byte) 0x4e, (byte) 0xdb, (byte) 0x00, (byte) 0x00,
+ (byte) 0x70, (byte) 0xb0, (byte) 0x65, (byte) 0x12, (byte) 0x03, (byte) 0x24, (byte) 0xa8,
+ (byte) 0xaa, (byte) 0xef, (byte) 0xab, (byte) 0xaa, (byte) 0x7f, (byte) 0x24, (byte) 0x16,
+ (byte) 0x35, (byte) 0x8f, (byte) 0xac, (byte) 0x9e, (byte) 0x3d, (byte) 0xf7, (byte) 0xf3,
+ (byte) 0xe3, (byte) 0x0a, (byte) 0xfc, (byte) 0xff, (byte) 0x03, (byte) 0x00, (byte) 0x00,
+ (byte) 0x78, (byte) 0x01, (byte) 0x08, (byte) 0x30, (byte) 0x31, (byte) 0x32, (byte) 0x33,
+ (byte) 0x34, (byte) 0x35, (byte) 0x36, (byte) 0x37, (byte) 0x38, (byte) 0x39, (byte) 0x41,
+ (byte) 0x42, (byte) 0x43, (byte) 0x44, (byte) 0x45, (byte) 0x46, (byte) 0x30, (byte) 0x31,
+ (byte) 0x32, (byte) 0x33, (byte) 0x34, (byte) 0x35, (byte) 0x36, (byte) 0x37, (byte) 0x38,
+ (byte) 0x39, (byte) 0x41, (byte) 0x42, (byte) 0x43, (byte) 0x44, (byte) 0x45, (byte) 0x46,
+ (byte) 0x30, (byte) 0x31, (byte) 0x32, (byte) 0x33, (byte) 0x34, (byte) 0x35, (byte) 0x36,
+ (byte) 0x37, (byte) 0x38, (byte) 0x39, (byte) 0x41, (byte) 0x42, (byte) 0x43, (byte) 0x44,
+ (byte) 0x45, (byte) 0x46, (byte) 0x03
+ };
+ /* This line is added manually. */
+ char[] stub = new char[8388602]; Arrays.fill(stub, 'c'); String hex = "0123456789ABCDEF";
+ checkSynth(
+ /*
+ * main_header: 24
+ * metablock_header_easy: 8388605, 0 // 2^23 - 3 = shortest 22-bit distance
+ * command_easy: 8388602, "abc", 1
+ * metablock_header_begin: 0, 0, 3, 0
+ * vlq_blocktypes: 1 // num litetal block types
+ * vlq_blocktypes: 1 // num command block types
+ * vlq_blocktypes: 1 // num distance block types
+ * ndirect: 0, 0
+ * bits: "00" // literal context modes
+ * vlq_blocktypes: 1 // num literal Huffman trees
+ * // command has no context -> num trees == num block types
+ * vlq_blocktypes: 1 // num distance Huffman trees
+ * huffman_fixed: 256
+ * huffman_fixed: 704
+ * // Begin of distance Huffman tree. First 15 codes have lengths 1 to 15.
+ * // Symbol that corresponds to first half of 22-bit distance range is also
+ * // 15. All other symbols are 0.
+ * hskip: 0
+ * clcl_ordered: 4,4,4,4, 4,4,4,4, 4,4,4,4, 4,4, 5,5,5,5
+ * set_prefix_cl_rle: "0000", "0001", "0010", "0011", \
+ * "0100", "0101", "0110", "0111", \
+ * "1000", "1001", "1010", "1011", \
+ * "1100", "1101", \
+ * "11100", "11101", "11110", "11111"
+ * cl_rle: 1
+ * cl_rle: 2
+ * cl_rle: 3
+ * cl_rle: 4
+ * cl_rle: 5
+ * cl_rle: 6
+ * cl_rle: 7
+ * cl_rle: 8
+ * cl_rle: 9
+ * cl_rle: 10
+ * cl_rle: 11
+ * cl_rle: 12
+ * cl_rle: 13
+ * cl_rle: 14
+ * cl_rle: 15
+ * cl_rle_rep_0: 43
+ * cl_rle: 15 // literal number 97, that is, the letter 'a'
+ * // end of literal Huffman tree
+ * command_inscopy_easy: 0, 3 // Insert 0, copy 3
+ * // 15 bits of distance code plus 22 extra bits
+ * command_dist_bits: "111111111111111", "0000000000000000000000"
+ * metablock_uncompressed: "0123456789ABCDEF0123456789ABCDEF0123456789ABCDEF"
+ * metablock_lastempty
+ */
+ compressed,
+ true,
+ /* This line is modified manually. */
+ "abc" + new String(stub) + "abc" + hex + hex + hex
+ );
+ }
+
@Test
public void testTooManySymbolsRepeated() {
byte[] compressed = {
@@ -2246,7 +2875,7 @@ public class SynthTest {
* main_header
* metablock_header_easy: 9, 1
* command_inscopy_easy: 0, 4
- * command_dist_easy: 5121
+ * command_dist_easy: 5121 // 5 << 10 + 1
*/
compressed,
true,
@@ -2270,7 +2899,7 @@ public class SynthTest {
* main_header
* metablock_header_easy: 4, 1
* command_inscopy_easy: 0, 4
- * command_dist_easy: 5121
+ * command_dist_easy: 5121 // 5 << 10 + 1
*/
compressed,
false,
@@ -2278,6 +2907,34 @@ public class SynthTest {
);
}
+ @Test
+ public void testZeroCostLiterals() {
+ byte[] compressed = {
+ (byte) 0x9b, (byte) 0xff, (byte) 0xff, (byte) 0xff, (byte) 0x00, (byte) 0x20, (byte) 0x54,
+ (byte) 0x00, (byte) 0x00, (byte) 0x38, (byte) 0xd8, (byte) 0x32, (byte) 0x89, (byte) 0x01,
+ (byte) 0x12, (byte) 0x00, (byte) 0x00, (byte) 0x77, (byte) 0xda, (byte) 0xcc, (byte) 0xe1,
+ (byte) 0x7b, (byte) 0xfa, (byte) 0x0f
+ };
+ /* This lines is added manually. */
+ char[] expected = new char[16777216]; Arrays.fill(expected, '*');
+ checkSynth(
+ /*
+ * main_header
+ * metablock_header_begin: 1, 0, 16777216, 0
+ * metablock_header_trivial_context
+ * huffman_simple: 0,1,256, 42 // Single symbol alphabet
+ * huffman_fixed: 704
+ * huffman_fixed: 64
+ * command_inscopy_easy: 16777216, 0
+ * // 16777216 times 0 bits
+ */
+ compressed,
+ true,
+ /* This line is modified manually. */
+ new String(expected)
+ );
+ }
+
/* GENERATED CODE END */
-} \ No newline at end of file
+}
diff --git a/java/org/brotli/dec/Transform.java b/java/org/brotli/dec/Transform.java
index b90f2e9..3279ee7 100644
--- a/java/org/brotli/dec/Transform.java
+++ b/java/org/brotli/dec/Transform.java
@@ -10,13 +10,58 @@ import java.nio.ByteBuffer;
/**
* Transformations on dictionary words.
+ *
+ * Transform descriptor is a triplet: {prefix, operator, suffix}.
+ * "prefix" and "suffix" are short strings inserted before and after transformed dictionary word.
+ * "operator" is applied to dictionary word itself.
+ *
+ * Some operators has "built-in" parameters, i.e. parameter is defined by operator ordinal. Other
+ * operators have "external" parameters, supplied via additional table encoded in shared dictionary.
+ *
+ * Operators:
+ * - IDENTITY (0): dictionary word is inserted "as is"
+ * - OMIT_LAST_N (1 - 9): last N octets of dictionary word are not inserted; N == ordinal
+ * - OMIT_FIRST_M (12-20): first M octets of dictionary word are not inserted; M == ordinal - 11
+ * - UPPERCASE_FIRST (10): first "scalar" is XOR'ed with number 32
+ * - UPPERCASE_ALL (11): all "scalars" are XOR'ed with number 32
+ * - SHIFT_FIRST (21): first "scalar" is shifted by number form parameter table
+ * - SHIFT_ALL (22): all "scalar" is shifted by number form parameter table
+ *
+ * Here "scalar" is a variable length character coding similar to UTF-8 encoding.
+ * UPPERCASE_XXX / SHIFT_XXX operators were designed to change the case of UTF-8 encoded characters.
+ * While UPPERCASE_XXX works well only on ASCII charset, SHIFT is much more generic and could be
+ * used for most (all?) alphabets.
*/
final class Transform {
- static final int NUM_TRANSFORMS = 121;
- private static final int[] TRANSFORMS = new int[NUM_TRANSFORMS * 3];
- private static final byte[] PREFIX_SUFFIX = new byte[217];
- private static final int[] PREFIX_SUFFIX_HEADS = new int[51];
+ static final class Transforms {
+ final int numTransforms;
+ final int[] triplets;
+ final byte[] prefixSuffixStorage;
+ final int[] prefixSuffixHeads;
+ final short[] params;
+
+ Transforms(int numTransforms, int prefixSuffixLen, int prefixSuffixCount) {
+ this.numTransforms = numTransforms;
+ this.triplets = new int[numTransforms * 3];
+ this.params = new short[numTransforms];
+ this.prefixSuffixStorage = new byte[prefixSuffixLen];
+ this.prefixSuffixHeads = new int[prefixSuffixCount + 1];
+ }
+ }
+
+ static final int NUM_RFC_TRANSFORMS = 121;
+ static final Transforms RFC_TRANSFORMS = new Transforms(NUM_RFC_TRANSFORMS, 167, 50);
+
+ private static final int OMIT_FIRST_LAST_LIMIT = 9;
+
+ private static final int IDENTITY = 0;
+ private static final int OMIT_LAST_BASE = IDENTITY + 1 - 1; // there is no OMIT_LAST_0.
+ private static final int UPPERCASE_FIRST = OMIT_LAST_BASE + OMIT_FIRST_LAST_LIMIT + 1;
+ private static final int UPPERCASE_ALL = UPPERCASE_FIRST + 1;
+ private static final int OMIT_FIRST_BASE = UPPERCASE_ALL + 1 - 1; // there is no OMIT_FIRST_0.
+ private static final int SHIFT_FIRST = OMIT_FIRST_BASE + OMIT_FIRST_LAST_LIMIT + 1;
+ private static final int SHIFT_ALL = SHIFT_FIRST + 1;
// Bundle of 0-terminated strings.
private static final String PREFIX_SUFFIX_SRC = "# #s #, #e #.# the #.com/#\u00C2\u00A0# of # and"
@@ -29,71 +74,87 @@ final class Transform {
+ " G% ! *A *% H! D I!+! J!+ K +- *4! A L!*4 M N +6 O!*% +.! K *G P +%( ! G *D +D "
+ " Q +# *K!*G!+D!+# +G +A +4!+% +K!+4!*D!+K!*K";
- private static void unpackTransforms(byte[] prefixSuffix, int[] prefixSuffixHeads,
- int[] transforms, String prefixSuffixSrc, String transformsSrc) {
+ private static void unpackTransforms(byte[] prefixSuffix,
+ int[] prefixSuffixHeads, int[] transforms, String prefixSuffixSrc, String transformsSrc) {
int n = prefixSuffixSrc.length();
int index = 1;
+ int j = 0;
for (int i = 0; i < n; ++i) {
char c = prefixSuffixSrc.charAt(i);
- prefixSuffix[i] = (byte) c;
if (c == 35) { // == #
- prefixSuffixHeads[index++] = i + 1;
- prefixSuffix[i] = 0;
+ prefixSuffixHeads[index++] = j;
+ } else {
+ prefixSuffix[j++] = (byte) c;
}
}
- for (int i = 0; i < NUM_TRANSFORMS * 3; ++i) {
+ for (int i = 0; i < NUM_RFC_TRANSFORMS * 3; ++i) {
transforms[i] = transformsSrc.charAt(i) - 32;
}
}
static {
- unpackTransforms(PREFIX_SUFFIX, PREFIX_SUFFIX_HEADS, TRANSFORMS, PREFIX_SUFFIX_SRC,
- TRANSFORMS_SRC);
+ unpackTransforms(RFC_TRANSFORMS.prefixSuffixStorage, RFC_TRANSFORMS.prefixSuffixHeads,
+ RFC_TRANSFORMS.triplets, PREFIX_SUFFIX_SRC, TRANSFORMS_SRC);
}
- static int transformDictionaryWord(byte[] dst, int dstOffset, ByteBuffer data, int wordOffset,
- int len, int transformIndex) {
+ static int transformDictionaryWord(byte[] dst, int dstOffset, ByteBuffer src, int srcOffset,
+ int len, Transforms transforms, int transformIndex) {
int offset = dstOffset;
+ int[] triplets = transforms.triplets;
+ byte[] prefixSuffixStorage = transforms.prefixSuffixStorage;
+ int[] prefixSuffixHeads = transforms.prefixSuffixHeads;
int transformOffset = 3 * transformIndex;
- int transformPrefix = PREFIX_SUFFIX_HEADS[TRANSFORMS[transformOffset]];
- int transformType = TRANSFORMS[transformOffset + 1];
- int transformSuffix = PREFIX_SUFFIX_HEADS[TRANSFORMS[transformOffset + 2]];
+ int prefixIdx = triplets[transformOffset];
+ int transformType = triplets[transformOffset + 1];
+ int suffixIdx = triplets[transformOffset + 2];
+ int prefix = prefixSuffixHeads[prefixIdx];
+ int prefixEnd = prefixSuffixHeads[prefixIdx + 1];
+ int suffix = prefixSuffixHeads[suffixIdx];
+ int suffixEnd = prefixSuffixHeads[suffixIdx + 1];
+
+ int omitFirst = transformType - OMIT_FIRST_BASE;
+ int omitLast = transformType - OMIT_LAST_BASE;
+ if (omitFirst < 1 || omitFirst > OMIT_FIRST_LAST_LIMIT) {
+ omitFirst = 0;
+ }
+ if (omitLast < 1 || omitLast > OMIT_FIRST_LAST_LIMIT) {
+ omitLast = 0;
+ }
// Copy prefix.
- while (PREFIX_SUFFIX[transformPrefix] != 0) {
- dst[offset++] = PREFIX_SUFFIX[transformPrefix++];
+ while (prefix != prefixEnd) {
+ dst[offset++] = prefixSuffixStorage[prefix++];
}
// Copy trimmed word.
- int omitFirst = transformType >= 12 ? (transformType - 11) : 0;
if (omitFirst > len) {
omitFirst = len;
}
- wordOffset += omitFirst;
+ srcOffset += omitFirst;
len -= omitFirst;
- len -= transformType <= 9 ? transformType : 0; // Omit last.
+ len -= omitLast;
int i = len;
while (i > 0) {
- dst[offset++] = data.get(wordOffset++);
+ dst[offset++] = src.get(srcOffset++);
i--;
}
// Ferment.
- if (transformType == 11 || transformType == 10) {
+ if (transformType == UPPERCASE_FIRST || transformType == UPPERCASE_ALL) {
int uppercaseOffset = offset - len;
- if (transformType == 10) {
+ if (transformType == UPPERCASE_FIRST) {
len = 1;
}
while (len > 0) {
- int tmp = dst[uppercaseOffset] & 0xFF;
- if (tmp < 0xc0) {
- if (tmp >= 97 && tmp <= 122) { // in [a..z] range
+ int c0 = dst[uppercaseOffset] & 0xFF;
+ if (c0 < 0xC0) {
+ if (c0 >= 97 && c0 <= 122) { // in [a..z] range
dst[uppercaseOffset] ^= (byte) 32;
}
uppercaseOffset += 1;
len -= 1;
- } else if (tmp < 0xe0) {
+ } else if (c0 < 0xE0) {
dst[uppercaseOffset + 1] ^= (byte) 32;
uppercaseOffset += 2;
len -= 2;
@@ -103,11 +164,71 @@ final class Transform {
len -= 3;
}
}
+ } else if (transformType == SHIFT_FIRST || transformType == SHIFT_ALL) {
+ int shiftOffset = offset - len;
+ short param = transforms.params[transformIndex];
+ /* Limited sign extension: scalar < (1 << 24). */
+ int scalar = (param & 0x7FFF) + (0x1000000 - (param & 0x8000));
+ while (len > 0) {
+ int step = 1;
+ int c0 = dst[shiftOffset] & 0xFF;
+ if (c0 < 0x80) {
+ /* 1-byte rune / 0sssssss / 7 bit scalar (ASCII). */
+ scalar += c0;
+ dst[shiftOffset] = (byte) (scalar & 0x7F);
+ } else if (c0 < 0xC0) {
+ /* Continuation / 10AAAAAA. */
+ } else if (c0 < 0xE0) {
+ /* 2-byte rune / 110sssss AAssssss / 11 bit scalar. */
+ if (len >= 2) {
+ byte c1 = dst[shiftOffset + 1];
+ scalar += (c1 & 0x3F) | ((c0 & 0x1F) << 6);
+ dst[shiftOffset] = (byte) (0xC0 | ((scalar >> 6) & 0x1F));
+ dst[shiftOffset + 1] = (byte) ((c1 & 0xC0) | (scalar & 0x3F));
+ step = 2;
+ } else {
+ step = len;
+ }
+ } else if (c0 < 0xF0) {
+ /* 3-byte rune / 1110ssss AAssssss BBssssss / 16 bit scalar. */
+ if (len >= 3) {
+ byte c1 = dst[shiftOffset + 1];
+ byte c2 = dst[shiftOffset + 2];
+ scalar += (c2 & 0x3F) | ((c1 & 0x3F) << 6) | ((c0 & 0x0F) << 12);
+ dst[shiftOffset] = (byte) (0xE0 | ((scalar >> 12) & 0x0F));
+ dst[shiftOffset + 1] = (byte) ((c1 & 0xC0) | ((scalar >> 6) & 0x3F));
+ dst[shiftOffset + 2] = (byte) ((c2 & 0xC0) | (scalar & 0x3F));
+ step = 3;
+ } else {
+ step = len;
+ }
+ } else if (c0 < 0xF8) {
+ /* 4-byte rune / 11110sss AAssssss BBssssss CCssssss / 21 bit scalar. */
+ if (len >= 4) {
+ byte c1 = dst[shiftOffset + 1];
+ byte c2 = dst[shiftOffset + 2];
+ byte c3 = dst[shiftOffset + 3];
+ scalar += (c3 & 0x3F) | ((c2 & 0x3F) << 6) | ((c1 & 0x3F) << 12) | ((c0 & 0x07) << 18);
+ dst[shiftOffset] = (byte) (0xF0 | ((scalar >> 18) & 0x07));
+ dst[shiftOffset + 1] = (byte) ((c1 & 0xC0) | ((scalar >> 12) & 0x3F));
+ dst[shiftOffset + 2] = (byte) ((c2 & 0xC0) | ((scalar >> 6) & 0x3F));
+ dst[shiftOffset + 3] = (byte) ((c3 & 0xC0) | (scalar & 0x3F));
+ step = 4;
+ } else {
+ step = len;
+ }
+ }
+ shiftOffset += step;
+ len -= step;
+ if (transformType == SHIFT_FIRST) {
+ len = 0;
+ }
+ }
}
// Copy suffix.
- while (PREFIX_SUFFIX[transformSuffix] != 0) {
- dst[offset++] = PREFIX_SUFFIX[transformSuffix++];
+ while (suffix != suffixEnd) {
+ dst[offset++] = prefixSuffixStorage[suffix++];
}
return offset - dstOffset;
diff --git a/java/org/brotli/dec/TransformTest.java b/java/org/brotli/dec/TransformTest.java
index 616ba35..6e04f0d 100644
--- a/java/org/brotli/dec/TransformTest.java
+++ b/java/org/brotli/dec/TransformTest.java
@@ -36,8 +36,8 @@ public class TransformTest {
public void testTrimAll() {
byte[] output = new byte[0];
byte[] input = {119, 111, 114, 100}; // "word"
- Transform.transformDictionaryWord(
- output, 0, ByteBuffer.wrap(input), 0, input.length, 39);
+ Transform.transformDictionaryWord(output, 0,
+ ByteBuffer.wrap(input), 0, input.length, Transform.RFC_TRANSFORMS, 39);
byte[] expectedOutput = new byte[0];
assertArrayEquals(expectedOutput, output);
}
@@ -46,8 +46,8 @@ public class TransformTest {
public void testCapitalize() {
byte[] output = new byte[6];
byte[] input = {113, -61, -90, -32, -92, -86}; // "qæप"
- Transform.transformDictionaryWord(
- output, 0, ByteBuffer.wrap(input), 0, input.length, 44);
+ Transform.transformDictionaryWord(output, 0,
+ ByteBuffer.wrap(input), 0, input.length, Transform.RFC_TRANSFORMS, 44);
byte[] expectedOutput = {81, -61, -122, -32, -92, -81}; // "QÆय"
assertArrayEquals(expectedOutput, output);
}
@@ -60,9 +60,9 @@ public class TransformTest {
byte[] testWord = {111, 49, 50, 51, 52, 53, 54, 55, 56, 57, 97, 98, 99, 100, 101, 102};
byte[] output = new byte[2259];
int offset = 0;
- for (int i = 0; i < Transform.NUM_TRANSFORMS; ++i) {
- offset += Transform.transformDictionaryWord(
- output, offset, ByteBuffer.wrap(testWord), 0, testWord.length, i);
+ for (int i = 0; i < Transform.NUM_RFC_TRANSFORMS; ++i) {
+ offset += Transform.transformDictionaryWord(output, offset,
+ ByteBuffer.wrap(testWord), 0, testWord.length, Transform.RFC_TRANSFORMS, i);
output[offset++] = -1;
}
assertEquals(output.length, offset);
diff --git a/java/org/brotli/dec/Utils.java b/java/org/brotli/dec/Utils.java
index 1583c75..3fb2bfa 100644
--- a/java/org/brotli/dec/Utils.java
+++ b/java/org/brotli/dec/Utils.java
@@ -58,6 +58,10 @@ final class Utils {
}
}
+ static void copyBytes(byte[] dst, int target, byte[] src, int start, int end) {
+ System.arraycopy(src, start, dst, target, end - start);
+ }
+
static void copyBytesWithin(byte[] bytes, int target, int start, int end) {
System.arraycopy(bytes, start, bytes, target, end - start);
}
@@ -88,4 +92,15 @@ final class Utils {
static void flipBuffer(Buffer buffer) {
buffer.flip();
}
+
+ static int isDebugMode() {
+ boolean assertsEnabled = Boolean.parseBoolean(System.getProperty("BROTLI_ENABLE_ASSERTS"));
+ return assertsEnabled ? 1 : 0;
+ }
+
+ // See BitReader.LOG_BITNESS
+ static int getLogBintness() {
+ boolean isLongExpensive = Boolean.parseBoolean(System.getProperty("BROTLI_32_BIT_CPU"));
+ return isLongExpensive ? 5 : 6;
+ }
}
diff --git a/java/org/brotli/dec/build_defs.bzl b/java/org/brotli/dec/build_defs.bzl
new file mode 100644
index 0000000..d0a015c
--- /dev/null
+++ b/java/org/brotli/dec/build_defs.bzl
@@ -0,0 +1,34 @@
+"""Utilities for Java brotli tests."""
+
+_TEST_JVM_FLAGS = [
+ "-DBROTLI_ENABLE_ASSERTS=true",
+]
+
+def brotli_java_test(name, main_class = None, jvm_flags = None, **kwargs):
+ """test duplication rule that creates 32/64-bit test pair."""
+
+ if jvm_flags == None:
+ jvm_flags = []
+ jvm_flags = jvm_flags + _TEST_JVM_FLAGS
+
+ test_package = native.package_name().replace("/", ".")
+ if main_class == None:
+ test_class = test_package + "." + name
+ else:
+ test_class = None
+
+ native.java_test(
+ name = name + "_32",
+ main_class = main_class,
+ test_class = test_class,
+ jvm_flags = jvm_flags + ["-DBROTLI_32_BIT_CPU=true"],
+ **kwargs
+ )
+
+ native.java_test(
+ name = name + "_64",
+ main_class = main_class,
+ test_class = test_class,
+ jvm_flags = jvm_flags + ["-DBROTLI_32_BIT_CPU=false"],
+ **kwargs
+ )
diff --git a/java/org/brotli/dec/pom.xml b/java/org/brotli/dec/pom.xml
index 24b7aa1..946fddf 100644
--- a/java/org/brotli/dec/pom.xml
+++ b/java/org/brotli/dec/pom.xml
@@ -42,6 +42,16 @@
</plugin>
<plugin>
<groupId>org.apache.maven.plugins</groupId>
+ <artifactId>maven-surefire-plugin</artifactId>
+ <version>3.0.0-M3</version>
+ <configuration>
+ <systemPropertyVariables>
+ <BROTLI_ENABLE_ASSERTS>true</BROTLI_ENABLE_ASSERTS>
+ </systemPropertyVariables>
+ </configuration>
+ </plugin>
+ <plugin>
+ <groupId>org.apache.maven.plugins</groupId>
<artifactId>maven-source-plugin</artifactId>
<version>2.4</version>
<executions>
@@ -123,6 +133,31 @@
</archive>
</configuration>
</plugin>
+ <plugin>
+ <artifactId>maven-resources-plugin</artifactId>
+ <version>3.1.0</version>
+ <executions>
+ <execution>
+ <id>copy-license</id>
+ <phase>validate</phase>
+ <goals>
+ <goal>copy-resources</goal>
+ </goals>
+ <configuration>
+ <outputDirectory>${project.build.outputDirectory}/META-INF</outputDirectory>
+ <resources>
+ <resource>
+ <directory>../../../../</directory>
+ <includes>
+ <include>LICENSE</include>
+ </includes>
+ <filtering>false</filtering>
+ </resource>
+ </resources>
+ </configuration>
+ </execution>
+ </executions>
+ </plugin>
</plugins>
</build>
diff --git a/java/org/brotli/dec/proguard.cfg b/java/org/brotli/dec/proguard.pgcfg
index 4c545dc..4c545dc 100644
--- a/java/org/brotli/dec/proguard.cfg
+++ b/java/org/brotli/dec/proguard.pgcfg
diff --git a/java/org/brotli/enc/BUILD b/java/org/brotli/enc/BUILD
new file mode 100644
index 0000000..66905b9
--- /dev/null
+++ b/java/org/brotli/enc/BUILD
@@ -0,0 +1,14 @@
+# Description:
+# Java port of Brotli decoder.
+
+package(default_visibility = ["//visibility:public"])
+
+licenses(["notice"]) # MIT
+
+java_library(
+ name = "prepared_dictionary",
+ srcs = [
+ "PreparedDictionary.java",
+ "PreparedDictionaryGenerator.java",
+ ],
+)
diff --git a/java/org/brotli/enc/PreparedDictionary.java b/java/org/brotli/enc/PreparedDictionary.java
new file mode 100644
index 0000000..5197801
--- /dev/null
+++ b/java/org/brotli/enc/PreparedDictionary.java
@@ -0,0 +1,16 @@
+/* Copyright 2018 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+package org.brotli.enc;
+
+import java.nio.ByteBuffer;
+
+/**
+ * Prepared dictionary data provider.
+ */
+public interface PreparedDictionary {
+ ByteBuffer getData();
+}
diff --git a/java/org/brotli/enc/PreparedDictionaryGenerator.java b/java/org/brotli/enc/PreparedDictionaryGenerator.java
new file mode 100644
index 0000000..1257b92
--- /dev/null
+++ b/java/org/brotli/enc/PreparedDictionaryGenerator.java
@@ -0,0 +1,185 @@
+/* Copyright 2017 Google Inc. All Rights Reserved.
+
+ Distributed under MIT license.
+ See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+package org.brotli.enc;
+
+import java.nio.Buffer;
+import java.nio.ByteBuffer;
+import java.nio.ByteOrder;
+import java.nio.IntBuffer;
+import java.nio.ShortBuffer;
+
+/**
+ * Java prepared (raw) dictionary producer.
+ */
+public class PreparedDictionaryGenerator {
+
+ private static final int MAGIC = 0xDEBCEDE0;
+ private static final long HASH_MULTIPLIER = 0x1fe35a7bd3579bd3L;
+
+ private static class PreparedDictionaryImpl implements PreparedDictionary {
+ private final ByteBuffer data;
+
+ private PreparedDictionaryImpl(ByteBuffer data) {
+ this.data = data;
+ }
+
+ @Override
+ public ByteBuffer getData() {
+ return data;
+ }
+ }
+
+ // Disallow instantiation.
+ private PreparedDictionaryGenerator() { }
+
+ public static PreparedDictionary generate(ByteBuffer src) {
+ return generate(src, 17, 3, 40, 5);
+ }
+
+ public static PreparedDictionary generate(ByteBuffer src,
+ int bucketBits, int slotBits, int hashBits, int blockBits) {
+ ((Buffer) src).clear(); // Just in case...
+ if (blockBits > 12) {
+ throw new IllegalArgumentException("blockBits is too big");
+ }
+ if (bucketBits >= 24) {
+ throw new IllegalArgumentException("bucketBits is too big");
+ }
+ if (bucketBits - slotBits >= 16) {
+ throw new IllegalArgumentException("slotBits is too small");
+ }
+ int bucketLimit = 1 << blockBits;
+ int numBuckets = 1 << bucketBits;
+ int numSlots = 1 << slotBits;
+ int slotMask = numSlots - 1;
+ int hashShift = 64 - bucketBits;
+ long hashMask = (~0L) >>> (64 - hashBits);
+ int sourceSize = src.capacity();
+ if (sourceSize < 8) {
+ throw new IllegalArgumentException("src is too short");
+ }
+
+ /* Step 1: create "bloated" hasher. */
+ short[] num = new short[numBuckets];
+ int[] bucketHeads = new int[numBuckets];
+ int[] nextBucket = new int[sourceSize];
+
+ long accumulator = 0;
+ for (int i = 0; i < 7; ++i) {
+ accumulator |= (src.get(i) & 0xFFL) << (8 * i);
+ }
+ accumulator <<= 8;
+ /* TODO: apply custom "store" order. */
+ for (int i = 0; i + 7 < sourceSize; ++i) {
+ accumulator = (accumulator >>> 8) | ((src.get(i + 7) & 0xFFL) << 56);
+ long h = (accumulator & hashMask) * HASH_MULTIPLIER;
+ int key = (int) (h >>> hashShift);
+ int count = num[key];
+ nextBucket[i] = (count == 0) ? -1 : bucketHeads[key];
+ bucketHeads[key] = i;
+ count++;
+ if (count > bucketLimit) {
+ count = bucketLimit;
+ }
+ num[key] = (short) count;
+ }
+
+ /* Step 2: find slot limits. */
+ int[] slotLimit = new int[numSlots];
+ int[] slotSize = new int[numSlots];
+ int totalItems = 0;
+ for (int i = 0; i < numSlots; ++i) {
+ boolean overflow = false;
+ slotLimit[i] = bucketLimit;
+ while (true) {
+ overflow = false;
+ int limit = slotLimit[i];
+ int count = 0;
+ for (int j = i; j < numBuckets; j += numSlots) {
+ int size = num[j];
+ /* Last chain may span behind 64K limit; overflow happens only if
+ we are about to use 0xFFFF+ as item offset. */
+ if (count >= 0xFFFF) {
+ overflow = true;
+ break;
+ }
+ if (size > limit) {
+ size = limit;
+ }
+ count += size;
+ }
+ if (!overflow) {
+ slotSize[i] = count;
+ totalItems += count;
+ break;
+ }
+ slotLimit[i]--;
+ }
+ }
+
+ /* Step 3: transfer data to "slim" hasher. */
+ int part0 = 6 * 4;
+ int part1 = numSlots * 4;
+ int part2 = numBuckets * 2;
+ int part3 = totalItems * 4;
+ int allocSize = part0 + part1 + part2 + part3 + sourceSize;
+ ByteBuffer flat = ByteBuffer.allocateDirect(allocSize);
+ ByteBuffer pointer = flat.slice();
+ pointer.order(ByteOrder.nativeOrder());
+
+ IntBuffer struct = pointer.asIntBuffer();
+ pointer.position(pointer.position() + part0);
+ IntBuffer slotOffsets = pointer.asIntBuffer();
+ pointer.position(pointer.position() + part1);
+ ShortBuffer heads = pointer.asShortBuffer();
+ pointer.position(pointer.position() + part2);
+ IntBuffer items = pointer.asIntBuffer();
+ pointer.position(pointer.position() + part3);
+ ByteBuffer sourceCopy = pointer.slice();
+
+ /* magic */ struct.put(0, MAGIC);
+ /* source_offset */ struct.put(1, totalItems);
+ /* source_size */ struct.put(2, sourceSize);
+ /* hash_bits */ struct.put(3, hashBits);
+ /* bucket_bits */ struct.put(4, bucketBits);
+ /* slot_bits */ struct.put(5, slotBits);
+
+ totalItems = 0;
+ for (int i = 0; i < numSlots; ++i) {
+ slotOffsets.put(i, totalItems);
+ totalItems += slotSize[i];
+ slotSize[i] = 0;
+ }
+
+ for (int i = 0; i < numBuckets; ++i) {
+ int slot = i & slotMask;
+ int count = num[i];
+ if (count > slotLimit[slot]) {
+ count = slotLimit[slot];
+ }
+ if (count == 0) {
+ heads.put(i, (short) 0xFFFF);
+ continue;
+ }
+ int cursor = slotSize[slot];
+ heads.put(i, (short) cursor);
+ cursor += slotOffsets.get(slot);
+ slotSize[slot] += count;
+ int pos = bucketHeads[i];
+ for (int j = 0; j < count; j++) {
+ items.put(cursor++, pos);
+ pos = nextBucket[pos];
+ }
+ cursor--;
+ items.put(cursor, items.get(cursor) | 0x80000000);
+ }
+
+ sourceCopy.put(src);
+
+ return new PreparedDictionaryImpl(flat);
+ }
+}
diff --git a/java/org/brotli/pom.xml b/java/org/brotli/pom.xml
index bb4a5a3..9a7abd0 100644
--- a/java/org/brotli/pom.xml
+++ b/java/org/brotli/pom.xml
@@ -80,8 +80,8 @@
<artifactId>maven-compiler-plugin</artifactId>
<version>3.1</version>
<configuration>
- <source>1.5</source>
- <target>1.5</target>
+ <source>1.6</source>
+ <target>1.6</target>
</configuration>
</plugin>
<plugin>
diff --git a/java/org/brotli/wrapper/common/BUILD b/java/org/brotli/wrapper/common/BUILD
index 48b02f3..afe9bc5 100644
--- a/java/org/brotli/wrapper/common/BUILD
+++ b/java/org/brotli/wrapper/common/BUILD
@@ -18,6 +18,7 @@ java_library(
["*.java"],
exclude = ["*Test*.java"],
),
+ resource_jars = ["//:license"],
)
java_library(
@@ -29,13 +30,12 @@ java_library(
"//org/brotli/dec",
"//org/brotli/integration:brotli_jni_test_base",
"//org/brotli/wrapper/dec",
- "@junit_junit//jar",
+ "@maven//:junit_junit",
],
)
java_test(
name = "SetZeroDictionaryTest",
- test_class = "org.brotli.wrapper.common.SetZeroDictionaryTest",
size = "small",
data = [
":brotli_jni_no_dictionary_data", # Bazel JNI workaround
@@ -43,12 +43,12 @@ java_test(
jvm_flags = [
"-DBROTLI_JNI_LIBRARY=$(location :brotli_jni_no_dictionary_data)",
],
+ test_class = "org.brotli.wrapper.common.SetZeroDictionaryTest",
runtime_deps = [":test_lib"],
)
java_test(
name = "SetRfcDictionaryTest",
- test_class = "org.brotli.wrapper.common.SetRfcDictionaryTest",
size = "small",
data = [
":brotli_jni_no_dictionary_data", # Bazel JNI workaround
@@ -56,5 +56,6 @@ java_test(
jvm_flags = [
"-DBROTLI_JNI_LIBRARY=$(location :brotli_jni_no_dictionary_data)",
],
+ test_class = "org.brotli.wrapper.common.SetRfcDictionaryTest",
runtime_deps = [":test_lib"],
)
diff --git a/java/org/brotli/wrapper/common/common_jni.cc b/java/org/brotli/wrapper/common/common_jni.cc
index 2ea2ad8..c71ca49 100644
--- a/java/org/brotli/wrapper/common/common_jni.cc
+++ b/java/org/brotli/wrapper/common/common_jni.cc
@@ -6,7 +6,7 @@
#include <jni.h>
-#include "../common/dictionary.h"
+#include "c/common/dictionary.h"
#ifdef __cplusplus
extern "C" {
diff --git a/java/org/brotli/wrapper/dec/BUILD b/java/org/brotli/wrapper/dec/BUILD
index fcf0dbf..4fd51d0 100644
--- a/java/org/brotli/wrapper/dec/BUILD
+++ b/java/org/brotli/wrapper/dec/BUILD
@@ -13,6 +13,7 @@ java_library(
["*.java"],
exclude = ["*Test*.java"],
),
+ resource_jars = ["//:license"],
)
java_library(
@@ -23,7 +24,7 @@ java_library(
":dec",
"//org/brotli/integration:brotli_jni_test_base",
"//org/brotli/integration:bundle_helper",
- "@junit_junit//jar",
+ "@maven//:junit_junit",
],
)
@@ -39,7 +40,6 @@ filegroup(
java_test(
name = "BrotliDecoderChannelTest",
- test_class = "org.brotli.wrapper.dec.BrotliDecoderChannelTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -49,12 +49,12 @@ java_test(
"-DBROTLI_JNI_LIBRARY=$(location :brotli_jni)",
"-DTEST_BUNDLE=$(location :test_bundle)",
],
+ test_class = "org.brotli.wrapper.dec.BrotliDecoderChannelTest",
runtime_deps = [":test_lib"],
)
java_test(
name = "BrotliInputStreamTest",
- test_class = "org.brotli.wrapper.dec.BrotliInputStreamTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -64,12 +64,12 @@ java_test(
"-DBROTLI_JNI_LIBRARY=$(location :brotli_jni)",
"-DTEST_BUNDLE=$(location :test_bundle)",
],
+ test_class = "org.brotli.wrapper.dec.BrotliInputStreamTest",
runtime_deps = [":test_lib"],
)
java_test(
name = "DecoderTest",
- test_class = "org.brotli.wrapper.dec.DecoderTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -79,5 +79,6 @@ java_test(
"-DBROTLI_JNI_LIBRARY=$(location :brotli_jni)",
"-DTEST_BUNDLE=$(location :test_bundle)",
],
+ test_class = "org.brotli.wrapper.dec.DecoderTest",
runtime_deps = [":test_lib"],
)
diff --git a/java/org/brotli/wrapper/dec/BrotliInputStream.java b/java/org/brotli/wrapper/dec/BrotliInputStream.java
index 26f7a82..6e2e6e5 100644
--- a/java/org/brotli/wrapper/dec/BrotliInputStream.java
+++ b/java/org/brotli/wrapper/dec/BrotliInputStream.java
@@ -34,8 +34,8 @@ public class BrotliInputStream extends InputStream {
this(source, DEFAULT_BUFFER_SIZE);
}
- public void setEager(boolean eager) {
- decoder.setEager(eager);
+ public void enableEagerOutput() {
+ decoder.enableEagerOutput();
}
@Override
diff --git a/java/org/brotli/wrapper/dec/Decoder.java b/java/org/brotli/wrapper/dec/Decoder.java
index ae4d817..26183ab 100644
--- a/java/org/brotli/wrapper/dec/Decoder.java
+++ b/java/org/brotli/wrapper/dec/Decoder.java
@@ -50,8 +50,8 @@ public class Decoder {
throw new IOException(message);
}
- public void setEager(boolean eager) {
- this.eager = eager;
+ public void enableEagerOutput() {
+ this.eager = true;
}
/**
diff --git a/java/org/brotli/wrapper/dec/DecoderJNI.java b/java/org/brotli/wrapper/dec/DecoderJNI.java
index 320705c..2319b1e 100644
--- a/java/org/brotli/wrapper/dec/DecoderJNI.java
+++ b/java/org/brotli/wrapper/dec/DecoderJNI.java
@@ -30,6 +30,7 @@ public class DecoderJNI {
private final long[] context = new long[3];
private final ByteBuffer inputBuffer;
private Status lastStatus = Status.NEEDS_MORE_INPUT;
+ private boolean fresh = true;
public Wrapper(int inputBufferSize) throws IOException {
this.context[1] = inputBufferSize;
@@ -52,6 +53,7 @@ public class DecoderJNI {
if (lastStatus == Status.OK && length != 0) {
throw new IllegalStateException("pushing input to decoder in OK state");
}
+ fresh = false;
nativePush(context, length);
parseStatus();
}
@@ -90,6 +92,7 @@ public class DecoderJNI {
if (lastStatus != Status.NEEDS_MORE_OUTPUT && !hasOutput()) {
throw new IllegalStateException("pulling output from decoder in " + lastStatus + " state");
}
+ fresh = false;
ByteBuffer result = nativePull(context);
parseStatus();
return result;
diff --git a/java/org/brotli/wrapper/dec/EagerStreamTest.java b/java/org/brotli/wrapper/dec/EagerStreamTest.java
index 9166092..919f6e3 100755..100644
--- a/java/org/brotli/wrapper/dec/EagerStreamTest.java
+++ b/java/org/brotli/wrapper/dec/EagerStreamTest.java
@@ -56,7 +56,7 @@ public class EagerStreamTest extends BrotliJniTestBase {
}
};
BrotliInputStream reader = new BrotliInputStream(source);
- reader.setEager(true);
+ reader.enableEagerOutput();
int count = 0;
while (true) {
log.append("^").append(count);
diff --git a/java/org/brotli/wrapper/enc/BUILD b/java/org/brotli/wrapper/enc/BUILD
index 42ad23e..22154d2 100644
--- a/java/org/brotli/wrapper/enc/BUILD
+++ b/java/org/brotli/wrapper/enc/BUILD
@@ -18,6 +18,7 @@ java_library(
["*.java"],
exclude = ["*Test*.java"],
),
+ resource_jars = ["//:license"],
)
java_library(
@@ -29,7 +30,7 @@ java_library(
"//org/brotli/integration:brotli_jni_test_base",
"//org/brotli/integration:bundle_helper",
"//org/brotli/wrapper/dec",
- "@junit_junit//jar",
+ "@maven//:junit_junit",
],
)
@@ -40,7 +41,6 @@ filegroup(
java_test(
name = "BrotliEncoderChannelTest",
- test_class = "org.brotli.wrapper.enc.BrotliEncoderChannelTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -51,12 +51,12 @@ java_test(
"-DTEST_BUNDLE=$(location :test_bundle)",
],
shard_count = 15,
+ test_class = "org.brotli.wrapper.enc.BrotliEncoderChannelTest",
runtime_deps = [":test_lib"],
)
java_test(
name = "BrotliOutputStreamTest",
- test_class = "org.brotli.wrapper.enc.BrotliOutputStreamTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -67,12 +67,12 @@ java_test(
"-DTEST_BUNDLE=$(location :test_bundle)",
],
shard_count = 15,
+ test_class = "org.brotli.wrapper.enc.BrotliOutputStreamTest",
runtime_deps = [":test_lib"],
)
java_test(
name = "EncoderTest",
- test_class = "org.brotli.wrapper.enc.EncoderTest",
size = "large",
data = [
":brotli_jni", # Bazel JNI workaround
@@ -83,5 +83,6 @@ java_test(
"-DTEST_BUNDLE=$(location :test_bundle)",
],
shard_count = 15,
+ test_class = "org.brotli.wrapper.enc.EncoderTest",
runtime_deps = [":test_lib"],
)
diff --git a/java/org/brotli/wrapper/enc/EmptyInputTest.java b/java/org/brotli/wrapper/enc/EmptyInputTest.java
index a536381..a536381 100755..100644
--- a/java/org/brotli/wrapper/enc/EmptyInputTest.java
+++ b/java/org/brotli/wrapper/enc/EmptyInputTest.java
diff --git a/java/org/brotli/wrapper/enc/EncoderJNI.java b/java/org/brotli/wrapper/enc/EncoderJNI.java
index 6627f5a..5013629 100644
--- a/java/org/brotli/wrapper/enc/EncoderJNI.java
+++ b/java/org/brotli/wrapper/enc/EncoderJNI.java
@@ -27,9 +27,13 @@ class EncoderJNI {
static class Wrapper {
protected final long[] context = new long[5];
private final ByteBuffer inputBuffer;
+ private boolean fresh = true;
Wrapper(int inputBufferSize, int quality, int lgwin)
throws IOException {
+ if (inputBufferSize <= 0) {
+ throw new IOException("buffer size must be positive");
+ }
this.context[1] = inputBufferSize;
this.context[2] = quality;
this.context[3] = lgwin;
@@ -56,6 +60,7 @@ class EncoderJNI {
throw new IllegalStateException("pushing input to encoder over previous input");
}
context[1] = op.ordinal();
+ fresh = false;
nativePush(context, length);
}
@@ -86,6 +91,7 @@ class EncoderJNI {
if (!isSuccess() || !hasMoreOutput()) {
throw new IllegalStateException("pulling while data is not ready");
}
+ fresh = false;
return nativePull(context);
}
diff --git a/js/WORKSPACE b/js/WORKSPACE
index a606eba..f15740a 100644
--- a/js/WORKSPACE
+++ b/js/WORKSPACE
@@ -1,13 +1,11 @@
workspace(name = "org_brotli_js")
-http_archive(
+load("@bazel_tools//tools/build_defs/repo:git.bzl", "git_repository")
+
+git_repository(
name = "io_bazel_rules_closure",
- sha256 = "b29a8bc2cb10513c864cb1084d6f38613ef14a143797cea0af0f91cd385f5e8c",
- strip_prefix = "rules_closure-0.8.0",
- urls = [
- "https://mirror.bazel.build/github.com/bazelbuild/rules_closure/archive/0.8.0.tar.gz",
- "https://github.com/bazelbuild/rules_closure/archive/0.8.0.tar.gz",
- ],
+ commit = "29ec97e7c85d607ba9e41cab3993fbb13f812c4b",
+ remote = "https://github.com/bazelbuild/rules_closure.git",
)
load("@io_bazel_rules_closure//closure:defs.bzl", "closure_repositories")
diff --git a/js/decode.js b/js/decode.js
index 40a4df7..7896a50 100644
--- a/js/decode.js
+++ b/js/decode.js
@@ -22,25 +22,98 @@ function BrotliDecodeClosure() {
/** @type {!number} */
this.offset = 0;
}
+ var MAX_HUFFMAN_TABLE_SIZE = Int32Array.from([256, 402, 436, 468, 500, 534, 566, 598, 630, 662, 694, 726, 758, 790, 822, 854, 886, 920, 952, 984, 1016, 1048, 1080]);
var CODE_LENGTH_CODE_ORDER = Int32Array.from([1, 2, 3, 4, 0, 5, 17, 6, 16, 7, 8, 9, 10, 11, 12, 13, 14, 15]);
- var DISTANCE_SHORT_CODE_INDEX_OFFSET = Int32Array.from([3, 2, 1, 0, 3, 3, 3, 3, 3, 3, 2, 2, 2, 2, 2, 2]);
+ var DISTANCE_SHORT_CODE_INDEX_OFFSET = Int32Array.from([0, 3, 2, 1, 0, 0, 0, 0, 0, 0, 3, 3, 3, 3, 3, 3]);
var DISTANCE_SHORT_CODE_VALUE_OFFSET = Int32Array.from([0, 0, 0, 0, -1, 1, -2, 2, -3, 3, -1, 1, -2, 2, -3, 3]);
var FIXED_TABLE = Int32Array.from([0x020000, 0x020004, 0x020003, 0x030002, 0x020000, 0x020004, 0x020003, 0x040001, 0x020000, 0x020004, 0x020003, 0x030002, 0x020000, 0x020004, 0x020003, 0x040005]);
var DICTIONARY_OFFSETS_BY_LENGTH = Int32Array.from([0, 0, 0, 0, 0, 4096, 9216, 21504, 35840, 44032, 53248, 63488, 74752, 87040, 93696, 100864, 104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280, 122016]);
var DICTIONARY_SIZE_BITS_BY_LENGTH = Int32Array.from([0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10, 9, 9, 8, 7, 7, 8, 7, 7, 6, 6, 5, 5]);
var BLOCK_LENGTH_OFFSET = Int32Array.from([1, 5, 9, 13, 17, 25, 33, 41, 49, 65, 81, 97, 113, 145, 177, 209, 241, 305, 369, 497, 753, 1265, 2289, 4337, 8433, 16625]);
var BLOCK_LENGTH_N_BITS = Int32Array.from([2, 2, 2, 2, 3, 3, 3, 3, 4, 4, 4, 4, 5, 5, 5, 5, 6, 6, 7, 8, 9, 10, 11, 12, 13, 24]);
- var INSERT_LENGTH_OFFSET = Int32Array.from([0, 1, 2, 3, 4, 5, 6, 8, 10, 14, 18, 26, 34, 50, 66, 98, 130, 194, 322, 578, 1090, 2114, 6210, 22594]);
- var INSERT_LENGTH_N_BITS = Int32Array.from([0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 12, 14, 24]);
- var COPY_LENGTH_OFFSET = Int32Array.from([2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 18, 22, 30, 38, 54, 70, 102, 134, 198, 326, 582, 1094, 2118]);
- var COPY_LENGTH_N_BITS = Int32Array.from([0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 2, 2, 3, 3, 4, 4, 5, 5, 6, 7, 8, 9, 10, 24]);
- var INSERT_RANGE_LUT = Int32Array.from([0, 0, 8, 8, 0, 16, 8, 16, 16]);
- var COPY_RANGE_LUT = Int32Array.from([0, 8, 0, 8, 16, 0, 16, 8, 16]);
+ var INSERT_LENGTH_N_BITS = Int16Array.from([0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x02, 0x02, 0x03, 0x03, 0x04, 0x04, 0x05, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0A, 0x0C, 0x0E, 0x18]);
+ var COPY_LENGTH_N_BITS = Int16Array.from([0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x02, 0x02, 0x03, 0x03, 0x04, 0x04, 0x05, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0A, 0x18]);
+ var CMD_LOOKUP = new Int16Array(2816);
+ {
+ unpackCommandLookupTable(CMD_LOOKUP);
+ }
+ /**
+ * @param {number} i
+ * @return {number}
+ */
+ function log2floor(i) {
+ var /** number */ result = -1;
+ var /** number */ step = 16;
+ while (step > 0) {
+ if ((i >>> step) != 0) {
+ result += step;
+ i = i >>> step;
+ }
+ step = step >> 1;
+ }
+ return result + i;
+ }
+ /**
+ * @param {number} npostfix
+ * @param {number} ndirect
+ * @param {number} maxndistbits
+ * @return {number}
+ */
+ function calculateDistanceAlphabetSize(npostfix, ndirect, maxndistbits) {
+ return 16 + ndirect + 2 * (maxndistbits << npostfix);
+ }
+ /**
+ * @param {number} maxDistance
+ * @param {number} npostfix
+ * @param {number} ndirect
+ * @return {number}
+ */
+ function calculateDistanceAlphabetLimit(maxDistance, npostfix, ndirect) {
+ if (maxDistance < ndirect + (2 << npostfix)) {
+ throw "maxDistance is too small";
+ }
+ var /** number */ offset = ((maxDistance - ndirect) >> npostfix) + 4;
+ var /** number */ ndistbits = log2floor(offset) - 1;
+ var /** number */ group = ((ndistbits - 1) << 1) | ((offset >> ndistbits) & 1);
+ return ((group - 1) << npostfix) + (1 << npostfix) + ndirect + 16;
+ }
+ /**
+ * @param {!Int16Array} cmdLookup
+ * @return {void}
+ */
+ function unpackCommandLookupTable(cmdLookup) {
+ var /** !Int16Array */ insertLengthOffsets = new Int16Array(24);
+ var /** !Int16Array */ copyLengthOffsets = new Int16Array(24);
+ copyLengthOffsets[0] = 2;
+ for (var /** number */ i = 0; i < 23; ++i) {
+ insertLengthOffsets[i + 1] = (insertLengthOffsets[i] + (1 << INSERT_LENGTH_N_BITS[i]));
+ copyLengthOffsets[i + 1] = (copyLengthOffsets[i] + (1 << COPY_LENGTH_N_BITS[i]));
+ }
+ for (var /** number */ cmdCode = 0; cmdCode < 704; ++cmdCode) {
+ var /** number */ rangeIdx = cmdCode >>> 6;
+ var /** number */ distanceContextOffset = -4;
+ if (rangeIdx >= 2) {
+ rangeIdx -= 2;
+ distanceContextOffset = 0;
+ }
+ var /** number */ insertCode = (((0x29850 >>> (rangeIdx * 2)) & 0x3) << 3) | ((cmdCode >>> 3) & 7);
+ var /** number */ copyCode = (((0x26244 >>> (rangeIdx * 2)) & 0x3) << 3) | (cmdCode & 7);
+ var /** number */ copyLengthOffset = copyLengthOffsets[copyCode];
+ var /** number */ distanceContext = distanceContextOffset + (copyLengthOffset > 4 ? 3 : copyLengthOffset - 2);
+ var /** number */ index = cmdCode * 4;
+ cmdLookup[index + 0] = (INSERT_LENGTH_N_BITS[insertCode] | (COPY_LENGTH_N_BITS[copyCode] << 8));
+ cmdLookup[index + 1] = insertLengthOffsets[insertCode];
+ cmdLookup[index + 2] = copyLengthOffsets[copyCode];
+ cmdLookup[index + 3] = distanceContext;
+ }
+ }
/**
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function decodeWindowBits(s) {
+ var /** number */ largeWindowEnabled = s.isLargeWindow;
+ s.isLargeWindow = 0;
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
@@ -48,18 +121,53 @@ function BrotliDecodeClosure() {
if (readFewBits(s, 1) == 0) {
return 16;
}
- var /** !number */ n = readFewBits(s, 3);
+ var /** number */ n = readFewBits(s, 3);
if (n != 0) {
return 17 + n;
}
n = readFewBits(s, 3);
if (n != 0) {
- return 8 + n;
+ if (n == 1) {
+ if (largeWindowEnabled == 0) {
+ return -1;
+ }
+ s.isLargeWindow = 1;
+ if (readFewBits(s, 1) == 1) {
+ return -1;
+ }
+ n = readFewBits(s, 6);
+ if (n < 10 || n > 30) {
+ return -1;
+ }
+ return n;
+ } else {
+ return 8 + n;
+ }
}
return 17;
}
/**
* @param {!State} s
+ * @return {void}
+ */
+ function enableEagerOutput(s) {
+ if (s.runningState != 1) {
+ throw "State MUST be freshly initialized";
+ }
+ s.isEager = 1;
+ }
+ /**
+ * @param {!State} s
+ * @return {void}
+ */
+ function enableLargeWindow(s) {
+ if (s.runningState != 1) {
+ throw "State MUST be freshly initialized";
+ }
+ s.isLargeWindow = 1;
+ }
+ /**
+ * @param {!State} s
* @param {!InputStream} input
* @return {void}
*/
@@ -67,15 +175,14 @@ function BrotliDecodeClosure() {
if (s.runningState != 0) {
throw "State MUST be uninitialized";
}
- s.blockTrees = new Int32Array(6480);
+ s.blockTrees = new Int32Array(3091);
+ s.blockTrees[0] = 7;
+ s.distRbIdx = 3;
+ var /** number */ maxDistanceAlphabetLimit = calculateDistanceAlphabetLimit(0x7FFFFFFC, 3, 15 << 3);
+ s.distExtraBits = new Int8Array(maxDistanceAlphabetLimit);
+ s.distOffset = new Int32Array(maxDistanceAlphabetLimit);
s.input = input;
initBitReader(s);
- var /** !number */ windowBits = decodeWindowBits(s);
- if (windowBits == 9) {
- throw "Invalid 'windowBits' code";
- }
- s.maxRingBufferSize = 1 << windowBits;
- s.maxBackwardDistance = s.maxRingBufferSize - 16;
s.runningState = 1;
}
/**
@@ -86,10 +193,10 @@ function BrotliDecodeClosure() {
if (s.runningState == 0) {
throw "State MUST be initialized";
}
- if (s.runningState == 10) {
+ if (s.runningState == 11) {
return;
}
- s.runningState = 10;
+ s.runningState = 11;
if (s.input != null) {
closeInput(s.input);
s.input = null;
@@ -97,7 +204,7 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function decodeVarLenUnsignedByte(s) {
if (s.bitOffset >= 16) {
@@ -105,7 +212,7 @@ function BrotliDecodeClosure() {
s.bitOffset -= 16;
}
if (readFewBits(s, 1) != 0) {
- var /** !number */ n = readFewBits(s, 3);
+ var /** number */ n = readFewBits(s, 3);
if (n == 0) {
return 1;
} else {
@@ -130,34 +237,34 @@ function BrotliDecodeClosure() {
if ((s.inputEnd != 0) && readFewBits(s, 1) != 0) {
return;
}
- var /** !number */ sizeNibbles = readFewBits(s, 2) + 4;
+ var /** number */ sizeNibbles = readFewBits(s, 2) + 4;
if (sizeNibbles == 7) {
s.isMetadata = 1;
if (readFewBits(s, 1) != 0) {
throw "Corrupted reserved bit";
}
- var /** !number */ sizeBytes = readFewBits(s, 2);
+ var /** number */ sizeBytes = readFewBits(s, 2);
if (sizeBytes == 0) {
return;
}
- for (var /** !number */ i = 0; i < sizeBytes; i++) {
+ for (var /** number */ i = 0; i < sizeBytes; i++) {
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ bits = readFewBits(s, 8);
+ var /** number */ bits = readFewBits(s, 8);
if (bits == 0 && i + 1 == sizeBytes && sizeBytes > 1) {
throw "Exuberant nibble";
}
s.metaBlockLength |= bits << (i * 8);
}
} else {
- for (var /** !number */ i = 0; i < sizeNibbles; i++) {
+ for (var /** number */ i = 0; i < sizeNibbles; i++) {
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ bits = readFewBits(s, 4);
+ var /** number */ bits = readFewBits(s, 4);
if (bits == 0 && i + 1 == sizeNibbles && sizeNibbles > 4) {
throw "Exuberant nibble";
}
@@ -170,39 +277,40 @@ function BrotliDecodeClosure() {
}
}
/**
- * @param {!Int32Array} table
- * @param {!number} offset
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
- function readSymbol(table, offset, s) {
- var /** !number */ val = (s.accumulator32 >>> s.bitOffset);
+ function readSymbol(tableGroup, tableIdx, s) {
+ var /** number */ offset = tableGroup[tableIdx];
+ var /** number */ val = (s.accumulator32 >>> s.bitOffset);
offset += val & 0xFF;
- var /** !number */ bits = table[offset] >> 16;
- var /** !number */ sym = table[offset] & 0xFFFF;
+ var /** number */ bits = tableGroup[offset] >> 16;
+ var /** number */ sym = tableGroup[offset] & 0xFFFF;
if (bits <= 8) {
s.bitOffset += bits;
return sym;
}
offset += sym;
- var /** !number */ mask = (1 << bits) - 1;
+ var /** number */ mask = (1 << bits) - 1;
offset += (val & mask) >>> 8;
- s.bitOffset += ((table[offset] >> 16) + 8);
- return table[offset] & 0xFFFF;
+ s.bitOffset += ((tableGroup[offset] >> 16) + 8);
+ return tableGroup[offset] & 0xFFFF;
}
/**
- * @param {!Int32Array} table
- * @param {!number} offset
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
- function readBlockLength(table, offset, s) {
+ function readBlockLength(tableGroup, tableIdx, s) {
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ code = readSymbol(table, offset, s);
- var /** !number */ n = BLOCK_LENGTH_N_BITS[code];
+ var /** number */ code = readSymbol(tableGroup, tableIdx, s);
+ var /** number */ n = BLOCK_LENGTH_N_BITS[code];
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
@@ -210,26 +318,12 @@ function BrotliDecodeClosure() {
return BLOCK_LENGTH_OFFSET[code] + ((n <= 16) ? readFewBits(s, n) : readManyBits(s, n));
}
/**
- * @param {!number} code
- * @param {!Int32Array} ringBuffer
- * @param {!number} index
- * @return {!number}
- */
- function translateShortCodes(code, ringBuffer, index) {
- if (code < 16) {
- index += DISTANCE_SHORT_CODE_INDEX_OFFSET[code];
- index &= 3;
- return ringBuffer[index] + DISTANCE_SHORT_CODE_VALUE_OFFSET[code];
- }
- return code - 16 + 1;
- }
- /**
* @param {!Int32Array} v
- * @param {!number} index
+ * @param {number} index
* @return {void}
*/
function moveToFront(v, index) {
- var /** !number */ value = v[index];
+ var /** number */ value = v[index];
for (; index > 0; index--) {
v[index] = v[index - 1];
}
@@ -237,16 +331,16 @@ function BrotliDecodeClosure() {
}
/**
* @param {!Int8Array} v
- * @param {!number} vLen
+ * @param {number} vLen
* @return {void}
*/
function inverseMoveToFrontTransform(v, vLen) {
var /** !Int32Array */ mtf = new Int32Array(256);
- for (var /** !number */ i = 0; i < 256; i++) {
+ for (var /** number */ i = 0; i < 256; i++) {
mtf[i] = i;
}
- for (var /** !number */ i = 0; i < vLen; i++) {
- var /** !number */ index = v[i] & 0xFF;
+ for (var /** number */ i = 0; i < vLen; i++) {
+ var /** number */ index = v[i] & 0xFF;
v[i] = mtf[index];
if (index != 0) {
moveToFront(mtf, index);
@@ -255,19 +349,20 @@ function BrotliDecodeClosure() {
}
/**
* @param {!Int32Array} codeLengthCodeLengths
- * @param {!number} numSymbols
+ * @param {number} numSymbols
* @param {!Int32Array} codeLengths
* @param {!State} s
* @return {void}
*/
function readHuffmanCodeLengths(codeLengthCodeLengths, numSymbols, codeLengths, s) {
- var /** !number */ symbol = 0;
- var /** !number */ prevCodeLen = 8;
- var /** !number */ repeat = 0;
- var /** !number */ repeatCodeLen = 0;
- var /** !number */ space = 32768;
- var /** !Int32Array */ table = new Int32Array(32);
- buildHuffmanTable(table, 0, 5, codeLengthCodeLengths, 18);
+ var /** number */ symbol = 0;
+ var /** number */ prevCodeLen = 8;
+ var /** number */ repeat = 0;
+ var /** number */ repeatCodeLen = 0;
+ var /** number */ space = 32768;
+ var /** !Int32Array */ table = new Int32Array(32 + 1);
+ var /** number */ tableIdx = table.length - 1;
+ buildHuffmanTable(table, tableIdx, 5, codeLengthCodeLengths, 18);
while (symbol < numSymbols && space > 0) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
@@ -276,9 +371,9 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ p = (s.accumulator32 >>> s.bitOffset) & 31;
+ var /** number */ p = (s.accumulator32 >>> s.bitOffset) & 31;
s.bitOffset += table[p] >> 16;
- var /** !number */ codeLen = table[p] & 0xFFFF;
+ var /** number */ codeLen = table[p] & 0xFFFF;
if (codeLen < 16) {
repeat = 0;
codeLengths[symbol++] = codeLen;
@@ -287,8 +382,8 @@ function BrotliDecodeClosure() {
space -= 32768 >> codeLen;
}
} else {
- var /** !number */ extraBits = codeLen - 14;
- var /** !number */ newLen = 0;
+ var /** number */ extraBits = codeLen - 14;
+ var /** number */ newLen = 0;
if (codeLen == 16) {
newLen = prevCodeLen;
}
@@ -296,7 +391,7 @@ function BrotliDecodeClosure() {
repeat = 0;
repeatCodeLen = newLen;
}
- var /** !number */ oldRepeat = repeat;
+ var /** number */ oldRepeat = repeat;
if (repeat > 0) {
repeat -= 2;
repeat <<= extraBits;
@@ -306,11 +401,11 @@ function BrotliDecodeClosure() {
s.bitOffset -= 16;
}
repeat += readFewBits(s, extraBits) + 3;
- var /** !number */ repeatDelta = repeat - oldRepeat;
+ var /** number */ repeatDelta = repeat - oldRepeat;
if (symbol + repeatDelta > numSymbols) {
throw "symbol + repeatDelta > numSymbols";
}
- for (var /** !number */ i = 0; i < repeatDelta; i++) {
+ for (var /** number */ i = 0; i < repeatDelta; i++) {
codeLengths[symbol++] = repeatCodeLen;
}
if (repeatCodeLen != 0) {
@@ -325,112 +420,145 @@ function BrotliDecodeClosure() {
}
/**
* @param {!Int32Array} symbols
- * @param {!number} length
- * @return {!number}
+ * @param {number} length
+ * @return {void}
*/
function checkDupes(symbols, length) {
- for (var /** !number */ i = 0; i < length - 1; ++i) {
- for (var /** !number */ j = i + 1; j < length; ++j) {
+ for (var /** number */ i = 0; i < length - 1; ++i) {
+ for (var /** number */ j = i + 1; j < length; ++j) {
if (symbols[i] == symbols[j]) {
- return 0;
+ throw "Duplicate simple Huffman code symbol";
}
}
}
- return 1;
}
/**
- * @param {!number} alphabetSize
- * @param {!Int32Array} table
- * @param {!number} offset
+ * @param {number} alphabetSizeMax
+ * @param {number} alphabetSizeLimit
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
* @param {!State} s
- * @return {void}
+ * @return {number}
+ */
+ function readSimpleHuffmanCode(alphabetSizeMax, alphabetSizeLimit, tableGroup, tableIdx, s) {
+ var /** !Int32Array */ codeLengths = new Int32Array(alphabetSizeLimit);
+ var /** !Int32Array */ symbols = new Int32Array(4);
+ var /** number */ maxBits = 1 + log2floor(alphabetSizeMax - 1);
+ var /** number */ numSymbols = readFewBits(s, 2) + 1;
+ for (var /** number */ i = 0; i < numSymbols; i++) {
+ if (s.bitOffset >= 16) {
+ s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
+ s.bitOffset -= 16;
+ }
+ var /** number */ symbol = readFewBits(s, maxBits);
+ if (symbol >= alphabetSizeLimit) {
+ throw "Can't readHuffmanCode";
+ }
+ symbols[i] = symbol;
+ }
+ checkDupes(symbols, numSymbols);
+ var /** number */ histogramId = numSymbols;
+ if (numSymbols == 4) {
+ histogramId += readFewBits(s, 1);
+ }
+ switch(histogramId) {
+ case 1:
+ codeLengths[symbols[0]] = 1;
+ break;
+ case 2:
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 1;
+ break;
+ case 3:
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 2;
+ break;
+ case 4:
+ codeLengths[symbols[0]] = 2;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 2;
+ codeLengths[symbols[3]] = 2;
+ break;
+ case 5:
+ codeLengths[symbols[0]] = 1;
+ codeLengths[symbols[1]] = 2;
+ codeLengths[symbols[2]] = 3;
+ codeLengths[symbols[3]] = 3;
+ break;
+ default:
+ break;
+ }
+ return buildHuffmanTable(tableGroup, tableIdx, 8, codeLengths, alphabetSizeLimit);
+ }
+ /**
+ * @param {number} alphabetSizeLimit
+ * @param {number} skip
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
+ * @param {!State} s
+ * @return {number}
*/
- function readHuffmanCode(alphabetSize, table, offset, s) {
- var /** !number */ ok = 1;
- var /** !number */ simpleCodeOrSkip;
+ function readComplexHuffmanCode(alphabetSizeLimit, skip, tableGroup, tableIdx, s) {
+ var /** !Int32Array */ codeLengths = new Int32Array(alphabetSizeLimit);
+ var /** !Int32Array */ codeLengthCodeLengths = new Int32Array(18);
+ var /** number */ space = 32;
+ var /** number */ numCodes = 0;
+ for (var /** number */ i = skip; i < 18 && space > 0; i++) {
+ var /** number */ codeLenIdx = CODE_LENGTH_CODE_ORDER[i];
+ if (s.bitOffset >= 16) {
+ s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
+ s.bitOffset -= 16;
+ }
+ var /** number */ p = (s.accumulator32 >>> s.bitOffset) & 15;
+ s.bitOffset += FIXED_TABLE[p] >> 16;
+ var /** number */ v = FIXED_TABLE[p] & 0xFFFF;
+ codeLengthCodeLengths[codeLenIdx] = v;
+ if (v != 0) {
+ space -= (32 >> v);
+ numCodes++;
+ }
+ }
+ if (space != 0 && numCodes != 1) {
+ throw "Corrupted Huffman code histogram";
+ }
+ readHuffmanCodeLengths(codeLengthCodeLengths, alphabetSizeLimit, codeLengths, s);
+ return buildHuffmanTable(tableGroup, tableIdx, 8, codeLengths, alphabetSizeLimit);
+ }
+ /**
+ * @param {number} alphabetSizeMax
+ * @param {number} alphabetSizeLimit
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
+ * @param {!State} s
+ * @return {number}
+ */
+ function readHuffmanCode(alphabetSizeMax, alphabetSizeLimit, tableGroup, tableIdx, s) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
- var /** !Int32Array */ codeLengths = new Int32Array(alphabetSize);
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- simpleCodeOrSkip = readFewBits(s, 2);
+ var /** number */ simpleCodeOrSkip = readFewBits(s, 2);
if (simpleCodeOrSkip == 1) {
- var /** !number */ maxBitsCounter = alphabetSize - 1;
- var /** !number */ maxBits = 0;
- var /** !Int32Array */ symbols = new Int32Array(4);
- var /** !number */ numSymbols = readFewBits(s, 2) + 1;
- while (maxBitsCounter != 0) {
- maxBitsCounter >>= 1;
- maxBits++;
- }
- for (var /** !number */ i = 0; i < numSymbols; i++) {
- if (s.bitOffset >= 16) {
- s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
- s.bitOffset -= 16;
- }
- symbols[i] = readFewBits(s, maxBits) % alphabetSize;
- codeLengths[symbols[i]] = 2;
- }
- codeLengths[symbols[0]] = 1;
- switch(numSymbols) {
- case 2:
- codeLengths[symbols[1]] = 1;
- break;
- case 4:
- if (readFewBits(s, 1) == 1) {
- codeLengths[symbols[2]] = 3;
- codeLengths[symbols[3]] = 3;
- } else {
- codeLengths[symbols[0]] = 2;
- }
- break;
- default:
- break;
- }
- ok = checkDupes(symbols, numSymbols);
+ return readSimpleHuffmanCode(alphabetSizeMax, alphabetSizeLimit, tableGroup, tableIdx, s);
} else {
- var /** !Int32Array */ codeLengthCodeLengths = new Int32Array(18);
- var /** !number */ space = 32;
- var /** !number */ numCodes = 0;
- for (var /** !number */ i = simpleCodeOrSkip; i < 18 && space > 0; i++) {
- var /** !number */ codeLenIdx = CODE_LENGTH_CODE_ORDER[i];
- if (s.bitOffset >= 16) {
- s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
- s.bitOffset -= 16;
- }
- var /** !number */ p = (s.accumulator32 >>> s.bitOffset) & 15;
- s.bitOffset += FIXED_TABLE[p] >> 16;
- var /** !number */ v = FIXED_TABLE[p] & 0xFFFF;
- codeLengthCodeLengths[codeLenIdx] = v;
- if (v != 0) {
- space -= (32 >> v);
- numCodes++;
- }
- }
- if (space != 0 && numCodes != 1) {
- ok = 0;
- }
- readHuffmanCodeLengths(codeLengthCodeLengths, alphabetSize, codeLengths, s);
- }
- if (ok == 0) {
- throw "Can't readHuffmanCode";
+ return readComplexHuffmanCode(alphabetSizeLimit, simpleCodeOrSkip, tableGroup, tableIdx, s);
}
- buildHuffmanTable(table, offset, 8, codeLengths, alphabetSize);
}
/**
- * @param {!number} contextMapSize
+ * @param {number} contextMapSize
* @param {!Int8Array} contextMap
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function decodeContextMap(contextMapSize, contextMap, s) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
- var /** !number */ numTrees = decodeVarLenUnsignedByte(s) + 1;
+ var /** number */ numTrees = decodeVarLenUnsignedByte(s) + 1;
if (numTrees == 1) {
contextMap.fill(0, 0, contextMapSize);
return numTrees;
@@ -439,14 +567,17 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ useRleForZeros = readFewBits(s, 1);
- var /** !number */ maxRunLengthPrefix = 0;
+ var /** number */ useRleForZeros = readFewBits(s, 1);
+ var /** number */ maxRunLengthPrefix = 0;
if (useRleForZeros != 0) {
maxRunLengthPrefix = readFewBits(s, 4) + 1;
}
- var /** !Int32Array */ table = new Int32Array(1080);
- readHuffmanCode(numTrees + maxRunLengthPrefix, table, 0, s);
- for (var /** !number */ i = 0; i < contextMapSize; ) {
+ var /** number */ alphabetSize = numTrees + maxRunLengthPrefix;
+ var /** number */ tableSize = MAX_HUFFMAN_TABLE_SIZE[(alphabetSize + 31) >> 5];
+ var /** !Int32Array */ table = new Int32Array(tableSize + 1);
+ var /** number */ tableIdx = table.length - 1;
+ readHuffmanCode(alphabetSize, alphabetSize, table, tableIdx, s);
+ for (var /** number */ i = 0; i < contextMapSize; ) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
@@ -454,7 +585,7 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ code = readSymbol(table, 0, s);
+ var /** number */ code = readSymbol(table, tableIdx, s);
if (code == 0) {
contextMap[i] = 0;
i++;
@@ -463,7 +594,7 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ reps = (1 << code) + readFewBits(s, code);
+ var /** number */ reps = (1 << code) + readFewBits(s, code);
while (reps != 0) {
if (i >= contextMapSize) {
throw "Corrupted context map";
@@ -488,19 +619,19 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @param {!number} treeType
- * @param {!number} numBlockTypes
- * @return {!number}
+ * @param {number} treeType
+ * @param {number} numBlockTypes
+ * @return {number}
*/
function decodeBlockTypeAndLength(s, treeType, numBlockTypes) {
var /** !Int32Array */ ringBuffers = s.rings;
- var /** !number */ offset = 4 + treeType * 2;
+ var /** number */ offset = 4 + treeType * 2;
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ blockType = readSymbol(s.blockTrees, treeType * 1080, s);
- var /** !number */ result = readBlockLength(s.blockTrees, (treeType + 3) * 1080, s);
+ var /** number */ blockType = readSymbol(s.blockTrees, 2 * treeType, s);
+ var /** number */ result = readBlockLength(s.blockTrees, 2 * treeType + 1, s);
if (blockType == 1) {
blockType = ringBuffers[offset + 1] + 1;
} else if (blockType == 0) {
@@ -521,11 +652,10 @@ function BrotliDecodeClosure() {
*/
function decodeLiteralBlockSwitch(s) {
s.literalBlockLength = decodeBlockTypeAndLength(s, 0, s.numLiteralBlockTypes);
- var /** !number */ literalBlockType = s.rings[5];
+ var /** number */ literalBlockType = s.rings[5];
s.contextMapSlice = literalBlockType << 6;
- s.literalTreeIndex = s.contextMap[s.contextMapSlice] & 0xFF;
- s.literalTree = s.hGroup0[s.literalTreeIndex];
- var /** !number */ contextMode = s.contextModes[literalBlockType];
+ s.literalTreeIdx = s.contextMap[s.contextMapSlice] & 0xFF;
+ var /** number */ contextMode = s.contextModes[literalBlockType];
s.contextLookupOffset1 = contextMode << 9;
s.contextLookupOffset2 = s.contextLookupOffset1 + 256;
}
@@ -535,7 +665,7 @@ function BrotliDecodeClosure() {
*/
function decodeCommandBlockSwitch(s) {
s.commandBlockLength = decodeBlockTypeAndLength(s, 1, s.numCommandBlockTypes);
- s.treeCommandOffset = s.hGroup1[s.rings[7]];
+ s.commandTreeIdx = s.rings[7];
}
/**
* @param {!State} s
@@ -550,9 +680,9 @@ function BrotliDecodeClosure() {
* @return {void}
*/
function maybeReallocateRingBuffer(s) {
- var /** !number */ newSize = s.maxRingBufferSize;
+ var /** number */ newSize = s.maxRingBufferSize;
if (newSize > s.expectedTotalSize) {
- var /** !number */ minimalNewSize = s.expectedTotalSize;
+ var /** number */ minimalNewSize = s.expectedTotalSize;
while ((newSize >> 1) > minimalNewSize) {
newSize >>= 1;
}
@@ -563,7 +693,7 @@ function BrotliDecodeClosure() {
if (newSize <= s.ringBufferSize) {
return;
}
- var /** !number */ ringBufferSizeWithSlack = newSize + 37;
+ var /** number */ ringBufferSizeWithSlack = newSize + 37;
var /** !Int8Array */ newBuffer = new Int8Array(ringBufferSizeWithSlack);
if (s.ringBuffer.length != 0) {
newBuffer.set(s.ringBuffer.subarray(0, 0 + s.ringBufferSize), 0);
@@ -577,13 +707,13 @@ function BrotliDecodeClosure() {
*/
function readNextMetablockHeader(s) {
if (s.inputEnd != 0) {
- s.nextRunningState = 9;
- s.runningState = 11;
+ s.nextRunningState = 10;
+ s.runningState = 12;
return;
}
- s.hGroup0 = new Int32Array(0);
- s.hGroup1 = new Int32Array(0);
- s.hGroup2 = new Int32Array(0);
+ s.literalTreeGroup = new Int32Array(0);
+ s.commandTreeGroup = new Int32Array(0);
+ s.distanceTreeGroup = new Int32Array(0);
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
@@ -593,9 +723,9 @@ function BrotliDecodeClosure() {
}
if ((s.isUncompressed != 0) || (s.isMetadata != 0)) {
jumpToByteBoundary(s);
- s.runningState = (s.isMetadata != 0) ? 4 : 5;
+ s.runningState = (s.isMetadata != 0) ? 5 : 6;
} else {
- s.runningState = 2;
+ s.runningState = 3;
}
if (s.isMetadata != 0) {
return;
@@ -610,17 +740,54 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @param {!number} treeType
- * @param {!number} numBlockTypes
- * @return {!number}
+ * @param {number} treeType
+ * @param {number} numBlockTypes
+ * @return {number}
*/
function readMetablockPartition(s, treeType, numBlockTypes) {
+ var /** number */ offset = s.blockTrees[2 * treeType];
if (numBlockTypes <= 1) {
+ s.blockTrees[2 * treeType + 1] = offset;
+ s.blockTrees[2 * treeType + 2] = offset;
return 1 << 28;
}
- readHuffmanCode(numBlockTypes + 2, s.blockTrees, treeType * 1080, s);
- readHuffmanCode(26, s.blockTrees, (treeType + 3) * 1080, s);
- return readBlockLength(s.blockTrees, (treeType + 3) * 1080, s);
+ var /** number */ blockTypeAlphabetSize = numBlockTypes + 2;
+ offset += readHuffmanCode(blockTypeAlphabetSize, blockTypeAlphabetSize, s.blockTrees, 2 * treeType, s);
+ s.blockTrees[2 * treeType + 1] = offset;
+ var /** number */ blockLengthAlphabetSize = 26;
+ offset += readHuffmanCode(blockLengthAlphabetSize, blockLengthAlphabetSize, s.blockTrees, 2 * treeType + 1, s);
+ s.blockTrees[2 * treeType + 2] = offset;
+ return readBlockLength(s.blockTrees, 2 * treeType + 1, s);
+ }
+ /**
+ * @param {!State} s
+ * @param {number} alphabetSizeLimit
+ * @return {void}
+ */
+ function calculateDistanceLut(s, alphabetSizeLimit) {
+ var /** !Int8Array */ distExtraBits = s.distExtraBits;
+ var /** !Int32Array */ distOffset = s.distOffset;
+ var /** number */ npostfix = s.distancePostfixBits;
+ var /** number */ ndirect = s.numDirectDistanceCodes;
+ var /** number */ postfix = 1 << npostfix;
+ var /** number */ bits = 1;
+ var /** number */ half = 0;
+ var /** number */ i = 16;
+ for (var /** number */ j = 0; j < ndirect; ++j) {
+ distExtraBits[i] = 0;
+ distOffset[i] = j + 1;
+ ++i;
+ }
+ while (i < alphabetSizeLimit) {
+ var /** number */ base = ndirect + ((((2 + half) << bits) - 4) << npostfix) + 1;
+ for (var /** number */ j = 0; j < postfix; ++j) {
+ distExtraBits[i] = bits;
+ distOffset[i] = base + j;
+ ++i;
+ }
+ bits = bits + half;
+ half = half ^ 1;
+ }
}
/**
* @param {!State} s
@@ -641,44 +808,49 @@ function BrotliDecodeClosure() {
s.bitOffset -= 16;
}
s.distancePostfixBits = readFewBits(s, 2);
- s.numDirectDistanceCodes = 16 + (readFewBits(s, 4) << s.distancePostfixBits);
+ s.numDirectDistanceCodes = readFewBits(s, 4) << s.distancePostfixBits;
s.distancePostfixMask = (1 << s.distancePostfixBits) - 1;
- var /** !number */ numDistanceCodes = s.numDirectDistanceCodes + (48 << s.distancePostfixBits);
s.contextModes = new Int8Array(s.numLiteralBlockTypes);
- for (var /** !number */ i = 0; i < s.numLiteralBlockTypes; ) {
- var /** !number */ limit = min(i + 96, s.numLiteralBlockTypes);
+ for (var /** number */ i = 0; i < s.numLiteralBlockTypes; ) {
+ var /** number */ limit = min(i + 96, s.numLiteralBlockTypes);
for (; i < limit; ++i) {
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- s.contextModes[i] = (readFewBits(s, 2));
+ s.contextModes[i] = readFewBits(s, 2);
}
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
}
s.contextMap = new Int8Array(s.numLiteralBlockTypes << 6);
- var /** !number */ numLiteralTrees = decodeContextMap(s.numLiteralBlockTypes << 6, s.contextMap, s);
+ var /** number */ numLiteralTrees = decodeContextMap(s.numLiteralBlockTypes << 6, s.contextMap, s);
s.trivialLiteralContext = 1;
- for (var /** !number */ j = 0; j < s.numLiteralBlockTypes << 6; j++) {
+ for (var /** number */ j = 0; j < s.numLiteralBlockTypes << 6; j++) {
if (s.contextMap[j] != j >> 6) {
s.trivialLiteralContext = 0;
break;
}
}
s.distContextMap = new Int8Array(s.numDistanceBlockTypes << 2);
- var /** !number */ numDistTrees = decodeContextMap(s.numDistanceBlockTypes << 2, s.distContextMap, s);
- s.hGroup0 = decodeHuffmanTreeGroup(256, numLiteralTrees, s);
- s.hGroup1 = decodeHuffmanTreeGroup(704, s.numCommandBlockTypes, s);
- s.hGroup2 = decodeHuffmanTreeGroup(numDistanceCodes, numDistTrees, s);
+ var /** number */ numDistTrees = decodeContextMap(s.numDistanceBlockTypes << 2, s.distContextMap, s);
+ s.literalTreeGroup = decodeHuffmanTreeGroup(256, 256, numLiteralTrees, s);
+ s.commandTreeGroup = decodeHuffmanTreeGroup(704, 704, s.numCommandBlockTypes, s);
+ var /** number */ distanceAlphabetSizeMax = calculateDistanceAlphabetSize(s.distancePostfixBits, s.numDirectDistanceCodes, 24);
+ var /** number */ distanceAlphabetSizeLimit = distanceAlphabetSizeMax;
+ if (s.isLargeWindow == 1) {
+ distanceAlphabetSizeMax = calculateDistanceAlphabetSize(s.distancePostfixBits, s.numDirectDistanceCodes, 62);
+ distanceAlphabetSizeLimit = calculateDistanceAlphabetLimit(0x7FFFFFFC, s.distancePostfixBits, s.numDirectDistanceCodes);
+ }
+ s.distanceTreeGroup = decodeHuffmanTreeGroup(distanceAlphabetSizeMax, distanceAlphabetSizeLimit, numDistTrees, s);
+ calculateDistanceLut(s, distanceAlphabetSizeLimit);
s.contextMapSlice = 0;
s.distContextMapSlice = 0;
- s.contextLookupOffset1 = (s.contextModes[0]) << 9;
+ s.contextLookupOffset1 = s.contextModes[0] * 512;
s.contextLookupOffset2 = s.contextLookupOffset1 + 256;
- s.literalTreeIndex = 0;
- s.literalTree = s.hGroup0[0];
- s.treeCommandOffset = s.hGroup1[0];
+ s.literalTreeIdx = 0;
+ s.commandTreeIdx = 0;
s.rings[4] = 1;
s.rings[5] = 0;
s.rings[6] = 1;
@@ -694,27 +866,27 @@ function BrotliDecodeClosure() {
var /** !Int8Array */ ringBuffer = s.ringBuffer;
if (s.metaBlockLength <= 0) {
reload(s);
- s.runningState = 1;
+ s.runningState = 2;
return;
}
- var /** !number */ chunkLength = min(s.ringBufferSize - s.pos, s.metaBlockLength);
+ var /** number */ chunkLength = min(s.ringBufferSize - s.pos, s.metaBlockLength);
copyBytes(s, ringBuffer, s.pos, chunkLength);
s.metaBlockLength -= chunkLength;
s.pos += chunkLength;
if (s.pos == s.ringBufferSize) {
- s.nextRunningState = 5;
- s.runningState = 11;
+ s.nextRunningState = 6;
+ s.runningState = 12;
return;
}
reload(s);
- s.runningState = 1;
+ s.runningState = 2;
}
/**
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function writeRingBuffer(s) {
- var /** !number */ toWrite = min(s.outputLength - s.outputUsed, s.ringBufferBytesReady - s.ringBufferBytesWritten);
+ var /** number */ toWrite = min(s.outputLength - s.outputUsed, s.ringBufferBytesReady - s.ringBufferBytesWritten);
if (toWrite != 0) {
s.output.set(s.ringBuffer.subarray(s.ringBufferBytesWritten, s.ringBufferBytesWritten + toWrite), s.outputOffset + s.outputUsed);
s.outputUsed += toWrite;
@@ -727,27 +899,28 @@ function BrotliDecodeClosure() {
}
}
/**
- * @param {!number} alphabetSize
- * @param {!number} n
+ * @param {number} alphabetSizeMax
+ * @param {number} alphabetSizeLimit
+ * @param {number} n
* @param {!State} s
* @return {!Int32Array}
*/
- function decodeHuffmanTreeGroup(alphabetSize, n, s) {
- var /** !Int32Array */ group = new Int32Array(n + (n * 1080));
- var /** !number */ next = n;
- for (var /** !number */ i = 0; i < n; i++) {
+ function decodeHuffmanTreeGroup(alphabetSizeMax, alphabetSizeLimit, n, s) {
+ var /** number */ maxTableSize = MAX_HUFFMAN_TABLE_SIZE[(alphabetSizeLimit + 31) >> 5];
+ var /** !Int32Array */ group = new Int32Array(n + n * maxTableSize);
+ var /** number */ next = n;
+ for (var /** number */ i = 0; i < n; ++i) {
group[i] = next;
- readHuffmanCode(alphabetSize, group, next, s);
- next += 1080;
+ next += readHuffmanCode(alphabetSizeMax, alphabetSizeLimit, group, i, s);
}
return group;
}
/**
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function calculateFence(s) {
- var /** !number */ result = s.ringBufferSize;
+ var /** number */ result = s.ringBufferSize;
if (s.isEager != 0) {
result = min(result, s.ringBufferBytesWritten + s.outputLength - s.outputUsed);
}
@@ -761,15 +934,24 @@ function BrotliDecodeClosure() {
if (s.runningState == 0) {
throw "Can't decompress until initialized";
}
- if (s.runningState == 10) {
+ if (s.runningState == 11) {
throw "Can't decompress after close";
}
- var /** !number */ fence = calculateFence(s);
- var /** !number */ ringBufferMask = s.ringBufferSize - 1;
+ if (s.runningState == 1) {
+ var /** number */ windowBits = decodeWindowBits(s);
+ if (windowBits == -1) {
+ throw "Invalid 'windowBits' code";
+ }
+ s.maxRingBufferSize = 1 << windowBits;
+ s.maxBackwardDistance = s.maxRingBufferSize - 16;
+ s.runningState = 2;
+ }
+ var /** number */ fence = calculateFence(s);
+ var /** number */ ringBufferMask = s.ringBufferSize - 1;
var /** !Int8Array */ ringBuffer = s.ringBuffer;
- while (s.runningState != 9) {
+ while (s.runningState != 10) {
switch(s.runningState) {
- case 1:
+ case 2:
if (s.metaBlockLength < 0) {
throw "Invalid metablock length";
}
@@ -778,12 +960,12 @@ function BrotliDecodeClosure() {
ringBufferMask = s.ringBufferSize - 1;
ringBuffer = s.ringBuffer;
continue;
- case 2:
- readMetablockHuffmanCodesAndContextMaps(s);
- s.runningState = 3;
case 3:
+ readMetablockHuffmanCodesAndContextMaps(s);
+ s.runningState = 4;
+ case 4:
if (s.metaBlockLength <= 0) {
- s.runningState = 1;
+ s.runningState = 2;
continue;
}
if (s.halfOffset > 2030) {
@@ -797,32 +979,26 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ cmdCode = readSymbol(s.hGroup1, s.treeCommandOffset, s);
- var /** !number */ rangeIdx = cmdCode >>> 6;
- s.distanceCode = 0;
- if (rangeIdx >= 2) {
- rangeIdx -= 2;
- s.distanceCode = -1;
- }
- var /** !number */ insertCode = INSERT_RANGE_LUT[rangeIdx] + ((cmdCode >>> 3) & 7);
+ var /** number */ cmdCode = readSymbol(s.commandTreeGroup, s.commandTreeIdx, s) << 2;
+ var /** number */ insertAndCopyExtraBits = CMD_LOOKUP[cmdCode];
+ var /** number */ insertLengthOffset = CMD_LOOKUP[cmdCode + 1];
+ var /** number */ copyLengthOffset = CMD_LOOKUP[cmdCode + 2];
+ s.distanceCode = CMD_LOOKUP[cmdCode + 3];
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ insertBits = INSERT_LENGTH_N_BITS[insertCode];
- var /** !number */ insertExtra = ((insertBits <= 16) ? readFewBits(s, insertBits) : readManyBits(s, insertBits));
- s.insertLength = INSERT_LENGTH_OFFSET[insertCode] + insertExtra;
- var /** !number */ copyCode = COPY_RANGE_LUT[rangeIdx] + (cmdCode & 7);
+ var /** number */ extraBits = insertAndCopyExtraBits & 0xFF;
+ s.insertLength = insertLengthOffset + ((extraBits <= 16) ? readFewBits(s, extraBits) : readManyBits(s, extraBits));
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- var /** !number */ copyBits = COPY_LENGTH_N_BITS[copyCode];
- var /** !number */ copyExtra = ((copyBits <= 16) ? readFewBits(s, copyBits) : readManyBits(s, copyBits));
- s.copyLength = COPY_LENGTH_OFFSET[copyCode] + copyExtra;
+ var /** number */ extraBits = insertAndCopyExtraBits >> 8;
+ s.copyLength = copyLengthOffset + ((extraBits <= 16) ? readFewBits(s, extraBits) : readManyBits(s, extraBits));
s.j = 0;
- s.runningState = 6;
- case 6:
+ s.runningState = 7;
+ case 7:
if (s.trivialLiteralContext != 0) {
while (s.j < s.insertLength) {
if (s.halfOffset > 2030) {
@@ -836,18 +1012,18 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- ringBuffer[s.pos] = readSymbol(s.hGroup0, s.literalTree, s);
+ ringBuffer[s.pos] = readSymbol(s.literalTreeGroup, s.literalTreeIdx, s);
s.pos++;
s.j++;
if (s.pos >= fence) {
- s.nextRunningState = 6;
- s.runningState = 11;
+ s.nextRunningState = 7;
+ s.runningState = 12;
break;
}
}
} else {
- var /** !number */ prevByte1 = ringBuffer[(s.pos - 1) & ringBufferMask] & 0xFF;
- var /** !number */ prevByte2 = ringBuffer[(s.pos - 2) & ringBufferMask] & 0xFF;
+ var /** number */ prevByte1 = ringBuffer[(s.pos - 1) & ringBufferMask] & 0xFF;
+ var /** number */ prevByte2 = ringBuffer[(s.pos - 2) & ringBufferMask] & 0xFF;
while (s.j < s.insertLength) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
@@ -855,33 +1031,37 @@ function BrotliDecodeClosure() {
if (s.literalBlockLength == 0) {
decodeLiteralBlockSwitch(s);
}
- var /** !number */ literalTreeIndex = s.contextMap[s.contextMapSlice + (LOOKUP[s.contextLookupOffset1 + prevByte1] | LOOKUP[s.contextLookupOffset2 + prevByte2])] & 0xFF;
+ var /** number */ literalContext = LOOKUP[s.contextLookupOffset1 + prevByte1] | LOOKUP[s.contextLookupOffset2 + prevByte2];
+ var /** number */ literalTreeIdx = s.contextMap[s.contextMapSlice + literalContext] & 0xFF;
s.literalBlockLength--;
prevByte2 = prevByte1;
if (s.bitOffset >= 16) {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- prevByte1 = readSymbol(s.hGroup0, s.hGroup0[literalTreeIndex], s);
+ prevByte1 = readSymbol(s.literalTreeGroup, literalTreeIdx, s);
ringBuffer[s.pos] = prevByte1;
s.pos++;
s.j++;
if (s.pos >= fence) {
- s.nextRunningState = 6;
- s.runningState = 11;
+ s.nextRunningState = 7;
+ s.runningState = 12;
break;
}
}
}
- if (s.runningState != 6) {
+ if (s.runningState != 7) {
continue;
}
s.metaBlockLength -= s.insertLength;
if (s.metaBlockLength <= 0) {
- s.runningState = 3;
+ s.runningState = 4;
continue;
}
- if (s.distanceCode < 0) {
+ var /** number */ distanceCode = s.distanceCode;
+ if (distanceCode < 0) {
+ s.distance = s.rings[s.distRbIdx];
+ } else {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
}
@@ -893,52 +1073,56 @@ function BrotliDecodeClosure() {
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
}
- s.distanceCode = readSymbol(s.hGroup2, s.hGroup2[s.distContextMap[s.distContextMapSlice + (s.copyLength > 4 ? 3 : s.copyLength - 2)] & 0xFF], s);
- if (s.distanceCode >= s.numDirectDistanceCodes) {
- s.distanceCode -= s.numDirectDistanceCodes;
- var /** !number */ postfix = s.distanceCode & s.distancePostfixMask;
- s.distanceCode >>>= s.distancePostfixBits;
- var /** !number */ n = (s.distanceCode >>> 1) + 1;
- var /** !number */ offset = ((2 + (s.distanceCode & 1)) << n) - 4;
- if (s.bitOffset >= 16) {
- s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
- s.bitOffset -= 16;
+ var /** number */ distTreeIdx = s.distContextMap[s.distContextMapSlice + distanceCode] & 0xFF;
+ distanceCode = readSymbol(s.distanceTreeGroup, distTreeIdx, s);
+ if (distanceCode < 16) {
+ var /** number */ index = (s.distRbIdx + DISTANCE_SHORT_CODE_INDEX_OFFSET[distanceCode]) & 0x3;
+ s.distance = s.rings[index] + DISTANCE_SHORT_CODE_VALUE_OFFSET[distanceCode];
+ if (s.distance < 0) {
+ throw "Negative distance";
}
- var /** !number */ distanceExtra = ((n <= 16) ? readFewBits(s, n) : readManyBits(s, n));
- s.distanceCode = s.numDirectDistanceCodes + postfix + ((offset + distanceExtra) << s.distancePostfixBits);
+ } else {
+ var /** number */ extraBits = s.distExtraBits[distanceCode];
+ var /** number */ bits;
+ if (s.bitOffset + extraBits <= 32) {
+ bits = readFewBits(s, extraBits);
+ } else {
+ if (s.bitOffset >= 16) {
+ s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
+ s.bitOffset -= 16;
+ }
+ bits = ((extraBits <= 16) ? readFewBits(s, extraBits) : readManyBits(s, extraBits));
+ }
+ s.distance = s.distOffset[distanceCode] + (bits << s.distancePostfixBits);
}
}
- s.distance = translateShortCodes(s.distanceCode, s.rings, s.distRbIdx);
- if (s.distance < 0) {
- throw "Negative distance";
- }
if (s.maxDistance != s.maxBackwardDistance && s.pos < s.maxBackwardDistance) {
s.maxDistance = s.pos;
} else {
s.maxDistance = s.maxBackwardDistance;
}
if (s.distance > s.maxDistance) {
- s.runningState = 8;
+ s.runningState = 9;
continue;
}
- if (s.distanceCode > 0) {
- s.rings[s.distRbIdx & 3] = s.distance;
- s.distRbIdx++;
+ if (distanceCode > 0) {
+ s.distRbIdx = (s.distRbIdx + 1) & 0x3;
+ s.rings[s.distRbIdx] = s.distance;
}
if (s.copyLength > s.metaBlockLength) {
throw "Invalid backward reference";
}
s.j = 0;
- s.runningState = 7;
- case 7:
- var /** !number */ src = (s.pos - s.distance) & ringBufferMask;
- var /** !number */ dst = s.pos;
- var /** !number */ copyLength = s.copyLength - s.j;
- var /** !number */ srcEnd = src + copyLength;
- var /** !number */ dstEnd = dst + copyLength;
+ s.runningState = 8;
+ case 8:
+ var /** number */ src = (s.pos - s.distance) & ringBufferMask;
+ var /** number */ dst = s.pos;
+ var /** number */ copyLength = s.copyLength - s.j;
+ var /** number */ srcEnd = src + copyLength;
+ var /** number */ dstEnd = dst + copyLength;
if ((srcEnd < ringBufferMask) && (dstEnd < ringBufferMask)) {
if (copyLength < 12 || (srcEnd > dst && dstEnd > src)) {
- for (var /** !number */ k = 0; k < copyLength; k += 4) {
+ for (var /** number */ k = 0; k < copyLength; k += 4) {
ringBuffer[dst++] = ringBuffer[src++];
ringBuffer[dst++] = ringBuffer[src++];
ringBuffer[dst++] = ringBuffer[src++];
@@ -957,32 +1141,35 @@ function BrotliDecodeClosure() {
s.pos++;
s.j++;
if (s.pos >= fence) {
- s.nextRunningState = 7;
- s.runningState = 11;
+ s.nextRunningState = 8;
+ s.runningState = 12;
break;
}
}
}
- if (s.runningState == 7) {
- s.runningState = 3;
+ if (s.runningState == 8) {
+ s.runningState = 4;
}
continue;
- case 8:
+ case 9:
+ if (s.distance > 0x7FFFFFFC) {
+ throw "Invalid backward reference";
+ }
if (s.copyLength >= 4 && s.copyLength <= 24) {
- var /** !number */ offset = DICTIONARY_OFFSETS_BY_LENGTH[s.copyLength];
- var /** !number */ wordId = s.distance - s.maxDistance - 1;
- var /** !number */ shift = DICTIONARY_SIZE_BITS_BY_LENGTH[s.copyLength];
- var /** !number */ mask = (1 << shift) - 1;
- var /** !number */ wordIdx = wordId & mask;
- var /** !number */ transformIdx = wordId >>> shift;
+ var /** number */ offset = DICTIONARY_OFFSETS_BY_LENGTH[s.copyLength];
+ var /** number */ wordId = s.distance - s.maxDistance - 1;
+ var /** number */ shift = DICTIONARY_SIZE_BITS_BY_LENGTH[s.copyLength];
+ var /** number */ mask = (1 << shift) - 1;
+ var /** number */ wordIdx = wordId & mask;
+ var /** number */ transformIdx = wordId >>> shift;
offset += wordIdx * s.copyLength;
if (transformIdx < 121) {
- var /** !number */ len = transformDictionaryWord(ringBuffer, s.pos, DICTIONARY_DATA, offset, s.copyLength, transformIdx);
+ var /** number */ len = transformDictionaryWord(ringBuffer, s.pos, DICTIONARY_DATA, offset, s.copyLength, RFC_TRANSFORMS, transformIdx);
s.pos += len;
s.metaBlockLength -= len;
if (s.pos >= fence) {
- s.nextRunningState = 3;
- s.runningState = 11;
+ s.nextRunningState = 4;
+ s.runningState = 12;
continue;
}
} else {
@@ -991,9 +1178,9 @@ function BrotliDecodeClosure() {
} else {
throw "Invalid backward reference";
}
- s.runningState = 3;
+ s.runningState = 4;
continue;
- case 4:
+ case 5:
while (s.metaBlockLength > 0) {
if (s.halfOffset > 2030) {
doReadMoreInput(s);
@@ -1005,15 +1192,15 @@ function BrotliDecodeClosure() {
readFewBits(s, 8);
s.metaBlockLength--;
}
- s.runningState = 1;
+ s.runningState = 2;
continue;
- case 5:
+ case 6:
copyUncompressedData(s);
continue;
- case 11:
- s.ringBufferBytesReady = min(s.pos, s.ringBufferSize);
- s.runningState = 12;
case 12:
+ s.ringBufferBytesReady = min(s.pos, s.ringBufferSize);
+ s.runningState = 13;
+ case 13:
if (writeRingBuffer(s) == 0) {
return;
}
@@ -1033,7 +1220,7 @@ function BrotliDecodeClosure() {
throw "Unexpected state " + s.runningState;
}
}
- if (s.runningState == 9) {
+ if (s.runningState == 10) {
if (s.metaBlockLength < 0) {
throw "Invalid metablock length";
}
@@ -1042,9 +1229,32 @@ function BrotliDecodeClosure() {
}
}
- var TRANSFORMS = new Int32Array(363);
- var PREFIX_SUFFIX = new Int8Array(217);
- var PREFIX_SUFFIX_HEADS = new Int32Array(51);
+ /**
+ * @constructor
+ * @param {number} numTransforms
+ * @param {number} prefixSuffixLen
+ * @param {number} prefixSuffixCount
+ * @struct
+ */
+ function Transforms(numTransforms, prefixSuffixLen, prefixSuffixCount) {
+ /** @type {!number} */
+ this.numTransforms = 0;
+ /** @type {!Int32Array} */
+ this.triplets = new Int32Array(0);
+ /** @type {!Int8Array} */
+ this.prefixSuffixStorage = new Int8Array(0);
+ /** @type {!Int32Array} */
+ this.prefixSuffixHeads = new Int32Array(0);
+ /** @type {!Int16Array} */
+ this.params = new Int16Array(0);
+ this.numTransforms = numTransforms;
+ this.triplets = new Int32Array(numTransforms * 3);
+ this.params = new Int16Array(numTransforms);
+ this.prefixSuffixStorage = new Int8Array(prefixSuffixLen);
+ this.prefixSuffixHeads = new Int32Array(prefixSuffixCount + 1);
+ }
+
+ var RFC_TRANSFORMS = new Transforms(121, 167, 50);
/**
* @param {!Int8Array} prefixSuffix
* @param {!Int32Array} prefixSuffixHeads
@@ -1054,67 +1264,83 @@ function BrotliDecodeClosure() {
* @return {void}
*/
function unpackTransforms(prefixSuffix, prefixSuffixHeads, transforms, prefixSuffixSrc, transformsSrc) {
- var /** !number */ n = prefixSuffixSrc.length;
- var /** !number */ index = 1;
- for (var /** !number */ i = 0; i < n; ++i) {
- var /** !number */ c = prefixSuffixSrc.charCodeAt(i);
- prefixSuffix[i] = c;
+ var /** number */ n = prefixSuffixSrc.length;
+ var /** number */ index = 1;
+ var /** number */ j = 0;
+ for (var /** number */ i = 0; i < n; ++i) {
+ var /** number */ c = prefixSuffixSrc.charCodeAt(i);
if (c == 35) {
- prefixSuffixHeads[index++] = i + 1;
- prefixSuffix[i] = 0;
+ prefixSuffixHeads[index++] = j;
+ } else {
+ prefixSuffix[j++] = c;
}
}
- for (var /** !number */ i = 0; i < 363; ++i) {
+ for (var /** number */ i = 0; i < 363; ++i) {
transforms[i] = transformsSrc.charCodeAt(i) - 32;
}
}
{
- unpackTransforms(PREFIX_SUFFIX, PREFIX_SUFFIX_HEADS, TRANSFORMS, "# #s #, #e #.# the #.com/#\u00C2\u00A0# of # and # in # to #\"#\">#\n#]# for # a # that #. # with #'# from # by #. The # on # as # is #ing #\n\t#:#ed #(# at #ly #=\"# of the #. This #,# not #er #al #='#ful #ive #less #est #ize #ous #", " !! ! , *! &! \" ! ) * * - ! # ! #!*! + ,$ ! - % . / # 0 1 . \" 2 3!* 4% ! # / 5 6 7 8 0 1 & $ 9 + : ; < ' != > ?! 4 @ 4 2 & A *# ( B C& ) % ) !*# *-% A +! *. D! %' & E *6 F G% ! *A *% H! D I!+! J!+ K +- *4! A L!*4 M N +6 O!*% +.! K *G P +%( ! G *D +D Q +# *K!*G!+D!+# +G +A +4!+% +K!+4!*D!+K!*K");
+ unpackTransforms(RFC_TRANSFORMS.prefixSuffixStorage, RFC_TRANSFORMS.prefixSuffixHeads, RFC_TRANSFORMS.triplets, "# #s #, #e #.# the #.com/#\u00C2\u00A0# of # and # in # to #\"#\">#\n#]# for # a # that #. # with #'# from # by #. The # on # as # is #ing #\n\t#:#ed #(# at #ly #=\"# of the #. This #,# not #er #al #='#ful #ive #less #est #ize #ous #", " !! ! , *! &! \" ! ) * * - ! # ! #!*! + ,$ ! - % . / # 0 1 . \" 2 3!* 4% ! # / 5 6 7 8 0 1 & $ 9 + : ; < ' != > ?! 4 @ 4 2 & A *# ( B C& ) % ) !*# *-% A +! *. D! %' & E *6 F G% ! *A *% H! D I!+! J!+ K +- *4! A L!*4 M N +6 O!*% +.! K *G P +%( ! G *D +D Q +# *K!*G!+D!+# +G +A +4!+% +K!+4!*D!+K!*K");
}
/**
* @param {!Int8Array} dst
- * @param {!number} dstOffset
- * @param {!Int8Array} data
- * @param {!number} wordOffset
- * @param {!number} len
- * @param {!number} transformIndex
- * @return {!number}
+ * @param {number} dstOffset
+ * @param {!Int8Array} src
+ * @param {number} srcOffset
+ * @param {number} len
+ * @param {!Transforms} transforms
+ * @param {number} transformIndex
+ * @return {number}
*/
- function transformDictionaryWord(dst, dstOffset, data, wordOffset, len, transformIndex) {
- var /** !number */ offset = dstOffset;
- var /** !number */ transformOffset = 3 * transformIndex;
- var /** !number */ transformPrefix = PREFIX_SUFFIX_HEADS[TRANSFORMS[transformOffset]];
- var /** !number */ transformType = TRANSFORMS[transformOffset + 1];
- var /** !number */ transformSuffix = PREFIX_SUFFIX_HEADS[TRANSFORMS[transformOffset + 2]];
- while (PREFIX_SUFFIX[transformPrefix] != 0) {
- dst[offset++] = PREFIX_SUFFIX[transformPrefix++];
+ function transformDictionaryWord(dst, dstOffset, src, srcOffset, len, transforms, transformIndex) {
+ var /** number */ offset = dstOffset;
+ var /** !Int32Array */ triplets = transforms.triplets;
+ var /** !Int8Array */ prefixSuffixStorage = transforms.prefixSuffixStorage;
+ var /** !Int32Array */ prefixSuffixHeads = transforms.prefixSuffixHeads;
+ var /** number */ transformOffset = 3 * transformIndex;
+ var /** number */ prefixIdx = triplets[transformOffset];
+ var /** number */ transformType = triplets[transformOffset + 1];
+ var /** number */ suffixIdx = triplets[transformOffset + 2];
+ var /** number */ prefix = prefixSuffixHeads[prefixIdx];
+ var /** number */ prefixEnd = prefixSuffixHeads[prefixIdx + 1];
+ var /** number */ suffix = prefixSuffixHeads[suffixIdx];
+ var /** number */ suffixEnd = prefixSuffixHeads[suffixIdx + 1];
+ var /** number */ omitFirst = transformType - 11;
+ var /** number */ omitLast = transformType - 0;
+ if (omitFirst < 1 || omitFirst > 9) {
+ omitFirst = 0;
+ }
+ if (omitLast < 1 || omitLast > 9) {
+ omitLast = 0;
+ }
+ while (prefix != prefixEnd) {
+ dst[offset++] = prefixSuffixStorage[prefix++];
}
- var /** !number */ omitFirst = transformType >= 12 ? (transformType - 11) : 0;
if (omitFirst > len) {
omitFirst = len;
}
- wordOffset += omitFirst;
+ srcOffset += omitFirst;
len -= omitFirst;
- len -= transformType <= 9 ? transformType : 0;
- var /** !number */ i = len;
+ len -= omitLast;
+ var /** number */ i = len;
while (i > 0) {
- dst[offset++] = data[wordOffset++];
+ dst[offset++] = src[srcOffset++];
i--;
}
- if (transformType == 11 || transformType == 10) {
- var /** !number */ uppercaseOffset = offset - len;
+ if (transformType == 10 || transformType == 11) {
+ var /** number */ uppercaseOffset = offset - len;
if (transformType == 10) {
len = 1;
}
while (len > 0) {
- var /** !number */ tmp = dst[uppercaseOffset] & 0xFF;
- if (tmp < 0xc0) {
- if (tmp >= 97 && tmp <= 122) {
+ var /** number */ c0 = dst[uppercaseOffset] & 0xFF;
+ if (c0 < 0xC0) {
+ if (c0 >= 97 && c0 <= 122) {
dst[uppercaseOffset] ^= 32;
}
uppercaseOffset += 1;
len -= 1;
- } else if (tmp < 0xe0) {
+ } else if (c0 < 0xE0) {
dst[uppercaseOffset + 1] ^= 32;
uppercaseOffset += 2;
len -= 2;
@@ -1124,20 +1350,74 @@ function BrotliDecodeClosure() {
len -= 3;
}
}
+ } else if (transformType == 21 || transformType == 22) {
+ var /** number */ shiftOffset = offset - len;
+ var /** number */ param = transforms.params[transformIndex];
+ var /** number */ scalar = (param & 0x7FFF) + (0x1000000 - (param & 0x8000));
+ while (len > 0) {
+ var /** number */ step = 1;
+ var /** number */ c0 = dst[shiftOffset] & 0xFF;
+ if (c0 < 0x80) {
+ scalar += c0;
+ dst[shiftOffset] = (scalar & 0x7F);
+ } else if (c0 < 0xC0) {
+ } else if (c0 < 0xE0) {
+ if (len >= 2) {
+ var /** number */ c1 = dst[shiftOffset + 1];
+ scalar += (c1 & 0x3F) | ((c0 & 0x1F) << 6);
+ dst[shiftOffset] = (0xC0 | ((scalar >> 6) & 0x1F));
+ dst[shiftOffset + 1] = ((c1 & 0xC0) | (scalar & 0x3F));
+ step = 2;
+ } else {
+ step = len;
+ }
+ } else if (c0 < 0xF0) {
+ if (len >= 3) {
+ var /** number */ c1 = dst[shiftOffset + 1];
+ var /** number */ c2 = dst[shiftOffset + 2];
+ scalar += (c2 & 0x3F) | ((c1 & 0x3F) << 6) | ((c0 & 0x0F) << 12);
+ dst[shiftOffset] = (0xE0 | ((scalar >> 12) & 0x0F));
+ dst[shiftOffset + 1] = ((c1 & 0xC0) | ((scalar >> 6) & 0x3F));
+ dst[shiftOffset + 2] = ((c2 & 0xC0) | (scalar & 0x3F));
+ step = 3;
+ } else {
+ step = len;
+ }
+ } else if (c0 < 0xF8) {
+ if (len >= 4) {
+ var /** number */ c1 = dst[shiftOffset + 1];
+ var /** number */ c2 = dst[shiftOffset + 2];
+ var /** number */ c3 = dst[shiftOffset + 3];
+ scalar += (c3 & 0x3F) | ((c2 & 0x3F) << 6) | ((c1 & 0x3F) << 12) | ((c0 & 0x07) << 18);
+ dst[shiftOffset] = (0xF0 | ((scalar >> 18) & 0x07));
+ dst[shiftOffset + 1] = ((c1 & 0xC0) | ((scalar >> 12) & 0x3F));
+ dst[shiftOffset + 2] = ((c2 & 0xC0) | ((scalar >> 6) & 0x3F));
+ dst[shiftOffset + 3] = ((c3 & 0xC0) | (scalar & 0x3F));
+ step = 4;
+ } else {
+ step = len;
+ }
+ }
+ shiftOffset += step;
+ len -= step;
+ if (transformType == 21) {
+ len = 0;
+ }
+ }
}
- while (PREFIX_SUFFIX[transformSuffix] != 0) {
- dst[offset++] = PREFIX_SUFFIX[transformSuffix++];
+ while (suffix != suffixEnd) {
+ dst[offset++] = prefixSuffixStorage[suffix++];
}
return offset - dstOffset;
}
/**
- * @param {!number} key
- * @param {!number} len
- * @return {!number}
+ * @param {number} key
+ * @param {number} len
+ * @return {number}
*/
function getNextKey(key, len) {
- var /** !number */ step = 1 << (len - 1);
+ var /** number */ step = 1 << (len - 1);
while ((key & step) != 0) {
step >>= 1;
}
@@ -1145,10 +1425,10 @@ function BrotliDecodeClosure() {
}
/**
* @param {!Int32Array} table
- * @param {!number} offset
- * @param {!number} step
- * @param {!number} end
- * @param {!number} item
+ * @param {number} offset
+ * @param {number} step
+ * @param {number} end
+ * @param {number} item
* @return {void}
*/
function replicateValue(table, offset, step, end, item) {
@@ -1159,12 +1439,12 @@ function BrotliDecodeClosure() {
}
/**
* @param {!Int32Array} count
- * @param {!number} len
- * @param {!number} rootBits
- * @return {!number}
+ * @param {number} len
+ * @param {number} rootBits
+ * @return {number}
*/
function nextTableBitSize(count, len, rootBits) {
- var /** !number */ left = 1 << (len - rootBits);
+ var /** number */ left = 1 << (len - rootBits);
while (len < 15) {
left -= count[len];
if (left <= 0) {
@@ -1176,24 +1456,25 @@ function BrotliDecodeClosure() {
return len - rootBits;
}
/**
- * @param {!Int32Array} rootTable
- * @param {!number} tableOffset
- * @param {!number} rootBits
+ * @param {!Int32Array} tableGroup
+ * @param {number} tableIdx
+ * @param {number} rootBits
* @param {!Int32Array} codeLengths
- * @param {!number} codeLengthsSize
- * @return {void}
+ * @param {number} codeLengthsSize
+ * @return {number}
*/
- function buildHuffmanTable(rootTable, tableOffset, rootBits, codeLengths, codeLengthsSize) {
- var /** !number */ key;
+ function buildHuffmanTable(tableGroup, tableIdx, rootBits, codeLengths, codeLengthsSize) {
+ var /** number */ tableOffset = tableGroup[tableIdx];
+ var /** number */ key;
var /** !Int32Array */ sorted = new Int32Array(codeLengthsSize);
var /** !Int32Array */ count = new Int32Array(16);
var /** !Int32Array */ offset = new Int32Array(16);
- var /** !number */ symbol;
+ var /** number */ symbol;
for (symbol = 0; symbol < codeLengthsSize; symbol++) {
count[codeLengths[symbol]]++;
}
offset[1] = 0;
- for (var /** !number */ len = 1; len < 15; len++) {
+ for (var /** number */ len = 1; len < 15; len++) {
offset[len + 1] = offset[len] + count[len];
}
for (symbol = 0; symbol < codeLengthsSize; symbol++) {
@@ -1201,27 +1482,27 @@ function BrotliDecodeClosure() {
sorted[offset[codeLengths[symbol]]++] = symbol;
}
}
- var /** !number */ tableBits = rootBits;
- var /** !number */ tableSize = 1 << tableBits;
- var /** !number */ totalSize = tableSize;
+ var /** number */ tableBits = rootBits;
+ var /** number */ tableSize = 1 << tableBits;
+ var /** number */ totalSize = tableSize;
if (offset[15] == 1) {
for (key = 0; key < totalSize; key++) {
- rootTable[tableOffset + key] = sorted[0];
+ tableGroup[tableOffset + key] = sorted[0];
}
- return;
+ return totalSize;
}
key = 0;
symbol = 0;
- for (var /** !number */ len = 1, step = 2; len <= rootBits; len++, step <<= 1) {
+ for (var /** number */ len = 1, step = 2; len <= rootBits; len++, step <<= 1) {
for (; count[len] > 0; count[len]--) {
- replicateValue(rootTable, tableOffset + key, step, tableSize, len << 16 | sorted[symbol++]);
+ replicateValue(tableGroup, tableOffset + key, step, tableSize, len << 16 | sorted[symbol++]);
key = getNextKey(key, len);
}
}
- var /** !number */ mask = totalSize - 1;
- var /** !number */ low = -1;
- var /** !number */ currentOffset = tableOffset;
- for (var /** !number */ len = rootBits + 1, step = 2; len <= 15; len++, step <<= 1) {
+ var /** number */ mask = totalSize - 1;
+ var /** number */ low = -1;
+ var /** number */ currentOffset = tableOffset;
+ for (var /** number */ len = rootBits + 1, step = 2; len <= 15; len++, step <<= 1) {
for (; count[len] > 0; count[len]--) {
if ((key & mask) != low) {
currentOffset += tableSize;
@@ -1229,12 +1510,13 @@ function BrotliDecodeClosure() {
tableSize = 1 << tableBits;
totalSize += tableSize;
low = key & mask;
- rootTable[tableOffset + low] = (tableBits + rootBits) << 16 | (currentOffset - tableOffset - low);
+ tableGroup[tableOffset + low] = (tableBits + rootBits) << 16 | (currentOffset - tableOffset - low);
}
- replicateValue(rootTable, currentOffset + (key >> rootBits), step, tableSize, (len - rootBits) << 16 | sorted[symbol++]);
+ replicateValue(tableGroup, currentOffset + (key >> rootBits), step, tableSize, (len - rootBits) << 16 | sorted[symbol++]);
key = getNextKey(key, len);
}
}
+ return totalSize;
}
/**
@@ -1248,13 +1530,13 @@ function BrotliDecodeClosure() {
}
throw "No more input";
}
- var /** !number */ readOffset = s.halfOffset << 1;
- var /** !number */ bytesInBuffer = 4096 - readOffset;
+ var /** number */ readOffset = s.halfOffset << 1;
+ var /** number */ bytesInBuffer = 4096 - readOffset;
s.byteBuffer.copyWithin(0, readOffset, 4096);
s.halfOffset = 0;
while (bytesInBuffer < 4096) {
- var /** !number */ spaceLeft = 4096 - bytesInBuffer;
- var /** !number */ len = readInput(s.input, s.byteBuffer, bytesInBuffer, spaceLeft);
+ var /** number */ spaceLeft = 4096 - bytesInBuffer;
+ var /** number */ len = readInput(s.input, s.byteBuffer, bytesInBuffer, spaceLeft);
if (len <= 0) {
s.endOfStreamReached = 1;
s.tailBytes = bytesInBuffer;
@@ -1267,14 +1549,14 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @param {!number} endOfStream
+ * @param {number} endOfStream
* @return {void}
*/
function checkHealth(s, endOfStream) {
if (s.endOfStreamReached == 0) {
return;
}
- var /** !number */ byteOffset = (s.halfOffset << 1) + ((s.bitOffset + 7) >> 3) - 4;
+ var /** number */ byteOffset = (s.halfOffset << 1) + ((s.bitOffset + 7) >> 3) - 4;
if (byteOffset > s.tailBytes) {
throw "Read after end";
}
@@ -1284,21 +1566,30 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @param {!number} n
- * @return {!number}
+ * @return {void}
+ */
+ function assertAccumulatorHealthy(s) {
+ if (s.bitOffset > 32) {
+ throw "Accumulator underloaded: " + s.bitOffset;
+ }
+ }
+ /**
+ * @param {!State} s
+ * @param {number} n
+ * @return {number}
*/
function readFewBits(s, n) {
- var /** !number */ val = (s.accumulator32 >>> s.bitOffset) & ((1 << n) - 1);
+ var /** number */ val = (s.accumulator32 >>> s.bitOffset) & ((1 << n) - 1);
s.bitOffset += n;
return val;
}
/**
* @param {!State} s
- * @param {!number} n
- * @return {!number}
+ * @param {number} n
+ * @return {number}
*/
function readManyBits(s, n) {
- var /** !number */ low = readFewBits(s, 16);
+ var /** number */ low = readFewBits(s, 16);
s.accumulator32 = (s.shortBuffer[s.halfOffset++] << 16) | (s.accumulator32 >>> 16);
s.bitOffset -= 16;
return low | (readFewBits(s, n - 16) << 16);
@@ -1344,9 +1635,9 @@ function BrotliDecodeClosure() {
* @return {void}
*/
function jumpToByteBoundary(s) {
- var /** !number */ padding = (32 - s.bitOffset) & 7;
+ var /** number */ padding = (32 - s.bitOffset) & 7;
if (padding != 0) {
- var /** !number */ paddingBits = readFewBits(s, padding);
+ var /** number */ paddingBits = readFewBits(s, padding);
if (paddingBits != 0) {
throw "Corrupted padding bits";
}
@@ -1354,10 +1645,10 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @return {!number}
+ * @return {number}
*/
function halfAvailable(s) {
- var /** !number */ limit = 2048;
+ var /** number */ limit = 2048;
if (s.endOfStreamReached != 0) {
limit = (s.tailBytes + 1) >> 1;
}
@@ -1366,8 +1657,8 @@ function BrotliDecodeClosure() {
/**
* @param {!State} s
* @param {!Int8Array} data
- * @param {!number} offset
- * @param {!number} length
+ * @param {number} offset
+ * @param {number} length
* @return {void}
*/
function copyBytes(s, data, offset, length) {
@@ -1382,10 +1673,10 @@ function BrotliDecodeClosure() {
if (length == 0) {
return;
}
- var /** !number */ copyNibbles = min(halfAvailable(s), length >> 1);
+ var /** number */ copyNibbles = min(halfAvailable(s), length >> 1);
if (copyNibbles > 0) {
- var /** !number */ readOffset = s.halfOffset << 1;
- var /** !number */ delta = copyNibbles << 1;
+ var /** number */ readOffset = s.halfOffset << 1;
+ var /** number */ delta = copyNibbles << 1;
data.set(s.byteBuffer.subarray(readOffset, readOffset + delta), offset);
offset += delta;
length -= delta;
@@ -1408,7 +1699,7 @@ function BrotliDecodeClosure() {
return;
}
while (length > 0) {
- var /** !number */ len = readInput(s.input, data, offset, length);
+ var /** number */ len = readInput(s.input, data, offset, length);
if (len == -1) {
throw "Unexpected end of input";
}
@@ -1418,14 +1709,14 @@ function BrotliDecodeClosure() {
}
/**
* @param {!State} s
- * @param {!number} byteLen
+ * @param {number} byteLen
* @return {void}
*/
function bytesToNibbles(s, byteLen) {
var /** !Int8Array */ byteBuffer = s.byteBuffer;
- var /** !number */ halfLen = byteLen >> 1;
+ var /** number */ halfLen = byteLen >> 1;
var /** !Int16Array */ shortBuffer = s.shortBuffer;
- for (var /** !number */ i = 0; i < halfLen; ++i) {
+ for (var /** number */ i = 0; i < halfLen; ++i) {
shortBuffer[i] = ((byteBuffer[i * 2] & 0xFF) | ((byteBuffer[(i * 2) + 1] & 0xFF) << 8));
}
}
@@ -1438,33 +1729,33 @@ function BrotliDecodeClosure() {
* @return {void}
*/
function unpackLookupTable(lookup, map, rle) {
- for (var /** !number */ i = 0; i < 256; ++i) {
+ for (var /** number */ i = 0; i < 256; ++i) {
lookup[i] = i & 0x3F;
lookup[512 + i] = i >> 2;
lookup[1792 + i] = 2 + (i >> 6);
}
- for (var /** !number */ i = 0; i < 128; ++i) {
+ for (var /** number */ i = 0; i < 128; ++i) {
lookup[1024 + i] = 4 * (map.charCodeAt(i) - 32);
}
- for (var /** !number */ i = 0; i < 64; ++i) {
+ for (var /** number */ i = 0; i < 64; ++i) {
lookup[1152 + i] = i & 1;
lookup[1216 + i] = 2 + (i & 1);
}
- var /** !number */ offset = 1280;
- for (var /** !number */ k = 0; k < 19; ++k) {
- var /** !number */ value = k & 3;
- var /** !number */ rep = rle.charCodeAt(k) - 32;
- for (var /** !number */ i = 0; i < rep; ++i) {
+ var /** number */ offset = 1280;
+ for (var /** number */ k = 0; k < 19; ++k) {
+ var /** number */ value = k & 3;
+ var /** number */ rep = rle.charCodeAt(k) - 32;
+ for (var /** number */ i = 0; i < rep; ++i) {
lookup[offset++] = value;
}
}
- for (var /** !number */ i = 0; i < 16; ++i) {
+ for (var /** number */ i = 0; i < 16; ++i) {
lookup[1792 + i] = 1;
lookup[2032 + i] = 6;
}
lookup[1792] = 0;
lookup[2047] = 7;
- for (var /** !number */ i = 0; i < 256; ++i) {
+ for (var /** number */ i = 0; i < 256; ++i) {
lookup[1536 + i] = lookup[1792 + i] << 3;
}
}
@@ -1486,6 +1777,8 @@ function BrotliDecodeClosure() {
/** @type {!Int8Array} */
this.distContextMap = new Int8Array(0);
/** @type {!Int8Array} */
+ this.distExtraBits = new Int8Array(0);
+ /** @type {!Int8Array} */
this.output = new Int8Array(0);
/** @type {!Int8Array} */
this.byteBuffer = new Int8Array(0);
@@ -1498,11 +1791,13 @@ function BrotliDecodeClosure() {
/** @type {!Int32Array} */
this.blockTrees = new Int32Array(0);
/** @type {!Int32Array} */
- this.hGroup0 = new Int32Array(0);
+ this.literalTreeGroup = new Int32Array(0);
+ /** @type {!Int32Array} */
+ this.commandTreeGroup = new Int32Array(0);
/** @type {!Int32Array} */
- this.hGroup1 = new Int32Array(0);
+ this.distanceTreeGroup = new Int32Array(0);
/** @type {!Int32Array} */
- this.hGroup2 = new Int32Array(0);
+ this.distOffset = new Int32Array(0);
/** @type {!number} */
this.runningState = 0;
/** @type {!number} */
@@ -1546,9 +1841,9 @@ function BrotliDecodeClosure() {
/** @type {!number} */
this.trivialLiteralContext = 0;
/** @type {!number} */
- this.literalTreeIndex = 0;
+ this.literalTreeIdx = 0;
/** @type {!number} */
- this.literalTree = 0;
+ this.commandTreeIdx = 0;
/** @type {!number} */
this.j = 0;
/** @type {!number} */
@@ -1562,8 +1857,6 @@ function BrotliDecodeClosure() {
/** @type {!number} */
this.contextLookupOffset2 = 0;
/** @type {!number} */
- this.treeCommandOffset = 0;
- /** @type {!number} */
this.distanceCode = 0;
/** @type {!number} */
this.numDirectDistanceCodes = 0;
@@ -1595,6 +1888,8 @@ function BrotliDecodeClosure() {
this.ringBufferBytesReady = 0;
/** @type {!number} */
this.isEager = 0;
+ /** @type {!number} */
+ this.isLargeWindow = 0;
/** @type {!InputStream|null} */
this.input = null;
this.ringBuffer = new Int8Array(0);
@@ -1617,13 +1912,13 @@ function BrotliDecodeClosure() {
if (dict.length != dictionary.length) {
throw "Corrupted brotli dictionary";
}
- var /** !number */ offset = 0;
- var /** !number */ n = skipFlip.length;
- for (var /** !number */ i = 0; i < n; i += 2) {
- var /** !number */ skip = skipFlip.charCodeAt(i) - 36;
- var /** !number */ flip = skipFlip.charCodeAt(i + 1) - 36;
+ var /** number */ offset = 0;
+ var /** number */ n = skipFlip.length;
+ for (var /** number */ i = 0; i < n; i += 2) {
+ var /** number */ skip = skipFlip.charCodeAt(i) - 36;
+ var /** number */ flip = skipFlip.charCodeAt(i + 1) - 36;
offset += skip;
- for (var /** !number */ j = 0; j < flip; ++j) {
+ for (var /** number */ j = 0; j < flip; ++j) {
dict[offset] |= 0x80;
offset++;
}
diff --git a/js/decode.min.js b/js/decode.min.js
index 109b891..5fee001 100755..100644
--- a/js/decode.min.js
+++ b/js/decode.min.js
@@ -1 +1,2 @@
-function BrotliDecodeClosure(){"use strict";var O=new Int8Array(0);function d(e){this.data=e;this.offset=0}var $=Int32Array.from([1,2,3,4,0,5,17,6,16,7,8,9,10,11,12,13,14,15]);var n=Int32Array.from([3,2,1,0,3,3,3,3,3,3,2,2,2,2,2,2]);var a=Int32Array.from([0,0,0,0,-1,1,-2,2,-3,3,-1,1,-2,2,-3,3]);var b=Int32Array.from([131072,131076,131075,196610,131072,131076,131075,262145,131072,131076,131075,196610,131072,131076,131075,262149]);var S=Int32Array.from([0,0,0,0,0,4096,9216,21504,35840,44032,53248,63488,74752,87040,93696,100864,104704,106752,108928,113536,115968,118528,119872,121280,122016]);var A=Int32Array.from([0,0,0,0,10,10,11,11,10,10,10,10,10,9,9,8,7,7,8,7,7,6,6,5,5]);var o=Int32Array.from([1,5,9,13,17,25,33,41,49,65,81,97,113,145,177,209,241,305,369,497,753,1265,2289,4337,8433,16625]);var r=Int32Array.from([2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,6,6,7,8,9,10,11,12,13,24]);var T=Int32Array.from([0,1,2,3,4,5,6,8,10,14,18,26,34,50,66,98,130,194,322,578,1090,2114,6210,22594]);var I=Int32Array.from([0,0,0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,7,8,9,10,12,14,24]);var q=Int32Array.from([2,3,4,5,6,7,8,9,10,12,14,18,22,30,38,54,70,102,134,198,326,582,1094,2118]);var z=Int32Array.from([0,0,0,0,0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,7,8,9,10,24]);var L=Int32Array.from([0,0,8,8,0,16,8,16,16]);var D=Int32Array.from([0,8,0,8,16,0,16,8,16]);function s(e){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}if(ee(e,1)==0){return 16}var t=ee(e,3);if(t!=0){return 17+t}t=ee(e,3);if(t!=0){return 8+t}return 17}function h(e,t){if(e.runningState!=0){throw"State MUST be uninitialized"}e.blockTrees=new Int32Array(6480);e.input=t;ie(e);var i=s(e);if(i==9){throw"Invalid 'windowBits' code"}e.maxRingBufferSize=1<<i;e.maxBackwardDistance=e.maxRingBufferSize-16;e.runningState=1}function f(e){if(e.runningState==0){throw"State MUST be initialized"}if(e.runningState==10){return}e.runningState=10;if(e.input!=null){ge(e.input);e.input=null}}function u(e){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}if(ee(e,1)!=0){var t=ee(e,3);if(t==0){return 1}else{return ee(e,t)+(1<<t)}}return 0}function t(e){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}e.inputEnd=ee(e,1);e.metaBlockLength=0;e.isUncompressed=0;e.isMetadata=0;if(e.inputEnd!=0&&ee(e,1)!=0){return}var t=ee(e,2)+4;if(t==7){e.isMetadata=1;if(ee(e,1)!=0){throw"Corrupted reserved bit"}var i=ee(e,2);if(i==0){return}for(var n=0;n<i;n++){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var a=ee(e,8);if(a==0&&n+1==i&&i>1){throw"Exuberant nibble"}e.metaBlockLength|=a<<n*8}}else{for(var n=0;n<t;n++){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var a=ee(e,4);if(a==0&&n+1==t&&t>4){throw"Exuberant nibble"}e.metaBlockLength|=a<<n*4}}e.metaBlockLength++;if(e.inputEnd==0){e.isUncompressed=ee(e,1)}}function E(e,t,i){var n=i.accumulator32>>>i.bitOffset;t+=n&255;var a=e[t]>>16;var o=e[t]&65535;if(a<=8){i.bitOffset+=a;return o}t+=o;var r=(1<<a)-1;t+=(n&r)>>>8;i.bitOffset+=(e[t]>>16)+8;return e[t]&65535}function l(e,t,i){if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}var n=E(e,t,i);var a=r[n];if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}return o[n]+(a<=16?ee(i,a):te(i,a))}function M(e,t,i){if(e<16){i+=n[e];i&=3;return t[i]+a[e]}return e-16+1}function c(e,t){var i=e[t];for(;t>0;t--){e[t]=e[t-1]}e[0]=i}function p(e,t){var i=new Int32Array(256);for(var n=0;n<256;n++){i[n]=n}for(var n=0;n<t;n++){var a=e[n]&255;e[n]=i[a];if(a!=0){c(i,a)}}}function v(e,t,i,n){var a=0;var o=8;var r=0;var s=0;var l=32768;var c=new Int32Array(32);V(c,0,5,e,18);while(a<t&&l>0){if(n.halfOffset>2030){K(n)}if(n.bitOffset>=16){n.accumulator32=n.shortBuffer[n.halfOffset++]<<16|n.accumulator32>>>16;n.bitOffset-=16}var d=n.accumulator32>>>n.bitOffset&31;n.bitOffset+=c[d]>>16;var h=c[d]&65535;if(h<16){r=0;i[a++]=h;if(h!=0){o=h;l-=32768>>h}}else{var f=h-14;var u=0;if(h==16){u=o}if(s!=u){r=0;s=u}var p=r;if(r>0){r-=2;r<<=f}if(n.bitOffset>=16){n.accumulator32=n.shortBuffer[n.halfOffset++]<<16|n.accumulator32>>>16;n.bitOffset-=16}r+=ee(n,f)+3;var m=r-p;if(a+m>t){throw"symbol + repeatDelta > numSymbols"}for(var g=0;g<m;g++){i[a++]=s}if(s!=0){l-=m<<15-s}}}if(l!=0){throw"Unused space"}i.fill(0,a,t)}function y(e,t){for(var i=0;i<t-1;++i){for(var n=i+1;n<t;++n){if(e[i]==e[n]){return 0}}}return 1}function m(e,t,i,n){var a=1;var o;if(n.halfOffset>2030){K(n)}var r=new Int32Array(e);if(n.bitOffset>=16){n.accumulator32=n.shortBuffer[n.halfOffset++]<<16|n.accumulator32>>>16;n.bitOffset-=16}o=ee(n,2);if(o==1){var s=e-1;var l=0;var c=new Int32Array(4);var d=ee(n,2)+1;while(s!=0){s>>=1;l++}for(var h=0;h<d;h++){if(n.bitOffset>=16){n.accumulator32=n.shortBuffer[n.halfOffset++]<<16|n.accumulator32>>>16;n.bitOffset-=16}c[h]=ee(n,l)%e;r[c[h]]=2}r[c[0]]=1;switch(d){case 2:r[c[1]]=1;break;case 4:if(ee(n,1)==1){r[c[2]]=3;r[c[3]]=3}else{r[c[0]]=2}break;default:break}a=y(c,d)}else{var f=new Int32Array(18);var u=32;var p=0;for(var h=o;h<18&&u>0;h++){var m=$[h];if(n.bitOffset>=16){n.accumulator32=n.shortBuffer[n.halfOffset++]<<16|n.accumulator32>>>16;n.bitOffset-=16}var g=n.accumulator32>>>n.bitOffset&15;n.bitOffset+=b[g]>>16;var P=b[g]&65535;f[m]=P;if(P!=0){u-=32>>P;p++}}if(u!=0&&p!=1){a=0}v(f,e,r,n)}if(a==0){throw"Can't readHuffmanCode"}V(t,i,8,r,e)}function g(e,t,i){if(i.halfOffset>2030){K(i)}var n=u(i)+1;if(n==1){t.fill(0,0,e);return n}if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}var a=ee(i,1);var o=0;if(a!=0){o=ee(i,4)+1}var r=new Int32Array(1080);m(n+o,r,0,i);for(var s=0;s<e;){if(i.halfOffset>2030){K(i)}if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}var l=E(r,0,i);if(l==0){t[s]=0;s++}else if(l<=o){if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}var c=(1<<l)+ee(i,l);while(c!=0){if(s>=e){throw"Corrupted context map"}t[s]=0;s++;c--}}else{t[s]=l-o;s++}}if(i.bitOffset>=16){i.accumulator32=i.shortBuffer[i.halfOffset++]<<16|i.accumulator32>>>16;i.bitOffset-=16}if(ee(i,1)==1){p(t,e)}return n}function P(e,t,i){var n=e.rings;var a=4+t*2;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var o=E(e.blockTrees,t*1080,e);var r=l(e.blockTrees,(t+3)*1080,e);if(o==1){o=n[a+1]+1}else if(o==0){o=n[a]}else{o-=2}if(o>=i){o-=i}n[a]=n[a+1];n[a+1]=o;return r}function R(e){e.literalBlockLength=P(e,0,e.numLiteralBlockTypes);var t=e.rings[5];e.contextMapSlice=t<<6;e.literalTreeIndex=e.contextMap[e.contextMapSlice]&255;e.literalTree=e.hGroup0[e.literalTreeIndex];var i=e.contextModes[t];e.contextLookupOffset1=i<<9;e.contextLookupOffset2=e.contextLookupOffset1+256}function F(e){e.commandBlockLength=P(e,1,e.numCommandBlockTypes);e.treeCommandOffset=e.hGroup1[e.rings[7]]}function N(e){e.distanceBlockLength=P(e,2,e.numDistanceBlockTypes);e.distContextMapSlice=e.rings[9]<<2}function i(e){var t=e.maxRingBufferSize;if(t>e.expectedTotalSize){var i=e.expectedTotalSize;while(t>>1>i){t>>=1}if(e.inputEnd==0&&t<16384&&e.maxRingBufferSize>=16384){t=16384}}if(t<=e.ringBufferSize){return}var n=t+37;var a=new Int8Array(n);if(e.ringBuffer.length!=0){a.set(e.ringBuffer.subarray(0,0+e.ringBufferSize),0)}e.ringBuffer=a;e.ringBufferSize=t}function U(e){if(e.inputEnd!=0){e.nextRunningState=9;e.runningState=11;return}e.hGroup0=new Int32Array(0);e.hGroup1=new Int32Array(0);e.hGroup2=new Int32Array(0);if(e.halfOffset>2030){K(e)}t(e);if(e.metaBlockLength==0&&e.isMetadata==0){return}if(e.isUncompressed!=0||e.isMetadata!=0){oe(e);e.runningState=e.isMetadata!=0?4:5}else{e.runningState=2}if(e.isMetadata!=0){return}e.expectedTotalSize+=e.metaBlockLength;if(e.expectedTotalSize>1<<30){e.expectedTotalSize=1<<30}if(e.ringBufferSize<e.maxRingBufferSize){i(e)}}function X(e,t,i){if(i<=1){return 1<<28}m(i+2,e.blockTrees,t*1080,e);m(26,e.blockTrees,(t+3)*1080,e);return l(e.blockTrees,(t+3)*1080,e)}function H(e){e.numLiteralBlockTypes=u(e)+1;e.literalBlockLength=X(e,0,e.numLiteralBlockTypes);e.numCommandBlockTypes=u(e)+1;e.commandBlockLength=X(e,1,e.numCommandBlockTypes);e.numDistanceBlockTypes=u(e)+1;e.distanceBlockLength=X(e,2,e.numDistanceBlockTypes);if(e.halfOffset>2030){K(e)}if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}e.distancePostfixBits=ee(e,2);e.numDirectDistanceCodes=16+(ee(e,4)<<e.distancePostfixBits);e.distancePostfixMask=(1<<e.distancePostfixBits)-1;var t=e.numDirectDistanceCodes+(48<<e.distancePostfixBits);e.contextModes=new Int8Array(e.numLiteralBlockTypes);for(var i=0;i<e.numLiteralBlockTypes;){var n=pe(i+96,e.numLiteralBlockTypes);for(;i<n;++i){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}e.contextModes[i]=ee(e,2)}if(e.halfOffset>2030){K(e)}}e.contextMap=new Int8Array(e.numLiteralBlockTypes<<6);var a=g(e.numLiteralBlockTypes<<6,e.contextMap,e);e.trivialLiteralContext=1;for(var o=0;o<e.numLiteralBlockTypes<<6;o++){if(e.contextMap[o]!=o>>6){e.trivialLiteralContext=0;break}}e.distContextMap=new Int8Array(e.numDistanceBlockTypes<<2);var r=g(e.numDistanceBlockTypes<<2,e.distContextMap,e);e.hGroup0=w(256,a,e);e.hGroup1=w(704,e.numCommandBlockTypes,e);e.hGroup2=w(t,r,e);e.contextMapSlice=0;e.distContextMapSlice=0;e.contextLookupOffset1=e.contextModes[0]<<9;e.contextLookupOffset2=e.contextLookupOffset1+256;e.literalTreeIndex=0;e.literalTree=e.hGroup0[0];e.treeCommandOffset=e.hGroup1[0];e.rings[4]=1;e.rings[5]=0;e.rings[6]=1;e.rings[7]=0;e.rings[8]=1;e.rings[9]=0}function W(e){var t=e.ringBuffer;if(e.metaBlockLength<=0){ae(e);e.runningState=1;return}var i=pe(e.ringBufferSize-e.pos,e.metaBlockLength);se(e,t,e.pos,i);e.metaBlockLength-=i;e.pos+=i;if(e.pos==e.ringBufferSize){e.nextRunningState=5;e.runningState=11;return}ae(e);e.runningState=1}function G(e){var t=pe(e.outputLength-e.outputUsed,e.ringBufferBytesReady-e.ringBufferBytesWritten);if(t!=0){e.output.set(e.ringBuffer.subarray(e.ringBufferBytesWritten,e.ringBufferBytesWritten+t),e.outputOffset+e.outputUsed);e.outputUsed+=t;e.ringBufferBytesWritten+=t}if(e.outputUsed<e.outputLength){return 1}else{return 0}}function w(e,t,i){var n=new Int32Array(t+t*1080);var a=t;for(var o=0;o<t;o++){n[o]=a;m(e,n,a,i);a+=1080}return n}function _(e){var t=e.ringBufferSize;if(e.isEager!=0){t=pe(t,e.ringBufferBytesWritten+e.outputLength-e.outputUsed)}return t}function Y(e){if(e.runningState==0){throw"Can't decompress until initialized"}if(e.runningState==10){throw"Can't decompress after close"}var t=_(e);var i=e.ringBufferSize-1;var n=e.ringBuffer;while(e.runningState!=9){switch(e.runningState){case 1:if(e.metaBlockLength<0){throw"Invalid metablock length"}U(e);t=_(e);i=e.ringBufferSize-1;n=e.ringBuffer;continue;case 2:H(e);e.runningState=3;case 3:if(e.metaBlockLength<=0){e.runningState=1;continue}if(e.halfOffset>2030){K(e)}if(e.commandBlockLength==0){F(e)}e.commandBlockLength--;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var a=E(e.hGroup1,e.treeCommandOffset,e);var o=a>>>6;e.distanceCode=0;if(o>=2){o-=2;e.distanceCode=-1}var r=L[o]+(a>>>3&7);if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var s=I[r];var l=s<=16?ee(e,s):te(e,s);e.insertLength=T[r]+l;var c=D[o]+(a&7);if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var d=z[c];var h=d<=16?ee(e,d):te(e,d);e.copyLength=q[c]+h;e.j=0;e.runningState=6;case 6:if(e.trivialLiteralContext!=0){while(e.j<e.insertLength){if(e.halfOffset>2030){K(e)}if(e.literalBlockLength==0){R(e)}e.literalBlockLength--;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}n[e.pos]=E(e.hGroup0,e.literalTree,e);e.pos++;e.j++;if(e.pos>=t){e.nextRunningState=6;e.runningState=11;break}}}else{var f=n[e.pos-1&i]&255;var u=n[e.pos-2&i]&255;while(e.j<e.insertLength){if(e.halfOffset>2030){K(e)}if(e.literalBlockLength==0){R(e)}var p=e.contextMap[e.contextMapSlice+(ce[e.contextLookupOffset1+f]|ce[e.contextLookupOffset2+u])]&255;e.literalBlockLength--;u=f;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}f=E(e.hGroup0,e.hGroup0[p],e);n[e.pos]=f;e.pos++;e.j++;if(e.pos>=t){e.nextRunningState=6;e.runningState=11;break}}}if(e.runningState!=6){continue}e.metaBlockLength-=e.insertLength;if(e.metaBlockLength<=0){e.runningState=3;continue}if(e.distanceCode<0){if(e.halfOffset>2030){K(e)}if(e.distanceBlockLength==0){N(e)}e.distanceBlockLength--;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}e.distanceCode=E(e.hGroup2,e.hGroup2[e.distContextMap[e.distContextMapSlice+(e.copyLength>4?3:e.copyLength-2)]&255],e);if(e.distanceCode>=e.numDirectDistanceCodes){e.distanceCode-=e.numDirectDistanceCodes;var m=e.distanceCode&e.distancePostfixMask;e.distanceCode>>>=e.distancePostfixBits;var g=(e.distanceCode>>>1)+1;var P=(2+(e.distanceCode&1)<<g)-4;if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}var $=g<=16?ee(e,g):te(e,g);e.distanceCode=e.numDirectDistanceCodes+m+(P+$<<e.distancePostfixBits)}}e.distance=M(e.distanceCode,e.rings,e.distRbIdx);if(e.distance<0){throw"Negative distance"}if(e.maxDistance!=e.maxBackwardDistance&&e.pos<e.maxBackwardDistance){e.maxDistance=e.pos}else{e.maxDistance=e.maxBackwardDistance}if(e.distance>e.maxDistance){e.runningState=8;continue}if(e.distanceCode>0){e.rings[e.distRbIdx&3]=e.distance;e.distRbIdx++}if(e.copyLength>e.metaBlockLength){throw"Invalid backward reference"}e.j=0;e.runningState=7;case 7:var b=e.pos-e.distance&i;var v=e.pos;var y=e.copyLength-e.j;var X=b+y;var w=v+y;if(X<i&&w<i){if(y<12||X>v&&w>b){for(var Y=0;Y<y;Y+=4){n[v++]=n[b++];n[v++]=n[b++];n[v++]=n[b++];n[v++]=n[b++]}}else{n.copyWithin(v,b,X)}e.j+=y;e.metaBlockLength-=y;e.pos+=y}else{for(;e.j<e.copyLength;){n[e.pos]=n[e.pos-e.distance&i];e.metaBlockLength--;e.pos++;e.j++;if(e.pos>=t){e.nextRunningState=7;e.runningState=11;break}}}if(e.runningState==7){e.runningState=3}continue;case 8:if(e.copyLength>=4&&e.copyLength<=24){var P=S[e.copyLength];var Q=e.distance-e.maxDistance-1;var k=A[e.copyLength];var x=(1<<k)-1;var C=Q&x;var B=Q>>>k;P+=C*e.copyLength;if(B<121){var j=J(n,e.pos,O,P,e.copyLength,B);e.pos+=j;e.metaBlockLength-=j;if(e.pos>=t){e.nextRunningState=3;e.runningState=11;continue}}else{throw"Invalid backward reference"}}else{throw"Invalid backward reference"}e.runningState=3;continue;case 4:while(e.metaBlockLength>0){if(e.halfOffset>2030){K(e)}if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}ee(e,8);e.metaBlockLength--}e.runningState=1;continue;case 5:W(e);continue;case 11:e.ringBufferBytesReady=pe(e.pos,e.ringBufferSize);e.runningState=12;case 12:if(G(e)==0){return}if(e.pos>=e.maxBackwardDistance){e.maxDistance=e.maxBackwardDistance}if(e.pos>=e.ringBufferSize){if(e.pos>e.ringBufferSize){n.copyWithin(0,e.ringBufferSize,e.pos)}e.pos&=i;e.ringBufferBytesWritten=0}e.runningState=e.nextRunningState;continue;default:throw"Unexpected state "+e.runningState}}if(e.runningState==9){if(e.metaBlockLength<0){throw"Invalid metablock length"}oe(e);Z(e,1)}}var Q=new Int32Array(363);var k=new Int8Array(217);var x=new Int32Array(51);function e(e,t,i,n,a){var o=n.length;var r=1;for(var s=0;s<o;++s){var l=n.charCodeAt(s);e[s]=l;if(l==35){t[r++]=s+1;e[s]=0}}for(var s=0;s<363;++s){i[s]=a.charCodeAt(s)-32}}{e(k,x,Q,'# #s #, #e #.# the #.com/# # of # and # in # to #"#">#\n#]# for # a # that #. # with #\'# from # by #. The # on # as # is #ing #\n\t#:#ed #(# at #ly #="# of the #. This #,# not #er #al #=\'#ful #ive #less #est #ize #ous #'," !! ! , *! &! \" ! ) * * - ! # ! #!*! + ,$ ! - % . / # 0 1 . \" 2 3!* 4% ! # / 5 6 7 8 0 1 & $ 9 + : ; < ' != > ?! 4 @ 4 2 & A *# ( B C& ) % ) !*# *-% A +! *. D! %' & E *6 F G% ! *A *% H! D I!+! J!+ K +- *4! A L!*4 M N +6 O!*% +.! K *G P +%( ! G *D +D Q +# *K!*G!+D!+# +G +A +4!+% +K!+4!*D!+K!*K")}function J(e,t,i,n,a,o){var r=t;var s=3*o;var l=x[Q[s]];var c=Q[s+1];var d=x[Q[s+2]];while(k[l]!=0){e[r++]=k[l++]}var h=c>=12?c-11:0;if(h>a){h=a}n+=h;a-=h;a-=c<=9?c:0;var f=a;while(f>0){e[r++]=i[n++];f--}if(c==11||c==10){var u=r-a;if(c==10){a=1}while(a>0){var p=e[u]&255;if(p<192){if(p>=97&&p<=122){e[u]^=32}u+=1;a-=1}else if(p<224){e[u+1]^=32;u+=2;a-=2}else{e[u+2]^=5;u+=3;a-=3}}}while(k[d]!=0){e[r++]=k[d++]}return r-t}function C(e,t){var i=1<<t-1;while((e&i)!=0){i>>=1}return(e&i-1)+i}function B(e,t,i,n,a){do{n-=i;e[t+n]=a}while(n>0)}function j(e,t,i){var n=1<<t-i;while(t<15){n-=e[t];if(n<=0){break}t++;n<<=1}return t-i}function V(e,t,i,n,a){var o;var r=new Int32Array(a);var s=new Int32Array(16);var l=new Int32Array(16);var c;for(c=0;c<a;c++){s[n[c]]++}l[1]=0;for(var d=1;d<15;d++){l[d+1]=l[d]+s[d]}for(c=0;c<a;c++){if(n[c]!=0){r[l[n[c]]++]=c}}var h=i;var f=1<<h;var u=f;if(l[15]==1){for(o=0;o<u;o++){e[t+o]=r[0]}return}o=0;c=0;for(var d=1,p=2;d<=i;d++,p<<=1){for(;s[d]>0;s[d]--){B(e,t+o,p,f,d<<16|r[c++]);o=C(o,d)}}var m=u-1;var g=-1;var P=t;for(var d=i+1,p=2;d<=15;d++,p<<=1){for(;s[d]>0;s[d]--){if((o&m)!=g){P+=f;h=j(s,d,i);f=1<<h;u+=f;g=o&m;e[t+g]=h+i<<16|P-t-g}B(e,P+(o>>i),p,f,d-i<<16|r[c++]);o=C(o,d)}}}function K(e){if(e.endOfStreamReached!=0){if(re(e)>=-2){return}throw"No more input"}var t=e.halfOffset<<1;var i=4096-t;e.byteBuffer.copyWithin(0,t,4096);e.halfOffset=0;while(i<4096){var n=4096-i;var a=me(e.input,e.byteBuffer,i,n);if(a<=0){e.endOfStreamReached=1;e.tailBytes=i;i+=1;break}i+=a}le(e,i)}function Z(e,t){if(e.endOfStreamReached==0){return}var i=(e.halfOffset<<1)+(e.bitOffset+7>>3)-4;if(i>e.tailBytes){throw"Read after end"}if(t!=0&&i!=e.tailBytes){throw"Unused bytes after end"}}function ee(e,t){var i=e.accumulator32>>>e.bitOffset&(1<<t)-1;e.bitOffset+=t;return i}function te(e,t){var i=ee(e,16);e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16;return i|ee(e,t-16)<<16}function ie(e){e.byteBuffer=new Int8Array(4160);e.accumulator32=0;e.shortBuffer=new Int16Array(2080);e.bitOffset=32;e.halfOffset=2048;e.endOfStreamReached=0;ne(e)}function ne(e){if(e.halfOffset>2030){K(e)}Z(e,0);e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16;e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}function ae(e){if(e.bitOffset==32){ne(e)}}function oe(e){var t=32-e.bitOffset&7;if(t!=0){var i=ee(e,t);if(i!=0){throw"Corrupted padding bits"}}}function re(e){var t=2048;if(e.endOfStreamReached!=0){t=e.tailBytes+1>>1}return t-e.halfOffset}function se(e,t,i,n){if((e.bitOffset&7)!=0){throw"Unaligned copyBytes"}while(e.bitOffset!=32&&n!=0){t[i++]=e.accumulator32>>>e.bitOffset;e.bitOffset+=8;n--}if(n==0){return}var a=pe(re(e),n>>1);if(a>0){var o=e.halfOffset<<1;var r=a<<1;t.set(e.byteBuffer.subarray(o,o+r),i);i+=r;n-=r;e.halfOffset+=a}if(n==0){return}if(re(e)>0){if(e.bitOffset>=16){e.accumulator32=e.shortBuffer[e.halfOffset++]<<16|e.accumulator32>>>16;e.bitOffset-=16}while(n!=0){t[i++]=e.accumulator32>>>e.bitOffset;e.bitOffset+=8;n--}Z(e,0);return}while(n>0){var s=me(e.input,t,i,n);if(s==-1){throw"Unexpected end of input"}i+=s;n-=s}}function le(e,t){var i=e.byteBuffer;var n=t>>1;var a=e.shortBuffer;for(var o=0;o<n;++o){a[o]=i[o*2]&255|(i[o*2+1]&255)<<8}}var ce=new Int32Array(2048);function de(e,t,i){for(var n=0;n<256;++n){e[n]=n&63;e[512+n]=n>>2;e[1792+n]=2+(n>>6)}for(var n=0;n<128;++n){e[1024+n]=4*(t.charCodeAt(n)-32)}for(var n=0;n<64;++n){e[1152+n]=n&1;e[1216+n]=2+(n&1)}var a=1280;for(var o=0;o<19;++o){var r=o&3;var s=i.charCodeAt(o)-32;for(var n=0;n<s;++n){e[a++]=r}}for(var n=0;n<16;++n){e[1792+n]=1;e[2032+n]=6}e[1792]=0;e[2047]=7;for(var n=0;n<256;++n){e[1536+n]=e[1792+n]<<3}}{de(ce," !! ! \"#$##%#$&'##(#)#++++++++++((&*'##,---,---,-----,-----,-----&#'###.///.///./////./////./////&#'# ","A/* ': & : $  @")}function he(){this.ringBuffer=new Int8Array(0);this.contextModes=new Int8Array(0);this.contextMap=new Int8Array(0);this.distContextMap=new Int8Array(0);this.output=new Int8Array(0);this.byteBuffer=new Int8Array(0);this.shortBuffer=new Int16Array(0);this.intBuffer=new Int32Array(0);this.rings=new Int32Array(0);this.blockTrees=new Int32Array(0);this.hGroup0=new Int32Array(0);this.hGroup1=new Int32Array(0);this.hGroup2=new Int32Array(0);this.runningState=0;this.nextRunningState=0;this.accumulator32=0;this.bitOffset=0;this.halfOffset=0;this.tailBytes=0;this.endOfStreamReached=0;this.metaBlockLength=0;this.inputEnd=0;this.isUncompressed=0;this.isMetadata=0;this.literalBlockLength=0;this.numLiteralBlockTypes=0;this.commandBlockLength=0;this.numCommandBlockTypes=0;this.distanceBlockLength=0;this.numDistanceBlockTypes=0;this.pos=0;this.maxDistance=0;this.distRbIdx=0;this.trivialLiteralContext=0;this.literalTreeIndex=0;this.literalTree=0;this.j=0;this.insertLength=0;this.contextMapSlice=0;this.distContextMapSlice=0;this.contextLookupOffset1=0;this.contextLookupOffset2=0;this.treeCommandOffset=0;this.distanceCode=0;this.numDirectDistanceCodes=0;this.distancePostfixMask=0;this.distancePostfixBits=0;this.distance=0;this.copyLength=0;this.maxBackwardDistance=0;this.maxRingBufferSize=0;this.ringBufferSize=0;this.expectedTotalSize=0;this.outputOffset=0;this.outputLength=0;this.outputUsed=0;this.ringBufferBytesWritten=0;this.ringBufferBytesReady=0;this.isEager=0;this.input=null;this.ringBuffer=new Int8Array(0);this.rings=new Int32Array(10);this.rings[0]=16;this.rings[1]=15;this.rings[2]=11;this.rings[3]=4}function fe(e,t,i,n){var a=$e(t+i);if(a.length!=e.length){throw"Corrupted brotli dictionary"}var o=0;var r=n.length;for(var s=0;s<r;s+=2){var l=n.charCodeAt(s)-36;var c=n.charCodeAt(s+1)-36;o+=l;for(var d=0;d<c;++d){a[o]|=128;o++}}e.set(a)}{var ue=new Int8Array(122784);fe(ue,'timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser\') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast\'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$(\'#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear\x3c!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$("#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS"agedgreyGET"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:e*/\r\n 100hall.\n\nA7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,\r\n\r\ncoolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px\'\'););">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarmb\0sboys[0].\');"POSTbearkids);}}marytend(UK)quadzh:f-siz----prop\');\rliftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene b\0softrometillross<h3>pourfadepink<tr>mini)|!(minezh:hbarshear00);milk --\x3eironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json\', \'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:d\'));puremageparatonebond:37Z_of_\']);000,zh:gtankyardbowlbush:56ZJava30px\n|}\n%C3%:34ZjeffEXPIcashvisagolfsnowzh:iquer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;\n}\nexit:35Zvarsbeat\'});diet999;anne}}</[i].LangkmB2wiretoysaddssealalex;\n\t}echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$(\'.50pxPh.Dmiscalanloandeskmileryanunixdisc);}\ndustclip).\n\n70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}\r\nHEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-\n!002)ndow[1];[];\nLog salt\r\n\t\tbangtrimbath){\r\n00px\n});ko:lfeesad>\rs:// [];tollplug(){\n{\r\n .js\'200pdualboat.JPG);\n}quot);\n\n\');\n\r\n}\r201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomC!sesteestaperotodohacecadaaC1obiendC-aasC-vidacasootroforosolootracualdijosidograntipotemadebealgoquC)estonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiP7P0P=P0P>P<Q\0P0Q\0QQP0P=P5P?P>P>QP8P7P=P>P4P>QP>P6P5P>P=P8QPP0P5P5P1Q\vP<Q\vPQ\vQP>P2Q\vP2P>PP>P>P1PP>P;P8P=P8P P$PP5PQ\vQQ\vPP=P8P<P4P0PP0PP0PQPP1QP5PP7P5P9P=QP<P<P"Q\vQP6YY\nX#YYX\'YX9YYX#Y\bX1X/Y\nX\'YY\tYY\bYYYYX\'Y\bYYX(X3X\'YX%YYY\nX#Y\nYX/YYX+YX(YYY\bYY\nX(YX\'Y\nX(YX4Y\nX\'YX#YYX*X(Y\nYYX-X(YYYX4Y\bX4firstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //--\x3eadminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase>\x3c!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow">genretrucklooksValueFrame.net/--\x3e\n<try {\nvar makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top">\n\x3c!--POST"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url="parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs\x3c!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();" Blocklinuxjonespixel\');">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar">.src=toweralt="cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});\r\nbandsqueue= {};80px;cking{\r\n\t\taheadclockirishlike ratiostatsForm"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg"spainbeachtaxesmicroangel--\x3e</giftssteve-linkbody.});\n\tmount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:csimon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/"1.jpgwmodeparamSTARTleft idden, 201);\n}\nform.viruschairtransworstPagesitionpatch\x3c!--\no-cacfirmstours,000 asiani++){adobe\')[0]id=10both;menu .2.mi.png"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120" sweettr>\r\nname=diegopage swiss--\x3e\n\n#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:cid="cName"worseshots-box-delta\n&lt;bears:48Z<data-rural</a> spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe<img img">, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknows</h5>faq">zh-cn10);\n-1");type=bluestrulydavis.js\';>\r\n<!steel you h2>\r\nform jesus100% menu.\r\n\t\r\nwalesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeaC1osestC!tienehastaotrospartedondenuevohacerformamismomejormundoaquC-dC-assC3loayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaC-snuevasaludforosmedioquienmesespoderchileserC!vecesdecirjosC)estarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocC3moenerojuegoperC:haberestoynuncamujervalorfueralibrogustaigualvotoscasosguC-apuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleC3nplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenC!readiscopedrocercapuedapapelmenorC:tilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniC1oquedapasarbancohijosviajepabloC)stevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallC-jovendichaestantalessalirsuelopesosfinesllamabuscoC)stalleganegroplazahumorpagarjuntadobleislasbolsabaC1ohablaluchaCreadicenjugarnotasvalleallC!cargadolorabajoestC)gustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename="amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.\n\nOnejoinedmenu">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo">beyond-scaleacceptservedmarineFootercamera</h1>\n_form"leavesstress" />\r\n.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop"><racingresize--&gt;pacitysexualbureau.jpg" 10,000obtaintitlesamount, Inc.comedymenu" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body">\n* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox">\nSystem DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String\n\nWhiltaylorclear:resortfrenchthough") + "<body>buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink">Images=falsewhile hspace0&amp; \n\nIn powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml" rights.html-blockregExp:hoverwithinvirginphones</tr>\rusing \n\tvar >\');\n\t</td>\n</tr>\nbahasabrasilgalegomagyarpolskisrpskiX1X/Y\bd8-fg.\0d=g9i+d?!f/d8-e=f\bd;,d8\0d8*e,e8g.!gh.:ee/d;%f\re\n!f6i4d8*d::d:\'eh*e71d<d8f%g\ve7%d=hg3;f2!f\tg=g+f\t\0f\th/h.:d8-e?fg+ g(f\b7i&i!5d=h\0f\n\0f/i.i"g8e3d8\vh==fg4"d=?g(h=/d;6e(g:?d8;i"h5fh\'i"ee$\rf3(e\fg=g;f6hee.9f(h\re8e:f6\bf/g):i4ee8d;\0d9\be%=e\vgf4;e>g\tee1e&ff\t\vf:f0i;f\0f0f9e<e\fd:,fd>e3d:f4e$h?d8*g3;g;g%if88f\be9?e\ne6d;eh!(e.\te(g,,d8\0d<eh?h!\fg9e;g\t\bfg5e-d8g\fh.>h.!e\rh49fh2e\n e%f4;e\n(d;d;,eee\re."g0e(d8\nf57e&d=e72g;gh(\0h/&g;g$>e\f:g;e=f,g+i\0h&d;7f <f/f\fe=ii>f%e=e.6e;:h.>f\ve\vih/;f3e>\vd=\rg=.g;f5i\0\tf\v)h?f 7e=e\t\re\bg1;fh!\fe d8:d:$ff\0ei3d9d8\rh=i\0h?h!\fd8g\'f\n\0e/h=h.>e$e\bd=e$\'e.6g$>d<g g)6d8d8e(i(i!9g.h?i\fh?f/e<\0e\'\vfe5g5hfd;6eg\t\fe8.e\n)fe\fh5f:e$\'e-&e-&d9 e0e\0f5h\'\bf\nh5e7%g(\vh&f1f\0d9\bf6e\0e\nh=d8;h&g.e\t\rh5h./ee8f9f3g5e=1f\vhe#0fd;;d=e%e:7f0f\r.g>e=f1=h=&d;\vg;\rd=f/d:$f5gd:\'f\t\0d;%g5h/f>g$:d8\0d:e\rd=\rd::ee\bfe0e>ff88e7%e7e-&gg3;e\bg=e\ve8e-e/g i"if\'e\b6e0e\f:e:f,e(e=g=d8\ni\rh&g,,d:\fef,"h?e%e\vfh?d:h\0h/eg0e9h.-d;%d8\nf?e:f\bd8:g/e"i&f8/e\ff6e(1d9ei\0d8\0e.e<\0ed=ef ef,"h?h\'#e3e0f9d8\0d8\vd;%e\nh4#d;;f\bh\0e."f\b7d;#h!(g\'/e\be%3d::f0g i\0e.e:g0g&;g:?e:g(e\bh!(d8\re\fg<h>g;h.!f%h/"d8\rh&f\te3f:fe>\be$f-f>g;g;f?g-g4f%h=e\nf%f:fig\ve\b0g-i(e3i.d8e\f:ie88h\v1h/-g>e:&e8\ffg>e%3f/h>g%h/h\'e.e;:h..i(i(fh\'g2>e=)f%f,fi+eh(\0f9i"e:ie$gfie=1g\ti6h!\fh?f\te\bd:+g\t)eg;h%f7;e\n d8e.6h?g\'\rh/i"h57f%d8e\n!e,e\nh.0e=g.\0d;\vh4(ig7d::e=1e\re<g(f\n%e\ni(e\be?+i\0e(h/"f6e0f3(fg3h/7e-&f !e:h/%ee2e*f/h?eh4-d90e\rg\'0d8:d:f\be\nh/4fd>e:e-)e-d8i"g(\ve:d8\0h\b,fe!e*f\te6e.d?f\n$h\0\fd8d;\ne$)g*e#e\n(f\0g\n6f\0g\t9e\b+h.$d8:e?i!;f4f0e0h/4f\be\0d=d8:e*d=e\ff\v,i#d9\bd8\0f 7e=ef/e&f 9f\r.g5h\'e-&i"e7f\th?g(\vg1d:d::f\t\re:f%d8\rh?f-#e(fffd:\ve3g3;f i"ee\n!h>e%d8\0g4e:g!\0fe-&d:h\'#e;:g-g;fe(gi\0g%h.!e\be/9d:h\t:f/g8e\feggge;:g+\vg-\tg:\'g1;e\vg;i*\fe.g0e\b6d=f%h*f g->d;%d8\vee\bf f3e6d8-e\0\vd::d8\0e\bf\fe\re3i-ie"g,,d8\te3f3(e f-$g\'g\tf71e3ed8e9?e7f%fi+g:\'f\0h?g;<e\bh!(g$:d8h>h!\fd8:d:$i\0h/d;7h\'\te>g2>e\re.6e:-e.\ff\bfh\'\te.\th#e>e\b0i.d;6e\b6e:&i#eh=g6h=,h==f\n%d;7h.0h\0f9f!\bh!\ff?d::f0g(ed8h%?fe:ie:g6ed;f,>g-g9d;%e\t\re.\fe(ee8h.>g=.i"e/<e7%d8e\f;i"g\vg\vg;e8ee e93e0eg\'\re"e\n fff0e"d9\veh\fd8f\bfd;\ne94h.:ff\be=e\nh/\tg\t\bd8;d?.f9ed8f\te\r0e?+d9f:f"0h\'g9e-e(g2>g%h7e>e\b)g(g;\'g;-d= d;,h?d9\bf(!e<h/-h(\0h=e$ihf\rd=i#f <d8\0h57g\'e-&d=h2g-d?!f!d;6f2;gh?e\n(d:\'d8d<h..e/<h\b*e\bghge/f/ei!\fg;fd=g(h0f%h3fh*e\n(h4h4#ed8h.?i.e.f=f%eh.(h.:i#d8*e\ri&\be\n e<:e%3f\0\'h\fe4f\re\vd<i2d;\nf%e."f\rh\'\0g\vee\n gh/d8\0g9d?h/e>d9&f\tf\bf5\vh/g\';e\n(f\t\rh=e3e.h!g%(d8\rf-i\0f1d8\re>e\nf3d9\vi4ig(h%i\0f\nh/\tg.f g\b1ffe=1f\td:h$h#=fe-&f:d<f0e-h#d?.h4-g\t)efe(i"g2>ee6e.d:\vff04e93fg$:d8\ne8h0"h0"f.i\0fe8\bd8\nd< g1;e\b+f-\ff2f\v%f\te\bf0i\rd;6e*h&f6d;#h3h(\nh>>e\b0d::gh."ih\0e8\be1g$:e?gh44e-g62g+d8;i!\fh*g6g:\'e\b+g.\0e\rf9i)i#d:f%h/4f\te<\0d;#g e\b i$h/e\b8h\ng.i\rg9f,!f8e$e0h\'e\bh5if\t>e\b0d;%ee$\'e(d8;i!5f\0d=3eg-e$)d8\vd?ig0d;#f#\0f%f\ng%(e0f6f2f\tf-#e88gh3d;#gg.e=e,e<\0e$\re\b6ih\re98g&g\t\bf,e="f\bee$h!\ffee\b0f\0f3f\0f 7e\rh..h.$h/f\0e%=d:\'gf\f\tg\'f\rh#e9?d8e\n(f<+ih4-f0f\t\vg;e>i"f?eh\0f?f2;e.9fe$)e0e\n*e\nd::d;,e\rg:\'i\0e:&d::g\t)h0f4f5h!\fi\0 f\bfe-i)e=h48fe<\0e1g8ih!(g0e=1h\'e&f-$g>e.9e$\'e0f\n%if!f,>e?fh.8e$f3h\'e.6e1d9&e:h?f%g+\ve\r3d8>f\n%f\n\0e7\'e%%h?g;e%d;%f%gh.:d:\vd;6h*g1d8-e\re\ne,e&\be&\bgf-#d8\rie(fe\be\fd;7e\0<e\b+d::gg#e7d=d8g:*e"ie\bd8f\t?f\ve"i?f\td::d?f\fee.6g;4d?.e0f9>e7&e3h!d;=g-f!\be.ig5d?!g;gge=e.#d< d;;e\n!f-#e<g\t9h\t2d8\vf%e\rd<e*h=e=g6i\rf0e\'e.9f\fe/<h?h!\ff%e?h3#e.6h6h?ee0f5f1f/d;f(e:g+i?f-e7f\t\'h!\fe\b6i\0 d9\vd8\0f(e9?g0e:fh?0ee\fd< g;f-\ff\t\vd?i)h/>g(\ve\f;gg;h?h?e;d9\ve\t\rf6e%e94e:&fe?g>d8=f\0i+g;if*f%e\n e7%e\rh4#fg(\vg\t\beh:+d=i\re:e:e.f\bf,e="e<eh1e:e9d8f9i.g.1e\rd:,f1h\fee>h\fd=\rg8d?!i!5i"e\big=i!5g!.e.e>d>\vg=e\0g\'/fih//g.ge.h4f:e3i#i)f\bfgf/e. g\t)i$d:h)h+g>ge\nf6f1h4-g+g9e?g+%f/e$)d8-e$.h.$h/f/d8*e$)f4%e-d=e0g#g;4f\n$f,i!5d8*f\0\'e.f9e88h\'g8f:f\bg%e:e=e>\ve8\bf9d>?f !e-h!e8f\b?e1\vf g.ee7%e/<h4g*g6ie7f,g=g;e\bf!#f!\be\n3e\n(e&e$g>ee<h57f9eg,,ed<h.!h**fig\'e.e.h\'h\ff6\bh49e1e\fe?h.0d=g3;e8&f%e\re-g<h!(e<\0f>e\n gee\b0d:\ff\t\ve$\'if\bd::f0ie1d:+e\f:ee%3e-)ee\bf\t\0e(g;fi\0d?!h6g:\'i\rg=.e=f6d<g\'\0f\0\'ff\b?d:\'i\nf\b2e:e#fd:$e01d8d?e%g(\ve:&ef0d:\vd8f4d8*e11d8ffg\t9f.\ne\bi!fe0\ve1d:i(f\b7h4"e\n!e#0i3e\ne6h4"g;ef\fe92i(f\bg+\ve\b)g\nh\0hf\bi=e\fh#g(f\b6f/h5fff\vee.\ff4gf/g<gd<d<4e(fi"ee\r+gd<f h+e#e,e1h\t/e%=ee\bg,&e\bid;6g\t9g9d8\re/h\v1fh5d:\'f 9f,ff>e/g"<e,d<f0ff4e\n d:+ee\fe-&e/e\n(i\0e\bef%i.g-f,fg>i#g;?h\t2g(3e.g;\bd:gg\t)d>f1fg\ve\nid8%i\rf08h?egf\tig+d:\te/9h1!h49g(d8\re%=g;e/9e\re\bd?h?g9h/e=1i3d<e\n?d8\re0f,#h5e96d8f\tg9f9ee(f0d?!g(h.>f=e="h1!h5f <g*g 4ig\0i\re$\'d:f/f/d8f:h=e\fe7%e.\fg>eeg;d8\0e:g\t\bf\ti\0 g"ef&e5g(d:d?ge g4 d8-e\ve-e(h44e>f\0fi?fe#d;7gh4"e:e0e.\tff-&f1\ti\fi"e\be;:e$)g):i&e\be.\fei)1e\n(d8\vi"d8\re\rh/d?!fd9\ti3e\th\v1e=f<d:.ed:\vg)e.6g>$d<ef0e\r3e/e\rg(1e.6e7e\n(g;f3e\b0f3(fe0e-&f\0\'h=h\0g g!,d;6h\'g\vf8f%fg,i&i i;ii\0g(f1h\vge.d8;g.!i6f.5h(;e\ng?;h/fe\b)ee%=d<<d9i\0h./f=e7%g\v\0f\vd9h.8g/d?e9e;f&e?5e$\'e\vf:g%(gh\'#e\f?e\rcuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestC!nnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegC:nbuenosvolverpuntossemanahabC-aagostonuevosunidoscarlosequiponiC1osmuchosalgunacorreoimagenpartirarribamarC-ahombreempleoverdadcambiomuchasfueronpasadolC-neaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposserC!neuropamediosfrenteacercademC!sofertacochesmodeloitalialetrasalgC:ncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrC!puestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosC:nicocaminositiosrazC3ndebidopruebatoledotenC-ajesC:sesperococinaorigentiendacientocC!dizhablarserC-alatinafuerzaestiloguerraentrarC)xitolC3pezagendavC-deoevitarpaginametrosjavierpadresfC!cilcabezaC!reassalidaenvC-ojapC3nabusosbienestextosllevarpuedanfuertecomC:nclaseshumanotenidobilbaounidadestC!seditarcreadoP4P;QQQP>P:P0P:P8P;P8Q\rQP>P2QP5P5P3P>P?Q\0P8QP0P:P5Q\tP5QP6P5PP0P:P1P5P7P1Q\vP;P>P=P8PQP5P?P>P4P-QP>QP>P<QP5P<P=P5QP;P5QQ\0P0P7P>P=P0P3P4P5P<P=P5PP;QPQ\0P8P=P0QP=P8QQP5P<P:QP>P3P>P4P2P>QQP0P<P!P(PP<P0QP\'QP>P2P0QP2P0P<P5P<QP"P0P:P4P2P0P=P0P<Q\rQP8Q\rQQPP0P<QP5QP?Q\0P>QQQP=P0P4P4P=QPP>QQQ\0P8P=P5P9PP0QP=P8P<QP0P<QP>QQ\0QP1PP=P8P<P8Q\0P=P5P5PPPP;P8QQ\rQP0PP=P0P=P5P<P4P>P<P<P>P9P4P2P5P>P=P>QQP4`$`%`$9`%\b`$`%\0`$8`%`$`$>`$`%\v`$`$0`$*`$0`$(`%`$`$`$`$?`$-`%\0`$`$8`$`$0`$$`%\v`$9`%\v`$`$*`$9`%\0`$/`$9`$/`$>`$$`$`$%`$>jagran`$`$`$`%\v`$`$,`$&`%\v`$`$\b`$`$>`$`$`$9`$.`$`$(`$5`$9`$/`%`$%`%`$%`%\0`$`$0`$`$,`$&`%\0`$`$\b`$`%\0`$5`%`$(`$\b`$(`$`$9`$0`$\t`$8`$.`%`$`$.`$5`%\v`$2`%`$8`$,`$.`$\b`$&`%`$`$0`$`$.`$,`$8`$-`$0`$,`$(`$`$2`$.`$(`$`$`$8`%\0`$2`%\0X9YY\tX%YY\tYX0X\'X"X.X1X9X/X/X\'YY\tYX0YX5Y\bX1X:Y\nX1YX\'YY\bYX\'X(Y\nYX9X1X6X0YYYYX\'Y\nY\bYYX\'YX9YY\nX\'YX\'YYYX-X*Y\tYX(YY\bX-X)X\'X.X1YYX7X9X(X/X1YYX%X0X\'YYX\'X\'X-X/X%YX\'YY\nYX(X9X6YY\nYX(X-X+Y\bYYY\bYY\bX#YX\'X,X/X\'YYX\'X3YYX9YX/YY\nX3X9X(X1X5YY\tYYX0X(YX\'X#YYYX+YYYX*X\'YX\'X-Y\nX+YX5X1X4X1X-X-Y\bYY\bYY\nX\'X0X\'YYYYX1X)X\'YX*X\'YYX#X(Y\bX.X\'X5X#YX*X\'YYX\'YY\nX9X6Y\bY\bYX/X\'X(YX.Y\nX1X(YX*YYYX4X\'X!Y\bYY\nX\'X(Y\bYX5X5Y\bYX\'X1YYX#X-X/YX-YX9X/YX1X#Y\nX\'X-X)YX*X(X/Y\bYY\nX,X(YYYX*X-X*X,YX)X3YX)Y\nX*YYX1X)X:X2X)YYX3X(Y\nX*YYYYYX\'X*YYYYX(YYX\'X9YYX#Y\bYX4Y\nX!YY\bX1X#YX\'YY\nYX(YYX0X\'X*X1X*X(X(X#YYYX3X\'YYX(Y\nX9YYX/X-X3YYYYX4X9X1X#YYX4YX1YX7X1X7YX(profileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>\r\nwrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1\']);\nconfirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.\n\nThe but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})();\r\npaymenttroubleconceptcompareparentsplayersregionsmonitor \'\'The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen\n\nWhen observe</h2>\r\nModern provide" alt="borders.\n\nFor \n\nMany artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>\r\n Countryignoredloss ofjust asGeorgiastrange<head><stopped1\']);\r\nislandsnotableborder:list ofcarried100,000</h3>\n severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})();\n\nburningoperatedegreessource=Richardcloselyplasticentries</tr>\r\ncolor:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br />\n: true,chartertourismclassicproceedexplain</h1>\r\nonline.?xml vehelpingdiamonduse theairlineend --\x3e).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn\'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e&quot;tradingleft">\npersonsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy\n\t\t\x3c!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| [];\nDATA[ *kitchenmountedactual dialectmainly _blank\'installexpertsif(typeIt also&copy; ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in\n\t\x3c!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday\'s.html" target=wearingAll Rig;\n})();raising Also, crucialabout">declare--\x3e\n<scfirefoxas muchappliesindex, s, but type = \n\r\n\x3c!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>\r\n returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of\n\nSome \'click\'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu">\nmonthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND --\x3efamous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>\nevidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>\n he left).val()false);logicalbankinghome tonaming Arizonacredits);\n});\nfounderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag --\x3eAdding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered\']);\n has theunclearEvent\',both innot all\n\n\x3c!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&amp;as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don\'tretreat. Some ww.");\nbombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>\n\n. When in bothdismissExplorealways via thespaC1olwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--\x3e</able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>\n\t\tit intoranked rate oful>\r\n attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture--\x3e\r\n\r\n rows=" objectinverse<footerCustomV><\\/scrsolvingChamberslaverywoundedwhereas!= \'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead\')[0Criticsstudios>&copy;group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr\'+\'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" />\n\t\there isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();\n is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of});\r\n immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0];\n it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen\'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in\']);\r\n marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = \'make a securedBaptistvoting \n\t\tvar March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header\n<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--\x3e\x3c!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;">\r\npushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>\npeople.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />\r\nAtlantanucleusCounty,purely count">easily build aonclicka givenpointerh&quot;events else {\nditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a >\r\n\r\n\r\nmarket.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks">\n();" rea place\\u003Caabout atr>\r\n\t\tccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>\r\n<ustomVa;&gt;</importsor thatmostly &amp;re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>\r\n\r\n<!organis <br />BeijingcatalC deutscheuropeueuskaragaeilgesvenskaespaC1amensajeusuariotrabajomC)xicopC!ginasiempresistemaoctubreduranteaC1adirempresamomentonuestroprimeratravC)sgraciasnuestraprocesoestadoscalidadpersonanC:meroacuerdomC:sicamiembroofertasalgunospaC-sesejemploderechoademC!sprivadoagregarenlacesposiblehotelessevillaprimeroC:ltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseC1oturismocC3digoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastC-tuloconocersegundoconsejofranciaminutossegundatenemosefectosmC!lagasesiC3nrevistagranadacompraringresogarcC-aacciC3necuadorquienesinclusodeberC!materiahombresmuestrapodrC-amaC1anaC:ltimaestamosoficialtambienningC:nsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern title="LocationcontractvisitorsDownloadwithout right">\nmeasureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2>\n keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" (&quot;graduate</head>\ncommercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>\n\t\t<select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--&gt;\n\ncoveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a>\r\nelectricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: \'http:\'script\'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending&hellip;new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks">\n\t<title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"EspaC1olreleasessubmit" er&quot;additionsymptomsorientedresourceright"><pleasurestationshistory.leaving border=contentscenter">.\n\nSome directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa &quot;allowingDocumentrevision. \n\nThe yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary\n\nAfter guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>\n\taffectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions"campbell\x3c!-- end</span><<br />\r\n_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=" Companyexamples<iframe believespresentsmarshallpart of properly).\n\nThe taxonomymuch of </span>\n" data-srtuguC*sscrollTo project<head>\r\nattorneyemphasissponsorsfancyboxworld\'s wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix\n<head>\narticle <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript">\n&nbsp;</<tr><td height:2/productcountry include footer" &lt;!-- title"></jquery.</form>\n(g.\0d=)(g9i+)hrvatskiitalianoromC"nDtC<rkC\'eX\'X1X/Y\btambiC)nnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuC)sdeportesproyectoproductopC:bliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniC3nimprimirmientrasamC)ricavendedorsociedadrespectorealizarregistropalabrasinterC)sentoncesespecialmiembrosrealidadcC3rdobazaragozapC!ginassocialesbloqueargestiC3nalquilersistemascienciascompletoversiC3ncompletaestudiospC:blicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayorC-aalemaniafunciC3nC:ltimoshaciendoaquellosediciC3nfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojC3venesdistritotC)cnicaconjuntoenergC-atrabajarasturiasrecienteutilizarboletC-nsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallaprC3ximoalmerC-aanimalesquiC)nescorazC3nsecciC3nbuscandoopcionesexteriorconceptotodavC-agalerC-aescribirmedicinalicenciaconsultaaspectoscrC-ticadC3laresjusticiadeberC!nperC-odonecesitamantenerpequeC1orecibidatribunaltenerifecanciC3ncanariasdescargadiversosmallorcarequieretC)cnicodeberC-aviviendafinanzasadelantefuncionaconsejosdifC-cilciudadesantiguasavanzadatC)rminounidadessC!nchezcampaC1asoftonicrevistascontienesectoresmomentosfacultadcrC)ditodiversassupuestofactoressegundospequeC1aP3P>P4P0P5QP;P8P5QQQ\fP1Q\vP;P>P1Q\vQQ\fQ\rQP>P<PQP;P8QP>P3P>P<P5P=QP2QP5QQ\rQP>P9P4P0P6P5P1Q\vP;P8P3P>P4QP4P5P=Q\fQ\rQP>QP1Q\vP;P0QP5P1QP>P4P8P=QP5P1P5P=P0P4P>QP0P9QQP>QP>P=P5P3P>QP2P>P8QP2P>P9P8P3Q\0Q\vQP>P6P5P2QP5P<QP2P>QP;P8Q\bQ\fQ\rQP8QP?P>P:P0P4P=P5P9P4P>P<P0P<P8Q\0P0P;P8P1P>QP5P<QQP>QQP4P2QQQP5QP8P;QP4P8P4P5P;P>P<P8Q\0P5QP5P1QQP2P>P5P2P8P4P5QP5P3P>Q\rQP8P<QQP5QQP5P<Q\vQP5P=Q\vQQP0P;P2P5P4Q\fQP5P<P5P2P>P4Q\vQP5P1P5P2Q\vQ\bP5P=P0P<P8QP8P?P0QP>P<QP?Q\0P0P2P;P8QP0P>P4P=P0P3P>P4Q\vP7P=P0QP<P>P3QP4Q\0QP3P2QP5P9P8P4P5QP:P8P=P>P>P4P=P>P4P5P;P0P4P5P;P5QQ\0P>P:P8QP=QP2P5QQ\fPQQQ\fQ\0P0P7P0P=P0Q\bP8X\'YYYX\'YX*Y\nX,YY\nX9X.X\'X5X)X\'YX0Y\nX9YY\nYX,X/Y\nX/X\'YX"YX\'YX1X/X*X-YYX5YX-X)YX\'YX*X\'YYY\nY\nYY\bYX4X(YX)YY\nYX\'X(YX\'X*X-Y\bX\'X!X#YX+X1X.YX\'YX\'YX-X(X/YY\nYX/X1Y\bX3X\'X6X:X7X*YY\bYYYX\'YX3X\'X-X)YX\'X/Y\nX\'YX7X(X9YY\nYX4YX1X\'Y\nYYYYYYX\'X4X1YX)X1X&Y\nX3YX4Y\nX7YX\'X0X\'X\'YYYX4X(X\'X(X*X9X(X1X1X-YX)YX\'YX)Y\nYY\bYYX1YX2YYYX)X#X-YX/YYX(Y\nY\nX9YY\nX5Y\bX1X)X7X1Y\nYX4X\'X1YX,Y\bX\'YX#X.X1Y\tYX9YX\'X\'X(X-X+X9X1Y\bX6X(X4YYYX3X,YX(YX\'YX.X\'YX/YX*X\'X(YYY\nX)X(X/Y\bYX#Y\nX6X\'Y\nY\bX,X/YX1Y\nYYX*X(X*X#YX6YYX7X(X.X\'YX+X1X(X\'X1YX\'YX6YX\'X-YY\tYYX3YX#Y\nX\'YX1X/Y\bX/X#YYX\'X/Y\nYX\'X\'YX\'YYX9X1X6X*X9YYX/X\'X.YYYYY\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\b\t\n\v\f\r\r\f\v\n\t\b\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\b\0\b\0\b\0\b\0\0\0\0\0\0\0\0\0resourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter" value="</select>Australia" class="situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement" title="potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form>\r\nstatementattentionBiography} else {\nsolutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter">\nexceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFranC\'aisHollywoodexpansionstandards</style>\nreductionDecember preferredCambridgeopponentsBusiness confusion>\n<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>\nmountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to</title>\nrelationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>\nsuspectedmargin: 0spiritual</head>\n\nmicrosoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>\n\tsponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered--\x3e\r\n\x3c!--American protectedNovember </style><furnitureInternet onblur="suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir="ltr"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;\n\nsouthwestthe rightradiationmay have unescape(spoken in" href="/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>\ncame fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8" /><![CDATA[">ContactSouthern bgcolor="series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent--\x3e\n\x3c!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id="precedingTechnicalphysicistoccurs innavigatorsection">span id="sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt="in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id="right">\r\nresidenceleave thecontent">are often })();\r\nprobably Professor-button" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor\n&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved\n\nIn the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also\n<head>\n<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained"></div>\n</a></td>depend onsearch">\npieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue="">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.\n\nAfter , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover" style="states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as Serviceslocation and oftenmeasuringand it ispaperbackvalues of\r\n<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href="y:inline;Church ofthe eventvery highofficial -height: content="/cgi-bin/to createafrikaansesperantofranC\'aislatvieE!ulietuviE3D\feE!tinaD\reE!tina`9`8`8"f%f,h*g.\0d=e-g9i+e-mj5-l4d8:d;\0d9\bh.!g.f:g,h.0f,h(h+e\r\0f\re\n!e(d:hg=f\b?e0d:\'d?1d9i(e:g\t\bg$>fh!\ff&i(h=f <h?d8\0f-%f/d;e.i*\fh/g e\'ed<f0f\r.e:f6\bh49h\0e\ne,e.$h.(h.:e\f:f71e3e8f-f>e(e\fd:,e8e$\'e-&gh6\nf%h6\ng.!ged?!f/g=serviciosartC-culoargentinabarcelonacualquierpublicadoproductospolC-ticarespuestawikipediasiguientebC:squedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciC3nnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomC-aimC!genescontactardescargarnecesarioatenciC3ntelC)fonocomisiC3ncancionescapacidadencontraranC!lisisfavoritostC)rminosprovinciaetiquetaselementosfuncionesresultadocarC!cterpropiedadprincipionecesidadmunicipalcreaciC3ndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzC!lezdocumentopelC-cularecientesgeneralestarragonaprC!cticanovedadespropuestapacientestC)cnicasobjetivoscontactos`$.`%`$`$2`$?`$`$9`%\b`$`$`$/`$>`$8`$>`$%`$`$5`$`$0`$9`%`$`%\v`$\b`$`%`$`$0`$9`$>`$,`$>`$&`$`$9`$>`$8`$-`%\0`$9`%`$`$0`$9`%\0`$.`%\b`$`$&`$?`$(`$,`$>`$$diplodocs`$8`$.`$/`$0`%`$*`$(`$>`$.`$*`$$`$>`$+`$?`$0`$`$8`$$`$$`$0`$9`$2`%\v`$`$9`%`$`$,`$>`$0`$&`%`$6`$9`%`$\b`$`%`$2`$/`$&`$?`$`$>`$.`$5`%`$,`$$`%\0`$(`$,`%\0`$`$.`%\f`$$`$8`$>`$2`$2`%`$`$`%\t`$,`$.`$&`$&`$$`$%`$>`$(`$9`%\0`$6`$9`$0`$`$2`$`$`$-`%\0`$(`$`$0`$*`$>`$8`$0`$>`$$`$`$?`$`$\t`$8`%`$`$/`%\0`$9`%`$`$`$`%`$`%\0`$.`$`%\v`$`$`$>`$0`$`$-`%\0`$`$/`%`$$`%`$.`$5`%\v`$`$&`%`$`$`$`$0`$`$8`%`$.`%`$2`$2`$`$>`$9`$>`$2`$\n`$*`$0`$`$>`$0`$`$8`$>`$&`%`$0`$`$?`$8`$&`$?`$2`$,`$`$&`$,`$(`$>`$9`%`$`$2`$>`$`$`%\0`$$`$,`$`$(`$.`$?`$2`$`$8`%`$`$(`%`$(`$/`$>`$`%`$2`$2`%\t`$`$-`$>`$`$0`%`$2`$`$`$9`$0`$>`$.`$2`$`%`$*`%`$`$9`$>`$%`$`$8`%\0`$8`$9`%\0`$`$2`$>`$ `%\0`$`$9`$>`$`$&`%`$0`$$`$9`$$`$8`$>`$$`$/`$>`$&`$`$/`$>`$*`$>`$`$`%\f`$(`$6`$>`$.`$&`%`$`$/`$9`%\0`$0`$>`$/`$`%`$&`$2`$`%\0categoriesexperience</title>\r\nCopyright javascriptconditionseverything<p class="technologybackground<a class="management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox" techniquesprotectionapparentlyas well asunt\', \'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor="#especially content="productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=".indexOf("conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus="<form id="processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png" (document,boundariesexpressionsettlementBackgroundout of theenterprise("https:" unescape("password" democratic<a href="/wrapper">\nmembershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick="considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic" height="link rel=".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class="0px;marginmechanicalstatisticscelebratedGovernment\n\nDuring tdevelopersartificialequivalentoriginatedCommissionattachment<span id="there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang="en" </style>\r\nabsolute; supportingextremely mainstream</strong> popularityemployment</table>\r\n colspan="</form>\n conversionabout the </p></div>integrated" lang="enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class="<a title="(includingparametersprohibited= "http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0" class="completelyillustratefive yearsinstrumentPublishing1" class="psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;\nfunction it was theConventionautomobileProtestantaggressiveafter the Similarly," /></div>collection\r\nfunctionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>\n</.indexOf(\'i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }\n</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt="adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css"\tfunction innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>\n\tdiplomaticcontainingperformingextensionsmay not beconcept of onclick="It is alsofinancial making theLuxembourgadditionalare calledengaged in"script");but it waselectroniconsubmit="\n\x3c!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences\n</head>\r\nrecognisedinitializelimited toAlexandriaretirementAdventuresfour years\n\n&lt;!-- increasingdecorationh3 class="origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews" width="1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class="Scientificclass="no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional\n<head>\n<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix">the publicmany yearswhich wereover time,synonymouscontent">\npresumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan="only a fewmeant thatled to the--\x3e\r\n<div <fieldset>Archbishop class="nobeing usedapproachesprivilegesnoscript>\nresults inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript>\r/index.phparrival of-jssdk\'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>\n\t\tcomplaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>\npercentagebest-knowncreating a" dir="ltrLieutenant\n<div id="they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren\'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.\n\nIn the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/" class="geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid="searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured">is said tostructuralreferendummost oftena separate->\n<div id Official worldwide.aria-labelthe planetand it wasd" value="looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id="opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/" title=".com/indextaking thepittsburghcontent">\r<script>(fturned outhaving the</span>\r\n occasionalbecause itstarted tophysically></div>\n created byCurrently, bgcolor="tabindex="disastrousAnalytics also has a><div id="</style>\n<called forsinger and.src = "//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguC*sW"WW(WW*YX\'X1X3[\fdesarrollocomentarioeducaciC3nseptiembreregistradodirecciC3nubicaciC3npublicidadrespuestasresultadosimportantereservadosartC-culosdiferentessiguientesrepC:blicasituaciC3nministerioprivacidaddirectorioformaciC3npoblaciC3npresidentecont','enidosaccesoriostechnoratipersonalescategorC-aespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolC-ticasanterioresdocumentosnaturalezamaterialesdiferenciaeconC3micatransporterodrC-guezparticiparencuentrandiscusiC3nestructurafundaciC3nfrecuentespermanentetotalmenteP<P>P6P=P>P1QP4P5QP<P>P6P5QP2Q\0P5P<QQP0P:P6P5QQP>P1Q\vP1P>P;P5P5P>QP5P=Q\fQ\rQP>P3P>P:P>P3P4P0P?P>QP;P5P2QP5P3P>QP0P9QP5QP5Q\0P5P7P<P>P3QQQP0P9QP0P6P8P7P=P8P<P5P6P4QP1QP4QQPP>P8QP:P7P4P5QQ\fP2P8P4P5P>QP2QP7P8P=QP6P=P>QP2P>P5P9P;QP4P5P9P?P>Q\0P=P>P<P=P>P3P>P4P5QP5P9QP2P>P8QP?Q\0P0P2P0QP0P:P>P9P<P5QQP>P8P<P5P5QP6P8P7P=Q\fP>P4P=P>P9P;QQQ\bP5P?P5Q\0P5P4QP0QQP8QP0QQQ\fQ\0P0P1P>QP=P>P2Q\vQP?Q\0P0P2P>QP>P1P>P9P?P>QP>P<P<P5P=P5P5QP8QP;P5P=P>P2Q\vP5QQP;QP3P>P:P>P;P>P=P0P7P0P4QP0P:P>P5QP>P3P4P0P?P>QQP8PP>QP;P5QP0P:P8P5P=P>P2Q\vP9QQP>P8QQP0P:P8QQQ\0P0P7QP!P0P=P:QQP>Q\0QP<PP>P3P4P0P:P=P8P3P8QP;P>P2P0P=P0Q\bP5P9P=P0P9QP8QP2P>P8P<QP2QP7Q\fP;QP1P>P9QP0QQP>QQ\0P5P4P8PQ\0P>P<P5P$P>Q\0QP<Q\0Q\vP=P:P5QQP0P;P8P?P>P8QP:QQ\vQQQP<P5QQQQP5P=QQ\0QQ\0QP4P0QP0P<Q\vQQ\0Q\vP=P:P0PP>P2Q\vP9QP0QP>P2P<P5QQP0QP8P;Q\fP<P<P0Q\0QP0QQQ\0P0P=P<P5QQP5QP5P:QQP=P0Q\bP8QP<P8P=QQP8P<P5P=P8P8P<P5QQP=P>P<P5Q\0P3P>Q\0P>P4QP0P<P>P<Q\rQP>P<QP:P>P=QP5QP2P>P5P<P:P0P:P>P9PQ\0QP8P2YYX*X/Y\tX%X1X3X\'YX1X3X\'YX)X\'YX9X\'YYX*X(YX\'X(X1X\'YX,X\'YY\nY\bYX\'YX5Y\bX1X,X/Y\nX/X)X\'YX9X6Y\bX%X6X\'YX)X\'YYX3YX\'YX9X\'X(X*X-YY\nYYYYX\'X*YYX*YY\tX*X9X/Y\nYX\'YX4X9X1X#X.X(X\'X1X*X7Y\bY\nX1X9YY\nYYX%X1YX\'YX7YX(X\'X*X\'YYX:X)X*X1X*Y\nX(X\'YYX\'X3X\'YX4Y\nX.YYX*X/Y\nX\'YX9X1X(X\'YYX5X5X\'YYX\'YX9YY\nYX\'X*X-X/Y\nX+X\'YYYYX\'YX9YYYYX*X(X)Y\nYYYYX\'YX7YYYY\nX/Y\nY\bX%X/X\'X1X)X*X\'X1Y\nX.X\'YX5X-X)X*X3X,Y\nYX\'YY\bYX*X9YX/YX\'YX/Y\nYX)X*X5YY\nYX#X1X4Y\nYX\'YX0Y\nYX9X1X(Y\nX)X(Y\bX\'X(X)X#YX9X\'X(X\'YX3YX1YX4X\'YYX*X9X\'YY\tX\'YX#Y\bYX\'YX3YX)X,X\'YX9X)X\'YX5X-YX\'YX/Y\nYYYYX\'X*X\'YX.X\'X5X\'YYYYX#X9X6X\'X!YX*X\'X(X)X\'YX.Y\nX1X1X3X\'X&YX\'YYYX(X\'YX#X/X(YYX\'X7X9YX1X\'X3YYYX7YX)X\'YYX*X(X\'YX1X,YX\'X4X*X1YX\'YYX/YY\nX9X7Y\nYsByTagName(.jpg" alt="1px solid #.gif" alt="transparentinformationapplication" onclick="establishedadvertising.png" alt="environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright">0" height="even thoughreplacementdestinationCorporation<ul class="AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class="hundreds of\n\nHowever, compositionclear:both;cooperationwithin the label for="border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength="switzerlandDevelopmentessentially\n\nAlthough </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics\n\t<div id="illustratedengineeringterritoriesauthoritiesdistributed6" height="sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class="more recentit has beeninvasion of).getTime()fundamentalDespite the"><div id="inspirationexaminationpreparationexplanation<input id="</a></span>versions ofinstrumentsbefore the = \'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content">\n<td class="undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src="/<h1 class="publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=";width:100%independent<h3 class=" onchange=").addClass(interactionOne of the daughter ofaccessoriesbranches of\r\n<div id="the largestdeclarationregulationsInformationtranslationdocumentaryin order to">\n<head>\n<" height="1across the orientation);<\/script>implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class="distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>\n</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>\n selected="high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex="it could be<noscript>\nhaving been\r\n<head>\r\n< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval"></span></in New Yorkadditional compression\n\n<div id="incorporate;<\/script><attachEventbecame the " target="_carried outSome of thescience andthe time ofContainer">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>\r\nContinentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel="This is the <a href="/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og="><a class="class="textConversion may be usedmanufactureafter beingclearfix">\nquestion ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment\r\n</head>\r\nConversely,>\n<div id="0" width="1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious">this is notthe presentif they areand finallya matter of\r\n\t</div>\r\n\r\n<\/script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the<\/script>\n<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger\n\t<\/script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>\n they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world\'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the></div>\r\n\t\treflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=""><a href="themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href="/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in\t\t<div id="it" value="language ofas they areproduced inis that theexplain thediv></div>\nHowever thelead to the\t<a href="/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenD\rinacomentariosuniversidadcondicionesactividadesexperienciatecnologC-aproducciC3npuntuaciC3naplicaciC3ncontraseC1acategorC-asregistrarseprofesionaltratamientoregC-stratesecretarC-aprincipalesprotecciC3nimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociaciC3ndisponiblesevaluaciC3nestudiantesresponsableresoluciC3nguadalajararegistradosoportunidadcomercialesfotografC-aautoridadesingenierC-atelevisiC3ncompetenciaoperacionesestablecidosimplementeactualmentenavegaciC3nconformidadline-height:font-family:" : "http://applicationslink" href="specifically//<![CDATA[\nOrganizationdistribution0px; height:relationshipdevice-width<div class="<label for="registration</noscript>\n/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name="intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class="organisationcivilization19th centuryarchitectureincorporated20th century-container">most notably/></a></div>notification\'undefined\')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang="&lt;/sup&gt;dealing withphiladelphiahistorically);<\/script>\npadding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd">\r\n<htgeographicalConstitution\', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style="Encyclopediaiframe src="demonstratedaccomplisheduniversitiesDemographics);<\/script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time"><a class="In addition,description+conversationcontact withis generallyr" content="representing&lt;math&gt;presentationoccasionally<img width="navigation">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]--\x3e}\n<\/script>\nChristianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""><a href="/introductionbelonging toclaimed thatconsequences<meta name="Guide to theoverwhelmingagainst the concentrated,\n.nontouch observations</a>\n</div>\nf (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting>&nbsp;</td>container">\nsuch as the influence ofa particularsrc=\'http://navigation" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet\t<ul class="installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures\n\t\t<a href="close to theexamples of is about the(see below)." id="searchprofessionalis availablethe official\t\t<\/script>\n\n\t\t<div id="accelerationthrough the Hall of Famedescriptionstranslationsinterference type=\'text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the\t<li class="instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class="aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc="http://px; height: available tomanufacturerhuman rightslink href="/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>\r\nconsider thean estimatedthe National<div id="pagresulting incommissionedanalogous toare required/ul>\n</div>\nwas based onand became a&nbsp;&nbsp;t" value="" was capturedno more thanrespectivelycontinue to >\r\n<head>\r\n<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml" title="weight:bold;creating thedisplay:nonereplaced the<img src="/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css" media="People from available onproved to besuggestions"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class="evidence forexplanationsenvironments"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign="top"principle ofat the time,</noscript>\rsaid to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style="input name="the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class="lastworking with\'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the\n<\/script>\n\nan effort toincrease theto the southspacing="0">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>\nthought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds" content="authority ofnorthwestern</div>\n<div "></div>\r\n consultationcommunity ofthe nationalit should beparticipants align="leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class="splace in thewhere he was<li class="fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class="effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();<\/script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\\s+|\\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers\t<link rel="provided thethe story ofcompetitionsenglish (UK)english (US)PP>P=P3P>P;P!Q\0P?QP:P8QQ\0P?QP:P8QQ\0P?QP:P>YX9X1X(Y\nX)f-#i+d8-fg.\0d=d8-fg9d=d8-ff\tie,e8d::f0f?e:i?i\fe74e74g$>d<d8;d9\tf\rd=g3;g;f?g-f3h\'informaciC3nherramientaselectrC3nicodescripciC3nclasificadosconocimientopublicaciC3nrelacionadasinformC!ticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontC!ctenoshabitacionescumplimientorestaurantesdisposiciC3nconsecuenciaelectrC3nicaaplicacionesdesconectadoinstalaciC3nrealizaciC3nutilizaciC3nenciclopediaenfermedadesinstrumentosexperienciasinstituciC3nparticularessubcategoriaQP>P;Q\fP:P>P P>QQP8P8Q\0P0P1P>QQ\vP1P>P;Q\fQ\bP5P?Q\0P>QQP>P<P>P6P5QP5P4Q\0QP3P8QQP;QQP0P5QP5P9QP0QP2QP5P3P4P0P P>QQP8QPP>QP:P2P5P4Q\0QP3P8P5P3P>Q\0P>P4P0P2P>P?Q\0P>QP4P0P=P=Q\vQP4P>P;P6P=Q\vP8P<P5P=P=P>PP>QP:P2Q\vQ\0QP1P;P5P9PP>QP:P2P0QQQ\0P0P=Q\vP=P8QP5P3P>Q\0P0P1P>QP5P4P>P;P6P5P=QQP;QP3P8QP5P?P5Q\0Q\fPP4P=P0P:P>P?P>QP>P<QQ\0P0P1P>QQP0P?Q\0P5P;QP2P>P>P1Q\tP5P>P4P=P>P3P>QP2P>P5P3P>QQP0QQ\fP8P4Q\0QP3P>P9QP>Q\0QP<P5QP>Q\0P>Q\bP>P?Q\0P>QP8P2QQQ\vP;P:P0P:P0P6P4Q\vP9P2P;P0QQP8P3Q\0QP?P?Q\vP2P<P5QQP5Q\0P0P1P>QP0QP:P0P7P0P;P?P5Q\0P2Q\vP9P4P5P;P0QQ\fP4P5P=Q\fP3P8P?P5Q\0P8P>P4P1P8P7P=P5QP>QP=P>P2P5P<P>P<P5P=QP:QP?P8QQ\fP4P>P;P6P=P0Q\0P0P<P:P0QP=P0QP0P;P>P P0P1P>QP0P"P>P;Q\fP:P>QP>P2QP5P<P2QP>Q\0P>P9P=P0QP0P;P0QP?P8QP>P:QP;QP6P1Q\vQP8QQP5P<P?P5QP0QP8P=P>P2P>P3P>P?P>P<P>Q\tP8QP0P9QP>P2P?P>QP5P<QP?P>P<P>Q\tQ\fP4P>P;P6P=P>QQQ\vP;P:P8P1Q\vQQQ\0P>P4P0P=P=Q\vP5P<P=P>P3P8P5P?Q\0P>P5P:QP!P5P9QP0QP<P>P4P5P;P8QP0P:P>P3P>P>P=P;P0P9P=P3P>Q\0P>P4P5P2P5Q\0QP8QQQQ\0P0P=P5QP8P;Q\fP<Q\vQQ\0P>P2P=QQ\0P0P7P=Q\vQP8QP:P0QQ\fP=P5P4P5P;QQP=P2P0Q\0QP<P5P=Q\fQ\bP5P<P=P>P3P8QP4P0P=P=P>P9P7P=P0QP8QP=P5P;Q\fP7QQP>Q\0QP<P0P"P5P?P5Q\0Q\fP<P5QQQP0P7P0Q\tP8QQ\vPQQQ\bP8P5`$(`$9`%\0`$`$`$0`$(`%`$`$*`$(`%`$`$?`$/`$>`$`$0`%`$`$`$(`%\r`$/`$`%\r`$/`$>`$`$>`$`$!`$,`$>`$0`%`$`$?`$8`%\0`$&`$?`$/`$>`$*`$9`$2`%`$8`$?`$`$9`$-`$>`$0`$$`$`$*`$(`%\0`$5`$>`$2`%`$8`%`$5`$>`$`$0`$$`%`$.`%`$0`%`$9`%\v`$(`%`$8`$`$$`%`$,`$9`%`$$`$8`$>`$`$`$9`%\v`$`$>`$`$>`$(`%`$.`$?`$(`$`$`$0`$$`$>`$`$0`$(`$>`$\t`$(`$`%`$/`$9`$>`$`$8`$,`$8`%`$-`$>`$7`$>`$`$*`$`%`$2`$?`$/`%`$6`%`$0`%`$`$8`$`%`$`$`$`%`$.`%`$0`%\0`$8`$`$$`$>`$.`%`$0`$>`$2`%`$`$0`$`$\'`$?`$`$`$*`$(`$>`$8`$.`$>`$`$.`%`$`%`$`$>`$0`$#`$9`%\v`$$`$>`$`$!`$<`%\0`$/`$9`$>`$`$9`%\v`$`$2`$6`$,`%\r`$&`$2`$?`$/`$>`$`%\0`$5`$(`$`$>`$$`$>`$`%\b`$8`%`$`$*`$`$>`$5`$>`$2`%\0`$&`%`$(`%`$*`%`$0`%\0`$*`$>`$(`%\0`$\t`$8`$`%`$9`%\v`$`%\0`$,`%\b`$ `$`$`$*`$`%\0`$5`$0`%\r`$7`$`$>`$`$5`$`$*`$`%\v`$`$?`$2`$>`$`$>`$(`$>`$8`$9`$.`$$`$9`$.`%`$`$\t`$(`$`%\0`$/`$>`$9`%`$&`$0`%\r`$`$8`%`$`%\0`$*`$8`$`$&`$8`$5`$>`$2`$9`%\v`$(`$>`$9`%\v`$$`%\0`$`%\b`$8`%`$5`$>`$*`$8`$`$(`$$`$>`$(`%`$$`$>`$`$>`$0`%\0`$`$>`$/`$2`$`$?`$2`%`$(`%\0`$`%`$`$>`$`$`$*`$$`%\r`$0`$`%`$`$2`$`$>`$$`%`$,`$>`$9`$0`$`$*`$(`%`$5`$>`$9`$(`$`$8`$`$>`$8`%`$,`$9`$0`$9`$(`%`$`$8`$8`%`$8`$9`$?`$$`$,`$!`$<`%`$`$`$(`$>`$$`$2`$>`$6`$*`$>`$`$`$6`%\r`$0`%\0`$,`$!`$<`%\0`$9`%\v`$$`%`$8`$>`$\b`$`$6`$>`$/`$&`$8`$`$$`%\0`$`$>`$$`%\0`$5`$>`$2`$>`$9`$`$>`$0`$*`$`$(`$>`$0`$`$(`%`$8`$!`$<`$`$.`$?`$2`$>`$\t`$8`$`%\0`$`%`$5`$2`$2`$`$$`$>`$`$>`$(`$>`$`$0`%\r`$%`$`$9`$>`$`$&`%`$`$>`$*`$9`$2`%\0`$(`$?`$/`$.`$,`$?`$(`$>`$,`%\b`$`$`$`$9`%\0`$`$`$9`$(`$>`$&`%`$$`$>`$9`$.`$2`%`$`$>`$+`%\0`$`$,`$`$?`$$`%`$0`$$`$.`$>`$`$`$5`$9`%\0`$`$0`%\v`$`$<`$.`$?`$2`%\0`$`$0`%\v`$*`$8`%`$(`$>`$/`$>`$&`$5`$2`%`$(`%`$`$>`$$`$>`$`$0`%\0`$,`$\t`$(`$`$>`$`$5`$>`$,`$*`%`$0`$>`$,`$!`$<`$>`$8`%\f`$&`$>`$6`%`$/`$0`$`$?`$/`%`$`$9`$>`$`$`$`$8`$0`$,`$(`$>`$`$5`$9`$>`$`$8`%\r`$%`$2`$.`$?`$2`%`$2`%`$`$`$5`$?`$7`$/`$`%\r`$0`$`$8`$.`%`$9`$%`$>`$(`$>X*X3X*X7Y\nX9YX4X\'X1YX)X(Y\bX\'X3X7X)X\'YX5YX-X)YY\bX\'X6Y\nX9X\'YX.X\'X5X)X\'YYX2Y\nX/X\'YX9X\'YX)X\'YYX\'X*X(X\'YX1X/Y\bX/X(X1YX\'YX,X\'YX/Y\bYX)X\'YX9X\'YYX\'YYY\bYX9X\'YX9X1X(Y\nX\'YX3X1Y\nX9X\'YX,Y\bX\'YX\'YX0YX\'X(X\'YX-Y\nX\'X)X\'YX-YY\bYX\'YYX1Y\nYX\'YX9X1X\'YYX-YY\bX8X)X\'YX+X\'YY\nYX4X\'YX/X)X\'YYX1X#X)X\'YYX1X"YX\'YX4X(X\'X(X\'YX-Y\bX\'X1X\'YX,X/Y\nX/X\'YX#X3X1X)X\'YX9YY\bYYX,YY\bX9X)X\'YX1X-YYX\'YYYX\'X7YYX3X7Y\nYX\'YYY\bY\nX*X\'YX/YY\nX\'X(X1YX\'X*YX\'YX1Y\nX\'X6X*X-Y\nX\'X*Y\nX(X*Y\bYY\nX*X\'YX#Y\bYY\tX\'YX(X1Y\nX/X\'YYYX\'YX\'YX1X\'X(X7X\'YX4X.X5Y\nX3Y\nX\'X1X\'X*X\'YX+X\'YX+X\'YX5YX\'X)X\'YX-X/Y\nX+X\'YX2Y\bX\'X1X\'YX.YY\nX,X\'YX,YY\nX9X\'YX9X\'YYX\'YX,YX\'YX\'YX3X\'X9X)YX4X\'YX/YX\'YX1X&Y\nX3X\'YX/X.Y\bYX\'YYYY\nX)X\'YYX*X\'X(X\'YX/Y\bX1Y\nX\'YX/X1Y\bX3X\'X3X*X:X1YX*X5X\'YY\nYX\'YX(YX\'X*X\'YX9X8Y\nYentertainmentunderstanding = function().jpg" width="configuration.png" width="<body class="Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=""><img src="/distinguishedthousands of communicationclear"></div>investigationfavicon.ico" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch" type="form method="as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of" maxlength="return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type="the number ofthe original comprehensiverefers to the</ul>\n</div>\nphilosophicallocation.hrefwas publishedSan Francisco(function(){\n<div id="mainsophisticatedmathematical /head>\r\n<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder="; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript" src="/(function() {are available\n\t<link rel=" src=\'http://interested inconventional " alt="" /></are generallyhas also beenmost popular correspondingcredited withtyle="border:</a></span></.gif" width="<iframe src="table class="inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name="or" content="controversialproperty="og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style="known as the shortly afterfor instance,described as /head>\n<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant" border="0">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name="searchattributed tocourse of themathematicianby the end ofat the end of" border="0" technological.removeClass(branch of theevidence that![endif]--\x3e\r\nInstitute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href="confused with<link href="/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>\n</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription" determine theavailable forAccording to wide range of\t<div class="more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover="because they async = true;problems withseems to havethe result of src="http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld\'s firstclassified asbottom of the(particularlyalign="left" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout="New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to\t<meta name="are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to\t\t<ul class="visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style="equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these\n<div class="input class="replaced withis one of theeducation andinfluenced byreputation as\n<meta name="accommodation</div>\n</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the\n<div style="almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in" value="" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class="mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass="headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;\n<\/script>\n<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle="marginincluding thebahasa Melayunorsk bokmC%lnorsk nynorskslovenE!D\rinainternacionalcalificaciC3ncomunicaciC3nconstrucciC3n"><div class="disambiguationDomainName\', \'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]--\x3e\n</><meta name="implementationinfrastructurerepresentationborder-bottom:</head>\n<body>=http%3A%2F%2F<form method="method="post" /favicon.ico" });\n<\/script>\n.setAttribute(Administration= new Array();<![endif]--\x3e\r\ndisplay:block;Unfortunately,">&nbsp;</div>/favicon.ico">=\'stylesheet\' identification, for example,<li><a href="/an alternativeas a result ofpt"><\/script>\ntype="submit" \n(function() {recommendationform action="/transformationreconstruction.style.display According to hidden" name="along with thedocument.body.approximately Communicationspost" action="meaning &quot;--<![endif]--\x3ePrime Ministercharacteristic</a> <a class=the history of onmouseover="the governmenthref="https://was originallywas introducedclassificationrepresentativeare considered<![endif]--\x3e\n\ndepends on theUniversity of in contrast to placeholder="in the case ofinternational constitutionalstyle="border-: function() {Because of the-strict.dtd">\n<table class="accompanied byaccount of the<script src="/nature of the the people in in addition tos); js.id = id" width="100%"regarding the Roman Catholican independentfollowing the .gif" width="1the following discriminationarchaeologicalprime minister.js"><\/script>combination of marginwidth="createElement(w.attachEvent(</a></td></tr>src="https://aIn particular, align="left" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html" title="(function () {comes from theapplication of<span class="sbelieved to beement(\'script\'</a>\n</li>\n<livery different><span class="option value="(also known as\t<li><a href="><input name="separated fromreferred to as valign="top">founder of theattempting to carbon dioxide\n\n<div class="class="search-/body>\n</html>opportunity tocommunications</head>\r\n<body style="width:Tia:?ng Via;tchanges in theborder-color:#0" border="0" </span></div><was discovered" type="text" );\n<\/script>\n\nDepartment of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>\n\n<div iwas consideredpercent of the" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href=\'http://whether or notThere are alsothere are manya small numberother parts ofimpossible to class="buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=" method="post"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign="right">many countriesfor many yearsearliest knownbecause it waspt"><\/script>\r valign="top" inhabitants offollowing year\r\n<div class="million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style="color:although therebest known forsubmit" name="multiplicationmore than one recognition ofCouncil of theedition of the <meta name="Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class="descendants of<span class="i align="right"</head>\n<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the\t<span class="is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class="<span class="t(Math.random()most prominentdescription ofConstantinoplewere published<div class="seappears in the1" height="1" most importantwhich includeswhich had beendestruction ofthe population\n\t<div class="possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle="clear:b\r\n<\/script>\r\n<was founded ininterview with_id" content="capital of the\r\n<link rel="srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class="cperformance of(function() {\rif and only ifregions of theleading to therelations withUnited Nationsstyle="height:other than theype" content="Association of\n</head>\n<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>\n<link rel=" return false;the purpose ofthe ability to;color:#fff}\n.\n<span class="the subject ofdefinitions of>\r\n<link rel="claim that thehave developed<table width="celebration ofFollowing the to distinguish<span class="btakes place inunder the namenoted that the><![endif]--\x3e\nstyle="margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id="was eventuallythroughout histhe differencesomething thatspan></span></significantly ><\/script>\r\n\r\nenvironmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made" src="http://interpreted assecond half ofcrolling="no" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class="footerand especiallytype="button" </span></span>which included>\n<meta name="considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process <div class="the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class="ptext" name="q"\t\t<div class="the scientificrepresented bymathematicianselected by thethat have been><div class="cdiv id="headerin particular,converted into);\n<\/script>\n<philosophical srpskohrvatskitia:?ng Via;tP QQQP:P8P9Q\0QQQP:P8P9investigaciC3nparticipaciC3nP:P>QP>Q\0Q\vP5P>P1P;P0QQP8P:P>QP>Q\0Q\vP9QP5P;P>P2P5P:QP8QQP5P<Q\vPP>P2P>QQP8P:P>QP>Q\0Q\vQP>P1P;P0QQQ\fP2Q\0P5P<P5P=P8P:P>QP>Q\0P0QQP5P3P>P4P=QQP:P0QP0QQ\fP=P>P2P>QQP8P#P:Q\0P0P8P=Q\vP2P>P?Q\0P>QQ\vP:P>QP>Q\0P>P9QP4P5P;P0QQ\fP?P>P<P>Q\tQ\fQQQ\0P5P4QQP2P>P1Q\0P0P7P>P<QQP>Q\0P>P=Q\vQQP0QQP8P5QP5QP5P=P8P5PP;P0P2P=P0QP8QQP>Q\0P8P8QP8QQP5P<P0Q\0P5Q\bP5P=P8QP!P:P0QP0QQ\fP?P>Q\rQP>P<QQP;P5P4QP5QQP:P0P7P0QQ\fQP>P2P0Q\0P>P2P:P>P=P5QP=P>Q\0P5Q\bP5P=P8P5P:P>QP>Q\0P>P5P>Q\0P3P0P=P>P2P:P>QP>Q\0P>P<P P5P:P;P0P<P0X\'YYYX*X/Y\tYYX*X/Y\nX\'X*X\'YYY\bX6Y\bX9X\'YX(X1X\'YX,X\'YYY\bX\'YX9X\'YX1X3X\'X&YYX4X\'X1YX\'X*X\'YX#X9X6X\'X!X\'YX1Y\nX\'X6X)X\'YX*X5YY\nYX\'YX\'X9X6X\'X!X\'YYX*X\'X&X,X\'YX#YX9X\'X(X\'YX*X3X,Y\nYX\'YX#YX3X\'YX\'YX6X:X7X\'X*X\'YYY\nX/Y\nY\bX\'YX*X1X-Y\nX(X\'YX,X/Y\nX/X)X\'YX*X9YY\nYX\'YX#X.X(X\'X1X\'YX\'YYX\'YX\'YX#YYX\'YX\'YX*X\'X1Y\nX.X\'YX*YYY\nX)X\'YX\'YX9X\'X(X\'YX.Y\bX\'X7X1X\'YYX,X*YX9X\'YX/Y\nYY\bX1X\'YX3Y\nX\'X-X)X9X(X/X\'YYYX\'YX*X1X(Y\nX)X\'YX1Y\bX\'X(X7X\'YX#X/X(Y\nX)X\'YX\'X.X(X\'X1X\'YYX*X-X/X)X\'YX\'X:X\'YY\ncursor:pointer;</title>\n<meta " href="http://"><span class="members of the window.locationvertical-align:/a> | <a href="<!doctype html>media="screen" <option value="favicon.ico" />\n\t\t<div class="characteristics" method="get" /body>\n</html>\nshortcut icon" document.write(padding-bottom:representativessubmit" value="align="center" throughout the science fiction\n <div class="submit" class="one of the most valign="top"><was established);\r\n<\/script>\r\nreturn false;">).style.displaybecause of the document.cookie<form action="/}body{margin:0;Encyclopedia ofversion of the .createElement(name" content="</div>\n</div>\n\nadministrative </body>\n</html>history of the "><input type="portion of the as part of the &nbsp;<a href="other countries">\n<div class="</span></span><In other words,display: block;control of the introduction of/>\n<meta name="as well as the in recent years\r\n\t<div class="</div>\n\t</div>\ninspired by thethe end of the compatible withbecame known as style="margin:.js"><\/script>< International there have beenGerman language style="color:#Communist Partyconsistent withborder="0" cell marginheight="the majority of" align="centerrelated to the many different Orthodox Churchsimilar to the />\n<link rel="swas one of the until his death})();\n<\/script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling="no" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign="center">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style="width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>\n\t<div class="consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important<\/script></div>function(){var relative to theas a result of the position ofFor example, in method="post" was followed by&amp;mdash; thethe applicationjs"><\/script>\r\nul></div></div>after the deathwith respect tostyle="padding:is particularlydisplay:inline; type="submit" is divided intod8-f (g.\0d=)responsabilidadadministraciC3ninternacionalescorrespondiente`$\t`$*`$/`%\v`$`$*`%`$0`%\r`$5`$9`$.`$>`$0`%`$2`%\v`$`%\v`$`$`%`$(`$>`$5`$2`%`$`$?`$(`$8`$0`$`$>`$0`$*`%`$2`$?`$8`$`%\v`$`%`$`$`$>`$9`$?`$`$-`%`$`%`$`$6`$>`$.`$?`$2`$9`$.`$>`$0`%\0`$`$>`$`$0`$#`$,`$(`$>`$(`%`$`%`$.`$>`$0`$,`%\r`$2`%\t`$`$.`$>`$2`$?`$`$.`$9`$?`$2`$>`$*`%`$7`%\r`$ `$,`$"`$<`$$`%`$-`$>`$`$*`$>`$`%\r`$2`$?`$`$`%\r`$0`%`$(`$`$?`$2`$>`$+`$&`%\f`$0`$>`$(`$.`$>`$.`$2`%`$.`$$`$&`$>`$(`$,`$>`$`$>`$0`$5`$?`$`$>`$8`$`%\r`$/`%\v`$`$`$>`$9`$$`%`$*`$9`%`$`$`$,`$$`$>`$/`$>`$8`$`$5`$>`$&`$&`%`$`$(`%`$*`$?`$`$2`%`$5`$?`$6`%`$7`$0`$>`$`%\r`$/`$\t`$$`%\r`$$`$0`$.`%`$`$,`$\b`$&`%\v`$(`%\v`$`$\t`$*`$`$0`$#`$*`$"`$<`%`$`$8`%\r`$%`$?`$$`$+`$?`$2`%\r`$.`$.`%`$`%\r`$/`$`$`%\r`$`$>`$`%`$`$$`%\0`$8`$`$`%\0`$$`$`$>`$`$`$>`$5`$?`$-`$>`$`$`$#`%\r`$`%`$&`%`$8`$0`%`$&`$?`$(`%\v`$`$9`$$`%\r`$/`$>`$8`%`$`%\r`$8`$`$>`$`$\'`%\0`$5`$?`$6`%\r`$5`$0`$>`$$`%`$`$&`%\b`$`%\r`$8`$(`$`%\r`$6`$>`$8`$>`$.`$(`%`$`$&`$>`$2`$$`$,`$?`$`$2`%\0`$*`%`$0`%`$7`$9`$?`$`$&`%\0`$.`$?`$$`%\r`$0`$`$5`$?`$$`$>`$0`%`$*`$/`%`$8`%\r`$%`$>`$(`$`$0`%\v`$!`$<`$.`%`$`%\r`$$`$/`%\v`$`$(`$>`$`%`$*`$/`$>`$*`%\v`$8`%\r`$`$`$0`%`$2`%`$`$>`$0`%\r`$/`$5`$?`$`$>`$0`$8`%`$`$(`$>`$.`%`$2`%\r`$/`$&`%`$`%`$`$9`$.`%`$6`$>`$8`%\r`$`%`$2`$.`%\b`$`$(`%`$$`%\b`$/`$>`$0`$`$?`$8`$`%rss+xml" title="-type" content="title" content="at the same time.js"><\/script>\n<" method="post" </span></a></li>vertical-align:t/jquery.min.js">.click(function( style="padding-})();\n<\/script>\n</span><a href="<a href="http://); return false;text-decoration: scrolling="no" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif" border="0"</body>\n</html>\noverflow:hidden;img src="http://addEventListenerresponsible for s.js"><\/script>\n/favicon.ico" />operating system" style="width:1target="_blank">State Universitytext-align:left;\ndocument.write(, including the around the world);\r\n<\/script>\r\n<" style="height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>\n\t\t</div>\ndisplay: none;">" />\n<link rel="\n (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the align="center">University Pressdominated by theSecond World Wardistribution of style="position:the rest of the characterized by rel="nofollow">derives from therather than the a combination ofstyle="width:100English-speakingcomputer scienceborder="0" alt="the existence ofDemocratic Party" style="margin-For this reason,.js"><\/script>\n\tsByTagName(s)[0]js"><\/script>\r\n<.js"><\/script>\r\nlink rel="icon" \' alt=\'\' class=\'formation of theversions of the </a></div></div>/page>\n <page>\n<div class="contbecame the firstbahasa Indonesiaenglish (simple)NN;N;N7N=N9N:N,QQ\0P2P0QQP:P8P:P>P<P?P0P=P8P8QP2P;QP5QQQPP>P1P0P2P8QQ\fQP5P;P>P2P5P:P0Q\0P0P7P2P8QP8QPP=QP5Q\0P=P5QPQP2P5QP8QQ\fP=P0P?Q\0P8P<P5Q\0P8P=QP5Q\0P=P5QP:P>QP>Q\0P>P3P>QQQ\0P0P=P8QQ\vP:P0QP5QQP2P5QQP;P>P2P8QQP?Q\0P>P1P;P5P<Q\vP?P>P;QQP8QQ\fQP2P;QQQQQP=P0P8P1P>P;P5P5P:P>P<P?P0P=P8QP2P=P8P<P0P=P8P5QQ\0P5P4QQP2P0X\'YYY\bX\'X6Y\nX9X\'YX1X&Y\nX3Y\nX)X\'YX\'YX*YX\'YYX4X\'X1YX\'X*YX\'YX3Y\nX\'X1X\'X*X\'YYYX*Y\bX(X)X\'YX3X9Y\bX/Y\nX)X\'X-X5X\'X&Y\nX\'X*X\'YX9X\'YYY\nX)X\'YX5Y\bX*Y\nX\'X*X\'YX\'YX*X1YX*X\'YX*X5X\'YY\nYX\'YX%X3YX\'YY\nX\'YYX4X\'X1YX)X\'YYX1X&Y\nX\'X*robots" content="<div id="footer">the United States<img src="http://.jpg|right|thumb|.js"><\/script>\r\n<location.protocolframeborder="0" s" />\n<meta name="</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:" rel="nofollow" President of the twentieth centuryevision>\n </pageInternet Explorera.async = true;\r\ninformation about<div id="header">" action="http://<a href="https://<div id="content"</div>\r\n</div>\r\n<derived from the <img src=\'http://according to the \n</body>\n</html>\nstyle="font-size:script language="Arial, Helvetica,</a><span class="<\/script><script political partiestd></tr></table><href="http://www.interpretation ofrel="stylesheet" document.write(\'<charset="utf-8">\nbeginning of the revealed that thetelevision series" rel="nofollow"> target="_blank">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass="clearfix">/div>\r\n</div>\r\n\r\nthree-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class="in some countriesmin.js"><\/script>of the populationofficial language<img src="images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>\r\n</html>\rNN;N;N7N=N9N:N,\ntake advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class="headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype="text/css">\nthe InternationalAccording to the pe="text/css" />\ncoincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;" target="_blank" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type="application/anguage" content="<meta http-equiv="Privacy Policy</a>e("%3Cscript src=\'" target="_blank">On the other hand,.jpg|thumb|right|2</div><div class="<div style="float:nineteenth century</body>\r\n</html>\r\n<img src="http://s;text-align:centerfont-weight: bold; According to the difference between" frameborder="0" " style="position:link href="http://html4/loose.dtd">\nduring this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type="text" <span style="font-onreadystatechange\t<div class="cleardocument.location. For example, the a wide variety of <!DOCTYPE html>\r\n<&nbsp;&nbsp;&nbsp;"><a href="http://style="float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype="text/css" />it is possible to Harvard Universitytylesheet" href="/the main characterOxford University name="keywords" cstyle="text-align:the United Kingdomfederal government<div style="margin depending on the description of the<div class="header.min.js"><\/script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc="http://staticsuggested that the" src="http://www.a large number of Telecommunications" rel="nofollow" tHoly Roman Emperoralmost exclusively" border="0" alt="Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle="background-<li><em><a href="/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src="http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref="https://www.recent developmentBoard of Directors<div class="search| <a href="http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>\r\n</div>\r\n\r\n<a href="index.phpwas established inmin.js"><\/script>\nparticipate in thea strong influencestyle="margin-top:represented by thegraduated from theTraditionally, theElement("script");However, since the/div>\n</div>\n<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype="image/x-icon/div>\n<div class=" class="clearfix"><div class="footer\t\t</div>\n\t\t</div>\nthe motion picturePQ\nP;P3P0Q\0QP:P8P1Q\nP;P3P0Q\0QP:P8P$P5P4P5Q\0P0QP8P8P=P5QP:P>P;Q\fP:P>QP>P>P1Q\tP5P=P8P5QP>P>P1Q\tP5P=P8QP?Q\0P>P3Q\0P0P<P<Q\vPQP?Q\0P0P2P8QQ\fP1P5QP?P;P0QP=P>P<P0QP5Q\0P8P0P;Q\vP?P>P7P2P>P;QP5QP?P>QP;P5P4P=P8P5Q\0P0P7P;P8QP=Q\vQP?Q\0P>P4QP:QP8P8P?Q\0P>P3Q\0P0P<P<P0P?P>P;P=P>QQQ\fQP=P0QP>P4P8QQQP8P7P1Q\0P0P=P=P>P5P=P0QP5P;P5P=P8QP8P7P<P5P=P5P=P8QP:P0QP5P3P>Q\0P8P8PP;P5P:QP0P=P4Q\0`$&`%\r`$5`$>`$0`$>`$.`%\b`$(`%`$`$2`$*`%\r`$0`$&`$>`$(`$-`$>`$0`$$`%\0`$/`$`$(`%`$&`%`$6`$9`$?`$(`%\r`$&`%\0`$`$`$!`$?`$/`$>`$&`$?`$2`%\r`$2`%\0`$`$\'`$?`$`$>`$0`$5`%\0`$!`$?`$/`%\v`$`$?`$`%\r`$ `%`$8`$.`$>`$`$>`$0`$`$`$`%\r`$6`$(`$&`%`$(`$?`$/`$>`$*`%\r`$0`$/`%\v`$`$`$(`%`$8`$>`$0`$`$(`$2`$>`$`$(`$*`$>`$0`%\r`$`%\0`$6`$0`%\r`$$`%\v`$`$2`%\v`$`$8`$-`$>`$+`$<`%\r`$2`%\b`$6`$6`$0`%\r`$$`%`$`$*`%\r`$0`$&`%`$6`$*`%\r`$2`%`$/`$0`$`%`$`$&`%\r`$0`$8`%\r`$%`$?`$$`$?`$\t`$$`%\r`$*`$>`$&`$\t`$(`%\r`$9`%`$`$`$?`$`%\r`$ `$>`$/`$>`$$`%\r`$0`$>`$`%\r`$/`$>`$&`$>`$*`%`$0`$>`$(`%`$`%\v`$!`$<`%`$`$`$(`%`$5`$>`$&`$6`%\r`$0`%`$#`%\0`$6`$?`$`%\r`$7`$>`$8`$0`$`$>`$0`%\0`$8`$`$`%\r`$0`$9`$*`$0`$?`$#`$>`$.`$,`%\r`$0`$>`$`$!`$,`$`%\r`$`%\v`$`$\t`$*`$2`$,`%\r`$\'`$.`$`$$`%\r`$0`%\0`$8`$`$*`$0`%\r`$`$\t`$.`%\r`$.`%\0`$&`$.`$>`$\'`%\r`$/`$.`$8`$9`$>`$/`$$`$>`$6`$,`%\r`$&`%\v`$`$.`%\0`$!`$?`$/`$>`$`$\b`$*`%\0`$`$2`$.`%\v`$,`$>`$`$2`$8`$`$`%\r`$/`$>`$`$*`$0`%`$6`$(`$`$(`%`$,`$`$\'`$,`$>`$`$<`$>`$0`$(`$5`%\0`$(`$$`$.`$*`%\r`$0`$.`%`$`$*`%\r`$0`$6`%\r`$(`$*`$0`$?`$5`$>`$0`$(`%`$`$8`$>`$(`$8`$.`$0`%\r`$%`$(`$`$/`%\v`$`$?`$$`$8`%\v`$.`$5`$>`$0X\'YYX4X\'X1YX\'X*X\'YYYX*X/Y\nX\'X*X\'YYYX(Y\nY\bX*X1X\'YYX4X\'YX/X\'X*X9X/X/X\'YX2Y\bX\'X1X9X/X/X\'YX1X/Y\bX/X\'YX%X3YX\'YY\nX)X\'YYY\bX*Y\bX4Y\bX(X\'YYX3X\'X(YX\'X*X\'YYX9YY\bYX\'X*X\'YYX3YX3YX\'X*X\'YX,X1X\'YY\nYX3X\'YX\'X3YX\'YY\nX)X\'YX\'X*X5X\'YX\'X*keywords" content="w3.org/1999/xhtml"><a target="_blank" text/html; charset=" target="_blank"><table cellpadding="autocomplete="off" text-align: center;to last version by background-color: #" href="http://www./div></div><div id=<a href="#" class=""><img src="http://cript" src="http://\n<script language="//EN" "http://www.wencodeURIComponent(" href="javascript:<div class="contentdocument.write(\'<scposition: absolute;script src="http:// style="margin-top:.min.js"><\/script>\n</div>\n<div class="w3.org/1999/xhtml" \n\r\n</body>\r\n</html>distinction between/" target="_blank"><link href="http://encoding="utf-8"?>\nw.addEventListener?action="http://www.icon" href="http:// style="background:type="text/css" />\nmeta property="og:t<input type="text" style="text-align:the development of tylesheet" type="tehtml; charset=utf-8is considered to betable width="100%" In addition to the contributed to the differences betweendevelopment of the It is important to <\/script>\n\n<script style="font-size:1></span><span id=gbLibrary of Congress<img src="http://imEnglish translationAcademy of Sciencesdiv style="display:construction of the.getElementById(id)in conjunction withElement(\'script\'); <meta property="og:PQ\nP;P3P0Q\0QP:P8\n type="text" name=">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src="http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style="background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet" href="/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland\n<\/script>\n<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv="X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0" cellpadding="0" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E"));<a href="http://www.<li><a href="http://site_name" content="text-decoration:nonestyle="display: none<meta http-equiv="X-new Date().getTime() type="image/x-icon"</span><span class="language="javascriptwindow.location.href<a href="javascript:--\x3e\r\n<script type="t<a href=\'http://www.hortcut icon" href="</div>\r\n<div class="<script src="http://" rel="stylesheet" t</div>\n<script type=/a> <a href="http:// allowTransparency="X-UA-Compatible" conrelationship between\n<\/script>\r\n<script </a></li></ul></div>associated with the programming language</a><a href="http://</a></li><li class="form action="http://<div style="display:type="text" name="q"<table width="100%" background-position:" border="0" width="rel="shortcut icon" h6><ul><li><a href=" <meta http-equiv="css" media="screen" responsible for the " type="application/" style="background-html; charset=utf-8" allowtransparency="stylesheet" type="te\r\n<meta http-equiv="></span><span class="0" cellspacing="0">;\n<\/script>\n<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type="hidden" name="javascript:void(0);"effectiveness of the autocomplete="off" generally considered><input type="text" "><\/script>\r\n<scriptthroughout the worldcommon misconceptionassociation with the</div>\n</div>\n<div cduring his lifetime,corresponding to thetype="image/x-icon" an increasing numberdiplomatic relationsare often consideredmeta charset="utf-8" <input type="text" examples include the"><img src="http://iparticipation in thethe establishment of\n</div>\n<div class="&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset="utf-8"> type="text/css" />\ninterchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type="text/csstype="submit" name="families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguC*s (Europeu)P#P:Q\0P0QP=QQ\fP:P0QP:Q\0P0QP=QQ\fP:P0P P>QQP8P9QP:P>P9P<P0QP5Q\0P8P0P;P>P2P8P=QP>Q\0P<P0QP8P8QP?Q\0P0P2P;P5P=P8QP=P5P>P1QP>P4P8P<P>P8P=QP>Q\0P<P0QP8QPP=QP>Q\0P<P0QP8QP P5QP?QP1P;P8P:P8P:P>P;P8QP5QQP2P>P8P=QP>Q\0P<P0QP8QQP5Q\0Q\0P8QP>Q\0P8P8P4P>QQP0QP>QP=P>X\'YYX*Y\bX\'X,X/Y\bYX\'YX\'X4X*X1X\'YX\'X*X\'YX\'YX*X1X\'X-X\'X*html; charset=UTF-8" setTimeout(function()display:inline-block;<input type="submit" type = \'text/javascri<img src="http://www." "http://www.w3.org/shortcut icon" href="" autocomplete="off" </a></div><div class=</a></li>\n<li class="css" type="text/css" <form action="http://xt/css" href="http://link rel="alternate" \r\n<script type="text/ onclick="javascript:(new Date).getTime()}height="1" width="1" People\'s Republic of <a href="http://www.text-decoration:underthe beginning of the </div>\n</div>\n</div>\nestablishment of the </div></div></div></d#viewport{min-height:\n<script src="http://option><option value=often referred to as /option>\n<option valu<!DOCTYPE html>\n\x3c!--[International Airport>\n<a href="http://www</a><a href="http://w`8 `82`8)`82`9`8`8"a%aa aa#aaf-#i+d8-f (g9i+)`$(`$?`$0`%\r`$&`%`$6`$!`$>`$\t`$(`$2`%\v`$!`$`%\r`$7`%`$$`%\r`$0`$`$>`$(`$`$>`$0`%\0`$8`$`$,`$`$\'`$?`$$`$8`%\r`$%`$>`$*`$(`$>`$8`%\r`$5`%\0`$`$>`$0`$8`$`$8`%\r`$`$0`$#`$8`$>`$.`$`%\r`$0`%\0`$`$?`$`%\r`$ `%\v`$`$5`$?`$`%\r`$`$>`$(`$`$.`%`$0`$?`$`$>`$5`$?`$-`$?`$(`%\r`$(`$`$>`$!`$?`$/`$>`$`$`%\r`$/`%\v`$`$`$?`$8`%`$0`$`%\r`$7`$>`$*`$9`%`$`$`$$`%\0`$*`%\r`$0`$,`$`$\'`$(`$`$?`$*`%\r`$*`$#`%\0`$`%\r`$0`$?`$`%`$`$*`%\r`$0`$>`$0`$`$-`$*`%\r`$0`$>`$*`%\r`$$`$.`$>`$2`$?`$`%\v`$`$0`$+`$<`%\r`$$`$>`$0`$(`$?`$0`%\r`$.`$>`$#`$2`$?`$.`$?`$`%`$!description" content="document.location.prot.getElementsByTagName(<!DOCTYPE html>\n<html <meta charset="utf-8">:url" content="http://.css" rel="stylesheet"style type="text/css">type="text/css" href="w3.org/1999/xhtml" xmltype="text/javascript" method="get" action="link rel="stylesheet" = document.getElementtype="image/x-icon" />cellpadding="0" cellsp.css" type="text/css" </a></li><li><a href="" width="1" height="1""><a href="http://www.style="display:none;">alternate" type="appli-//W3C//DTD XHTML 1.0 ellspacing="0" cellpad type="hidden" value="/a>&nbsp;<span role="s\n<input type="hidden" language="JavaScript" document.getElementsBg="0" cellspacing="0" ype="text/css" media="type=\'text/javascript\'with the exception of ype="text/css" rel="st height="1" width="1" =\'+encodeURIComponent(<link rel="alternate" \nbody, tr, input, textmeta name="robots" conmethod="post" action=">\n<a href="http://www.css" rel="stylesheet" </div></div><div classlanguage="javascript">aria-hidden="true">B7<ript" type="text/javasl=0;})();\n(function(){background-image: url(/a></li><li><a href="h\t\t<li><a href="http://ator" aria-hidden="tru> <a href="http://www.language="javascript" /option>\n<option value/div></div><div class=rator" aria-hidden="tre=(new Date).getTime()portuguC*s (do Brasil)P>Q\0P3P0P=P8P7P0QP8P8P2P>P7P<P>P6P=P>QQQ\fP>P1Q\0P0P7P>P2P0P=P8QQ\0P5P3P8QQQ\0P0QP8P8P2P>P7P<P>P6P=P>QQP8P>P1QP7P0QP5P;Q\fP=P0<!DOCTYPE html PUBLIC "nt-Type" content="text/<meta http-equiv="Conteransitional//EN" "http:<html xmlns="http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = \'text/javascript\';<meta name="descriptionparentNode.insertBefore<input type="hidden" najs" type="text/javascri(document).ready(functiscript type="text/javasimage" content="http://UA-Compatible" content=tml; charset=utf-8" />\nlink rel="shortcut icon<link rel="stylesheet" <\/script>\n<script type== document.createElemen<a target="_blank" href= document.getElementsBinput type="text" name=a.type = \'text/javascrinput type="hidden" namehtml; charset=utf-8" />dtd">\n<html xmlns="http-//W3C//DTD HTML 4.01 TentsByTagName(\'script\')input type="hidden" nam<script type="text/javas" style="display:none;">document.getElementById(=document.createElement(\' type=\'text/javascript\'input type="text" name="d.getElementsByTagName(snical" href="http://www.C//DTD HTML 4.01 Transit<style type="text/css">\n\n<style type="text/css">ional.dtd">\n<html xmlns=http-equiv="Content-Typeding="0" cellspacing="0"html; charset=utf-8" />\n style="display:none;"><<li><a href="http://www. type=\'text/javascript\'>P4P5QQP5P;Q\fP=P>QQP8QP>P>QP2P5QQQP2P8P8P?Q\0P>P8P7P2P>P4QQP2P0P1P5P7P>P?P0QP=P>QQP8`$*`%`$8`%\r`$$`$?`$`$>`$`$>`$`$`%\r`$0`%`$8`$\t`$(`%\r`$9`%\v`$`$(`%`$5`$?`$\'`$>`$(`$8`$-`$>`$+`$?`$`%\r`$8`$?`$`$`$8`%`$0`$`%\r`$7`$?`$$`$`%\t`$*`%\0`$0`$>`$`$`$5`$?`$`%\r`$`$>`$*`$(`$`$>`$0`%\r`$0`$5`$>`$\b`$8`$`%\r`$0`$?`$/`$$`$>',"۷%ƌ'T%…'W%×%O%g%¦&Ɠ%ǥ&>&*&'&^&ˆŸా&ƭ&ƒ&)&^&%&'&‚&P&1&±&3&]&m&u&E&t&C&Ï&V&V&/&>&6&ྲྀ᝼o&p&@&E&M&P&x&@&F&e&Ì&7&:&(&D&0&C&)&.&F&-&1&(&L&F&1ɞ*Ϫ⇳&፲&K&;&)&E&H&P&0&?&9&V&&-&v&a&,&E&)&?&=&'&'&B&മ&ԃ&̖*&*8&%&%&&&%,)&š&>&†&7&]&F&2&>&J&6&n&2&%&?&Ž&2&6&J&g&-&0&,&*&J&*&O&)&6&(&<&B&N&.&P&@&2&.&W&M&%Լ„(,(<&,&Ϛ&ᣇ&-&,(%&(&%&(Ļ0&X&D&&j&'&J&(&.&B&3&Z&R&h&3&E&E&<Æ-͠ỳ&%8?&@&,&Z&@&0&J&,&^&x&_&6&C&6&Cܬ⨥&f&-&-&-&-&,&J&2&8&z&8&C&Y&8&-&d&ṸÌ-&7&1&F&7&t&W&7&I&.&.&^&=ྜ᧓&8(>&/&/&ݻ')'ၥ')'%@/&0&%оী*&*@&CԽהɴ׫4෗ܚӑ6඄&/Ÿ̃Z&*%ɆϿ&Ĵ&1¨ҴŴ");Pe(ue);O=ue}function pe(e,t){return e<=t?e:t}function me(e,t,i,n){if(e==null)return-1;var a=pe(e.offset+n,e.data.length);var o=a-e.offset;t.set(e.data.subarray(e.offset,a),i);e.offset+=o;return o}function ge(e){return 0}function Pe(e){}function $e(e){var t=e.length;var i=new Int8Array(t);for(var n=0;n<t;++n){i[n]=e.charCodeAt(n)}return i}function be(e){var t=new he;h(t,new d(e));var i=0;var n=[];while(true){var a=new Int8Array(16384);n.push(a);t.output=a;t.outputOffset=0;t.outputLength=16384;t.outputUsed=0;Y(t);i+=t.outputUsed;if(t.outputUsed<16384)break}f(t);var o=new Int8Array(i);var r=0;for(var s=0;s<n.length;++s){var a=n[s];var l=pe(i,r+16384);var c=l-r;if(c<16384){o.set(a.subarray(0,c),r)}else{o.set(a,r)}r+=c}return o}return be}var BrotliDecode=BrotliDecodeClosure();window["BrotliDecode"]=BrotliDecode; \ No newline at end of file
+function BrotliDecodeClosure(){"use strict";function e(e){this.a=e,this.b=0}function t(e){for(var t=-1,i=16;i>0;)e>>>i!=0&&(t+=i,e>>>=i),i>>=1;return t+e}function i(e,t,i){return 16+t+2*(i<<e)}function n(e,i,n){if(e<n+(2<<i))throw"maxDistance is too small";var a=(e-n>>i)+4,o=t(a)-1,r=o-1<<1|a>>o&1;return(r-1<<i)+(1<<i)+n+16}function a(e){var t=new Int16Array(24),i=new Int16Array(24);i[0]=2;for(var n=0;n<23;++n)t[n+1]=t[n]+(1<<Pe[n]),i[n+1]=i[n]+(1<<$e[n]);for(var a=0;a<704;++a){var o=a>>>6,r=-4;o>=2&&(o-=2,r=0);var s=(170064>>>2*o&3)<<3|a>>>3&7,l=(156228>>>2*o&3)<<3|7&a,c=i[l],d=r+(c>4?3:c-2),h=4*a;e[h+0]=Pe[s]|$e[l]<<8,e[h+1]=t[s],e[h+2]=i[l],e[h+3]=d}}function o(e){var t=e.c;if(e.c=0,e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),0==H(e,1))return 16;var i=H(e,3);return 0!=i?17+i:(i=H(e,3),0!=i?1==i?0==t?-1:(e.c=1,1==H(e,1)?-1:(i=H(e,6),i<10||i>30?-1:i)):8+i:17)}function r(e,t){if(0!=e.h)throw"State MUST be uninitialized";e.j=new Int32Array(3091),e.j[0]=7,e.k=3;var i=n(2147483644,3,120);e.l=new Int8Array(i),e.m=new Int32Array(i),e.input=t,U(e),e.h=1}function s(e){if(0==e.h)throw"State MUST be initialized";11!=e.h&&(e.h=11,null!=e.input&&(ne(e.input),e.input=null))}function l(e){if(e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),0!=H(e,1)){var t=H(e,3);return 0==t?1:H(e,t)+(1<<t)}return 0}function c(e){if(e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),e.n=H(e,1),e.o=0,e.p=0,e.q=0,0==e.n||0==H(e,1)){var t=H(e,2)+4;if(7==t){if(e.q=1,0!=H(e,1))throw"Corrupted reserved bit";var i=H(e,2);if(0==i)return;for(var n=0;n<i;n++){e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var a=H(e,8);if(0==a&&n+1==i&&i>1)throw"Exuberant nibble";e.o|=a<<8*n}}else for(var n=0;n<t;n++){e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var a=H(e,4);if(0==a&&n+1==t&&t>4)throw"Exuberant nibble";e.o|=a<<4*n}e.o++,0==e.n&&(e.p=H(e,1))}}function d(e,t,i){var n=e[t],a=i.e>>>i.d;n+=255&a;var o=e[n]>>16,r=65535&e[n];if(o<=8)return i.d+=o,r;n+=r;var s=(1<<o)-1;return n+=(a&s)>>>8,i.d+=(e[n]>>16)+8,65535&e[n]}function h(e,t,i){i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16);var n=d(e,t,i),a=ge[n];return i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16),me[n]+(a<=16?H(i,a):R(i,a))}function f(e,t){for(var i=e[t];t>0;t--)e[t]=e[t-1];e[0]=i}function p(e,t){for(var i=new Int32Array(256),n=0;n<256;n++)i[n]=n;for(var n=0;n<t;n++){var a=255&e[n];e[n]=i[a],0!=a&&f(i,a)}}function u(e,t,i,n){var a=0,o=8,r=0,s=0,l=32768,c=new Int32Array(33),d=c.length-1;for(W(c,d,5,e,18);a<t&&l>0;){n.g>2030&&B(n),n.d>=16&&(n.e=n.f[n.g++]<<16|n.e>>>16,n.d-=16);var h=n.e>>>n.d&31;n.d+=c[h]>>16;var f=65535&c[h];if(f<16)r=0,i[a++]=f,0!=f&&(o=f,l-=32768>>f);else{var p=f-14,u=0;16==f&&(u=o),s!=u&&(r=0,s=u);var m=r;r>0&&(r-=2,r<<=p),n.d>=16&&(n.e=n.f[n.g++]<<16|n.e>>>16,n.d-=16),r+=H(n,p)+3;var g=r-m;if(a+g>t)throw"symbol + repeatDelta > numSymbols";for(var P=0;P<g;P++)i[a++]=s;0!=s&&(l-=g<<15-s)}}if(0!=l)throw"Unused space";i.fill(0,a,t)}function m(e,t){for(var i=0;i<t-1;++i)for(var n=i+1;n<t;++n)if(e[i]==e[n])throw"Duplicate simple Huffman code symbol"}function g(e,i,n,a,o){for(var r=new Int32Array(i),s=new Int32Array(4),l=1+t(e-1),c=H(o,2)+1,d=0;d<c;d++){o.d>=16&&(o.e=o.f[o.g++]<<16|o.e>>>16,o.d-=16);var h=H(o,l);if(h>=i)throw"Can't readHuffmanCode";s[d]=h}m(s,c);var f=c;switch(4==c&&(f+=H(o,1)),f){case 1:r[s[0]]=1;break;case 2:r[s[0]]=1,r[s[1]]=1;break;case 3:r[s[0]]=1,r[s[1]]=2,r[s[2]]=2;break;case 4:r[s[0]]=2,r[s[1]]=2,r[s[2]]=2,r[s[3]]=2;break;case 5:r[s[0]]=1,r[s[1]]=2,r[s[2]]=3,r[s[3]]=3}return W(n,a,8,r,i)}function P(e,t,i,n,a){for(var o=new Int32Array(e),r=new Int32Array(18),s=32,l=0,c=t;c<18&&s>0;c++){var d=ce[c];a.d>=16&&(a.e=a.f[a.g++]<<16|a.e>>>16,a.d-=16);var h=a.e>>>a.d&15;a.d+=fe[h]>>16;var f=65535&fe[h];r[d]=f,0!=f&&(s-=32>>f,l++)}if(0!=s&&1!=l)throw"Corrupted Huffman code histogram";return u(r,e,o,a),W(i,n,8,o,e)}function $(e,t,i,n,a){a.g>2030&&B(a),a.d>=16&&(a.e=a.f[a.g++]<<16|a.e>>>16,a.d-=16);var o=H(a,2);return 1==o?g(e,t,i,n,a):P(t,o,i,n,a)}function b(e,t,i){i.g>2030&&B(i);var n=l(i)+1;if(1==n)return t.fill(0,0,e),n;i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16);var a=H(i,1),o=0;0!=a&&(o=H(i,4)+1);var r=n+o,s=le[r+31>>5],c=new Int32Array(s+1),h=c.length-1;$(r,r,c,h,i);for(var f=0;f<e;){i.g>2030&&B(i),i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16);var u=d(c,h,i);if(0==u)t[f]=0,f++;else if(u<=o){i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16);for(var m=(1<<u)+H(i,u);0!=m;){if(f>=e)throw"Corrupted context map";t[f]=0,f++,m--}}else t[f]=u-o,f++}return i.d>=16&&(i.e=i.f[i.g++]<<16|i.e>>>16,i.d-=16),1==H(i,1)&&p(t,e),n}function v(e,t,i){var n=e.r,a=4+2*t;e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var o=d(e.j,2*t,e),r=h(e.j,2*t+1,e);return 1==o?o=n[a+1]+1:0==o?o=n[a]:o-=2,o>=i&&(o-=i),n[a]=n[a+1],n[a+1]=o,r}function y(e){e.s=v(e,0,e.t);var t=e.r[5];e.u=t<<6,e.v=255&e.w[e.u];var i=e.x[t];e.y=i<<9,e.z=e.y+256}function X(e){e.A=v(e,1,e.B),e.C=e.r[7]}function w(e){e.D=v(e,2,e.F),e.G=e.r[9]<<2}function Y(e){var t=e.H;if(t>e.I){for(var i=e.I;t>>1>i;)t>>=1;0==e.n&&t<16384&&e.H>=16384&&(t=16384)}if(!(t<=e.J)){var n=t+37,a=new Int8Array(n);0!=e.K.length&&a.L(e.K.M(0,0+e.J),0),e.K=a,e.J=t}}function Q(e){return 0!=e.n?(e.N=10,void(e.h=12)):(e.O=new Int32Array(0),e.P=new Int32Array(0),e.Q=new Int32Array(0),e.g>2030&&B(e),c(e),void(0==e.o&&0==e.q||(0!=e.p||0!=e.q?(J(e),e.h=0!=e.q?5:6):e.h=3,0==e.q&&(e.I+=e.o,e.I>1<<30&&(e.I=1<<30),e.J<e.H&&Y(e)))))}function k(e,t,i){var n=e.j[2*t];if(i<=1)return e.j[2*t+1]=n,e.j[2*t+2]=n,1<<28;var a=i+2;n+=$(a,a,e.j,2*t,e),e.j[2*t+1]=n;var o=26;return n+=$(o,o,e.j,2*t+1,e),e.j[2*t+2]=n,h(e.j,2*t+1,e)}function x(e,t){for(var i=e.l,n=e.m,a=e.R,o=e.S,r=1<<a,s=1,l=0,c=16,d=0;d<o;++d)i[c]=0,n[c]=d+1,++c;for(;c<t;){for(var h=o+((2+l<<s)-4<<a)+1,d=0;d<r;++d)i[c]=s,n[c]=h+d,++c;s+=l,l^=1}}function C(e){e.t=l(e)+1,e.s=k(e,0,e.t),e.B=l(e)+1,e.A=k(e,1,e.B),e.F=l(e)+1,e.D=k(e,2,e.F),e.g>2030&&B(e),e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),e.R=H(e,2),e.S=H(e,4)<<e.R,e.T=(1<<e.R)-1,e.x=new Int8Array(e.t);for(var t=0;t<e.t;){for(var a=te(t+96,e.t);t<a;++t)e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),e.x[t]=H(e,2);e.g>2030&&B(e)}e.w=new Int8Array(e.t<<6);var o=b(e.t<<6,e.w,e);e.U=1;for(var r=0;r<e.t<<6;r++)if(e.w[r]!=r>>6){e.U=0;break}e.V=new Int8Array(e.F<<2);var s=b(e.F<<2,e.V,e);e.O=I(256,256,o,e),e.P=I(704,704,e.B,e);var c=i(e.R,e.S,24),d=c;1==e.c&&(c=i(e.R,e.S,62),d=n(2147483644,e.R,e.S)),e.Q=I(c,d,s,e),x(e,d),e.u=0,e.G=0,e.y=512*e.x[0],e.z=e.y+256,e.v=0,e.C=0,e.r[4]=1,e.r[5]=0,e.r[6]=1,e.r[7]=0,e.r[8]=1,e.r[9]=0}function j(e){var t=e.K;if(e.o<=0)return L(e),void(e.h=2);var i=te(e.J-e.W,e.o);return G(e,t,e.W,i),e.o-=i,e.W+=i,e.W==e.J?(e.N=6,void(e.h=12)):(L(e),void(e.h=2))}function A(e){var t=te(e.X-e.Y,e.Z-e.$);return 0!=t&&(e._.L(e.K.M(e.$,e.$+t),e.aa+e.Y),e.Y+=t,e.$+=t),e.Y<e.X?1:0}function I(e,t,i,n){for(var a=le[t+31>>5],o=new Int32Array(i+i*a),r=i,s=0;s<i;++s)o[s]=r,r+=$(e,t,o,s,n);return o}function q(e){var t=e.J;return 0!=e.i&&(t=te(t,e.$+e.X-e.Y)),t}function T(e){if(0==e.h)throw"Can't decompress until initialized";if(11==e.h)throw"Can't decompress after close";if(1==e.h){var t=o(e);if(t==-1)throw"Invalid 'windowBits' code";e.H=1<<t,e.ba=e.H-16,e.h=2}for(var i=q(e),n=e.J-1,a=e.K;10!=e.h;)switch(e.h){case 2:if(e.o<0)throw"Invalid metablock length";Q(e),i=q(e),n=e.J-1,a=e.K;continue;case 3:C(e),e.h=4;case 4:if(e.o<=0){e.h=2;continue}e.g>2030&&B(e),0==e.A&&X(e),e.A--,e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var r=d(e.P,e.C,e)<<2,s=be[r],l=be[r+1],c=be[r+2];e.ca=be[r+3],e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var h=255&s;e.da=l+(h<=16?H(e,h):R(e,h)),e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var h=s>>8;e.ea=c+(h<=16?H(e,h):R(e,h)),e.fa=0,e.h=7;case 7:if(0!=e.U){for(;e.fa<e.da;)if(e.g>2030&&B(e),0==e.s&&y(e),e.s--,e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),a[e.W]=d(e.O,e.v,e),e.W++,e.fa++,e.W>=i){e.N=7,e.h=12;break}}else for(var f=255&a[e.W-1&n],p=255&a[e.W-2&n];e.fa<e.da;){e.g>2030&&B(e),0==e.s&&y(e);var u=ye[e.y+f]|ye[e.z+p],m=255&e.w[e.u+u];if(e.s--,p=f,e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),f=d(e.O,m,e),a[e.W]=f,e.W++,e.fa++,e.W>=i){e.N=7,e.h=12;break}}if(7!=e.h)continue;if(e.o-=e.da,e.o<=0){e.h=4;continue}var g=e.ca;if(g<0)e.ga=e.r[e.k];else{e.g>2030&&B(e),0==e.D&&w(e),e.D--,e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);var P=255&e.V[e.G+g];if(g=d(e.Q,P,e),g<16){var $=e.k+de[g]&3;if(e.ga=e.r[$]+he[g],e.ga<0)throw"Negative distance"}else{var b,h=e.l[g];e.d+h<=32?b=H(e,h):(e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),b=h<=16?H(e,h):R(e,h)),e.ga=e.m[g]+(b<<e.R)}}if(e.ha!=e.ba&&e.W<e.ba?e.ha=e.W:e.ha=e.ba,e.ga>e.ha){e.h=9;continue}if(g>0&&(e.k=e.k+1&3,e.r[e.k]=e.ga),e.ea>e.o)throw"Invalid backward reference";e.fa=0,e.h=8;case 8:var v=e.W-e.ga&n,Y=e.W,k=e.ea-e.fa,x=v+k,I=Y+k;if(x<n&&I<n){if(k<12||x>Y&&I>v)for(var T=0;T<k;T+=4)a[Y++]=a[v++],a[Y++]=a[v++],a[Y++]=a[v++],a[Y++]=a[v++];else a.copyWithin(Y,v,x);e.fa+=k,e.o-=k,e.W+=k}else for(;e.fa<e.ea;)if(a[e.W]=a[e.W-e.ga&n],e.o--,e.W++,e.fa++,e.W>=i){e.N=8,e.h=12;break}8==e.h&&(e.h=4);continue;case 9:if(e.ga>2147483644)throw"Invalid backward reference";if(!(e.ea>=4&&e.ea<=24))throw"Invalid backward reference";var S=pe[e.ea],E=e.ga-e.ha-1,D=ue[e.ea],N=(1<<D)-1,F=E&N,W=E>>>D;if(S+=F*e.ea,!(W<121))throw"Invalid backward reference";var U=z(a,e.W,se,S,e.ea,ve,W);if(e.W+=U,e.o-=U,e.W>=i){e.N=4,e.h=12;continue}e.h=4;continue;case 5:for(;e.o>0;)e.g>2030&&B(e),e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16),H(e,8),e.o--;e.h=2;continue;case 6:j(e);continue;case 12:e.Z=te(e.W,e.J),e.h=13;case 13:if(0==A(e))return;e.W>=e.ba&&(e.ha=e.ba),e.W>=e.J&&(e.W>e.J&&a.copyWithin(0,e.J,e.W),e.W&=n,e.$=0),e.h=e.N;continue;default:throw"Unexpected state "+e.h}if(10==e.h){if(e.o<0)throw"Invalid metablock length";J(e),M(e,1)}}function S(e,t,i){this.ia=0,this.ja=new Int32Array(0),this.ka=new Int8Array(0),this.la=new Int32Array(0),this.ma=new Int16Array(0),this.ia=e,this.ja=new Int32Array(3*e),this.ma=new Int16Array(e),this.ka=new Int8Array(t),this.la=new Int32Array(i+1)}function E(e,t,i,n,a){for(var o=n.length,r=1,s=0,l=0;l<o;++l){var c=n.charCodeAt(l);35==c?t[r++]=s:e[s++]=c}for(var l=0;l<363;++l)i[l]=a.charCodeAt(l)-32}function z(e,t,i,n,a,o,r){var s=t,l=o.ja,c=o.ka,d=o.la,h=3*r,f=l[h],p=l[h+1],u=l[h+2],m=d[f],g=d[f+1],P=d[u],$=d[u+1],b=p-11,v=p-0;for((b<1||b>9)&&(b=0),(v<1||v>9)&&(v=0);m!=g;)e[s++]=c[m++];b>a&&(b=a),n+=b,a-=b,a-=v;for(var y=a;y>0;)e[s++]=i[n++],y--;if(10==p||11==p){var X=s-a;for(10==p&&(a=1);a>0;){var w=255&e[X];w<192?(w>=97&&w<=122&&(e[X]^=32),X+=1,a-=1):w<224?(e[X+1]^=32,X+=2,a-=2):(e[X+2]^=5,X+=3,a-=3)}}else if(21==p||22==p)for(var Y=s-a,Q=o.ma[r],k=(32767&Q)+(16777216-(32768&Q));a>0;){var x=1,w=255&e[Y];if(w<128)k+=w,e[Y]=127&k;else if(w<192);else if(w<224)if(a>=2){var C=e[Y+1];k+=63&C|(31&w)<<6,e[Y]=192|k>>6&31,e[Y+1]=192&C|63&k,x=2}else x=a;else if(w<240)if(a>=3){var C=e[Y+1],j=e[Y+2];k+=63&j|(63&C)<<6|(15&w)<<12,e[Y]=224|k>>12&15,e[Y+1]=192&C|k>>6&63,e[Y+2]=192&j|63&k,x=3}else x=a;else if(w<248)if(a>=4){var C=e[Y+1],j=e[Y+2],A=e[Y+3];k+=63&A|(63&j)<<6|(63&C)<<12|(7&w)<<18,e[Y]=240|k>>18&7,e[Y+1]=192&C|k>>12&63,e[Y+2]=192&j|k>>6&63,e[Y+3]=192&A|63&k,x=4}else x=a;Y+=x,a-=x,21==p&&(a=0)}for(;P!=$;)e[s++]=c[P++];return s-t}function D(e,t){for(var i=1<<t-1;0!=(e&i);)i>>=1;return(e&i-1)+i}function N(e,t,i,n,a){do n-=i,e[t+n]=a;while(n>0)}function F(e,t,i){for(var n=1<<t-i;t<15&&(n-=e[t],!(n<=0));)t++,n<<=1;return t-i}function W(e,t,i,n,a){var o,r,s=e[t],l=new Int32Array(a),c=new Int32Array(16),d=new Int32Array(16);for(r=0;r<a;r++)c[n[r]]++;d[1]=0;for(var h=1;h<15;h++)d[h+1]=d[h]+c[h];for(r=0;r<a;r++)0!=n[r]&&(l[d[n[r]]++]=r);var f=i,p=1<<f,u=p;if(1==d[15]){for(o=0;o<u;o++)e[s+o]=l[0];return u}o=0,r=0;for(var h=1,m=2;h<=i;h++,m<<=1)for(;c[h]>0;c[h]--)N(e,s+o,m,p,h<<16|l[r++]),o=D(o,h);for(var g=u-1,P=-1,$=s,h=i+1,m=2;h<=15;h++,m<<=1)for(;c[h]>0;c[h]--)(o&g)!=P&&($+=p,f=F(c,h,i),p=1<<f,u+=p,P=o&g,e[s+P]=f+i<<16|$-s-P),N(e,$+(o>>i),m,p,h-i<<16|l[r++]),o=D(o,h);return u}function B(e){if(0!=e.na){if(_(e)>=-2)return;throw"No more input"}var t=e.g<<1,i=4096-t;for(e.oa.copyWithin(0,t,4096),e.g=0;i<4096;){var n=4096-i,a=ie(e.input,e.oa,i,n);if(a<=0){e.na=1,e.pa=i,i+=1;break}i+=a}K(e,i)}function M(e,t){if(0!=e.na){var i=(e.g<<1)+(e.d+7>>3)-4;if(i>e.pa)throw"Read after end";if(0!=t&&i!=e.pa)throw"Unused bytes after end"}}function H(e,t){var i=e.e>>>e.d&(1<<t)-1;return e.d+=t,i}function R(e,t){var i=H(e,16);return e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16,i|H(e,t-16)<<16}function U(e){e.oa=new Int8Array(4160),e.e=0,e.f=new Int16Array(2080),e.d=32,e.g=2048,e.na=0,O(e)}function O(e){e.g>2030&&B(e),M(e,0),e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16,e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16}function L(e){32==e.d&&O(e)}function J(e){var t=32-e.d&7;if(0!=t){var i=H(e,t);if(0!=i)throw"Corrupted padding bits"}}function _(e){var t=2048;return 0!=e.na&&(t=e.pa+1>>1),t-e.g}function G(e,t,i,n){if(0!=(7&e.d))throw"Unaligned copyBytes";for(;32!=e.d&&0!=n;)t[i++]=e.e>>>e.d,e.d+=8,n--;if(0!=n){var a=te(_(e),n>>1);if(a>0){var o=e.g<<1,r=a<<1;t.L(e.oa.M(o,o+r),i),i+=r,n-=r,e.g+=a}if(0!=n){if(_(e)>0){for(e.d>=16&&(e.e=e.f[e.g++]<<16|e.e>>>16,e.d-=16);0!=n;)t[i++]=e.e>>>e.d,e.d+=8,n--;return void M(e,0)}for(;n>0;){var s=ie(e.input,t,i,n);if(s==-1)throw"Unexpected end of input";i+=s,n-=s}}}}function K(e,t){for(var i=e.oa,n=t>>1,a=e.f,o=0;o<n;++o)a[o]=255&i[2*o]|(255&i[2*o+1])<<8}function V(e,t,i){for(var n=0;n<256;++n)e[n]=63&n,e[512+n]=n>>2,e[1792+n]=2+(n>>6);for(var n=0;n<128;++n)e[1024+n]=4*(t.charCodeAt(n)-32);for(var n=0;n<64;++n)e[1152+n]=1&n,e[1216+n]=2+(1&n);for(var a=1280,o=0;o<19;++o)for(var r=3&o,s=i.charCodeAt(o)-32,n=0;n<s;++n)e[a++]=r;for(var n=0;n<16;++n)e[1792+n]=1,e[2032+n]=6;e[1792]=0,e[2047]=7;for(var n=0;n<256;++n)e[1536+n]=e[1792+n]<<3}function Z(){this.K=new Int8Array(0),this.x=new Int8Array(0),this.w=new Int8Array(0),this.V=new Int8Array(0),this.l=new Int8Array(0),this._=new Int8Array(0),this.oa=new Int8Array(0),this.f=new Int16Array(0),this.qa=new Int32Array(0),this.r=new Int32Array(0),this.j=new Int32Array(0),this.O=new Int32Array(0),this.P=new Int32Array(0),this.Q=new Int32Array(0),this.m=new Int32Array(0),this.h=0,this.N=0,this.e=0,this.d=0,this.g=0,this.pa=0,this.na=0,this.o=0,this.n=0,this.p=0,this.q=0,this.s=0,this.t=0,this.A=0,this.B=0,this.D=0,this.F=0,this.W=0,this.ha=0,this.k=0,this.U=0,this.v=0,this.C=0,this.fa=0,this.da=0,this.u=0,this.G=0,this.y=0,this.z=0,this.ca=0,this.S=0,this.T=0,this.R=0,this.ga=0,this.ea=0,this.ba=0,this.H=0,this.J=0,this.I=0,this.aa=0,this.X=0,this.Y=0,this.$=0,this.Z=0,this.i=0,this.c=0,this.input=null,this.K=new Int8Array(0),this.r=new Int32Array(10),this.r[0]=16,this.r[1]=15,this.r[2]=11,this.r[3]=4}function ee(e,t,i,n){var a=oe(t+i);if(a.length!=e.length)throw"Corrupted brotli dictionary";for(var o=0,r=n.length,s=0;s<r;s+=2){var l=n.charCodeAt(s)-36,c=n.charCodeAt(s+1)-36;o+=l;for(var d=0;d<c;++d)a[o]|=128,o++}e.L(a)}function te(e,t){return e<=t?e:t}function ie(e,t,i,n){if(null==e)return-1;var a=te(e.b+n,e.a.length),o=a-e.b;return t.L(e.a.M(e.b,a),i),e.b+=o,o}function ne(e){return 0}function ae(e){}function oe(e){for(var t=e.length,i=new Int8Array(t),n=0;n<t;++n)i[n]=e.charCodeAt(n);return i}function re(t){var i=new Z;r(i,new e(t));for(var n=0,a=[];;){var o=new Int8Array(16384);if(a.push(o),i._=o,i.aa=0,i.X=16384,i.Y=0,T(i),n+=i.Y,i.Y<16384)break}s(i);for(var l=new Int8Array(n),c=0,d=0;d<a.length;++d){var o=a[d],h=te(n,c+16384),f=h-c;f<16384?l.L(o.M(0,f),c):l.L(o,c),c+=f}return l}var se=new Int8Array(0),le=Int32Array.from([256,402,436,468,500,534,566,598,630,662,694,726,758,790,822,854,886,920,952,984,1016,1048,1080]),ce=Int32Array.from([1,2,3,4,0,5,17,6,16,7,8,9,10,11,12,13,14,15]),de=Int32Array.from([0,3,2,1,0,0,0,0,0,0,3,3,3,3,3,3]),he=Int32Array.from([0,0,0,0,-1,1,-2,2,-3,3,-1,1,-2,2,-3,3]),fe=Int32Array.from([131072,131076,131075,196610,131072,131076,131075,262145,131072,131076,131075,196610,131072,131076,131075,262149]),pe=Int32Array.from([0,0,0,0,0,4096,9216,21504,35840,44032,53248,63488,74752,87040,93696,100864,104704,106752,108928,113536,115968,118528,119872,121280,122016]),ue=Int32Array.from([0,0,0,0,10,10,11,11,10,10,10,10,10,9,9,8,7,7,8,7,7,6,6,5,5]),me=Int32Array.from([1,5,9,13,17,25,33,41,49,65,81,97,113,145,177,209,241,305,369,497,753,1265,2289,4337,8433,16625]),ge=Int32Array.from([2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,6,6,7,8,9,10,11,12,13,24]),Pe=Int16Array.from([0,0,0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,7,8,9,10,12,14,24]),$e=Int16Array.from([0,0,0,0,0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,7,8,9,10,24]),be=new Int16Array(2816);a(be);var ve=new S(121,167,50);E(ve.ka,ve.la,ve.ja,'# #s #, #e #.# the #.com/#\xc2\xa0# of # and # in # to #"#">#\n#]# for # a # that #. # with #\'# from # by #. The # on # as # is #ing #\n\t#:#ed #(# at #ly #="# of the #. This #,# not #er #al #=\'#ful #ive #less #est #ize #ous #'," !! ! , *! &! \" ! ) * * - ! # ! #!*! + ,$ ! - % . / # 0 1 . \" 2 3!* 4% ! # / 5 6 7 8 0 1 & $ 9 + : ; < ' != > ?! 4 @ 4 2 & A *# ( B C& ) % ) !*# *-% A +! *. D! %' & E *6 F G% ! *A *% H! D I!+! J!+ K +- *4! A L!*4 M N +6 O!*% +.! K *G P +%( ! G *D +D Q +# *K!*G!+D!+# +G +A +4!+% +K!+4!*D!+K!*K");var ye=new Int32Array(2048);V(ye," !! ! \"#$##%#$&'##(#)#++++++++++((&*'##,---,---,-----,-----,-----&#'###.///.///./////./////./////&#'# ","A/* ': & : $ \x81 @");var Xe=new Int8Array(122784);return ee(Xe,'timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser\') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast\'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$(\'#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$("#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS"agedgreyGET"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:e*/\r\n 100hall.\n\nA7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,\r\n\r\ncoolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px\'\'););">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarmb\0\x19sboys[0].\');"POSTbearkids);}}marytend(UK)quadzh:f-siz----prop\');\rliftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene b\0\x14softrometillross<h3>pourfadepink<tr>mini)|!(minezh:hbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json\', \'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:d\'));puremageparatonebond:37Z_of_\']);000,zh:gtankyardbowlbush:56ZJava30px\n|}\n%C3%:34ZjeffEXPIcashvisagolfsnowzh:iquer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;\n}\nexit:35Zvarsbeat\'});diet999;anne}}</[i].LangkmB2wiretoysaddssealalex;\n\t}echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$(\'.50pxPh.Dmiscalanloandeskmileryanunixdisc);}\ndustclip).\n\n70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}\r\nHEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-\n!002)ndow[1];[];\nLog salt\r\n\t\tbangtrimbath){\r\n00px\n});ko:lfeesad>\rs:// [];tollplug(){\n{\r\n .js\'200pdualboat.JPG);\n}quot);\n\n\');\n\r\n}\r201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomC!sesteestaperotodohacecadaaC1obiendC-aasC-vidacasootroforosolootracualdijosidograntipotemadebealgoquC)estonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiP7P0P=P0P>P<Q\0P0Q\0Q\x03Q\x02P0P=P5P?P>P>Q\x02P8P7P=P>P4P>Q\x02P>P6P5P>P=P8Q\x05P\x1dP0P5P5P1Q\vP<Q\vP\x12Q\vQ\x01P>P2Q\vP2P>P\x1dP>P>P1P\x1fP>P;P8P=P8P P$P\x1dP5P\x1cQ\vQ\x02Q\vP\x1eP=P8P<P4P0P\x17P0P\x14P0P\x1dQ\x03P\x1eP1Q\x02P5P\x18P7P5P9P=Q\x03P<P<P"Q\vQ\x03P6Y\x01Y\nX#Y\x06Y\x05X\'Y\x05X9Y\x03Y\x04X#Y\bX1X/Y\nX\'Y\x01Y\tY\x07Y\bY\x04Y\x05Y\x04Y\x03X\'Y\bY\x04Y\x07X(X3X\'Y\x04X%Y\x06Y\x07Y\nX#Y\nY\x02X/Y\x07Y\x04X+Y\x05X(Y\x07Y\x04Y\bY\x04Y\nX(Y\x04X\'Y\nX(Y\x03X4Y\nX\'Y\x05X#Y\x05Y\x06X*X(Y\nY\x04Y\x06X-X(Y\x07Y\x05Y\x05X4Y\bX4firstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow">genretrucklooksValueFrame.net/-->\n<try {\nvar makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top">\n<!--POST"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url="parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();" Blocklinuxjonespixel\');">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar">.src=toweralt="cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});\r\nbandsqueue= {};80px;cking{\r\n\t\taheadclockirishlike ratiostatsForm"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg"spainbeachtaxesmicroangel--></giftssteve-linkbody.});\n\tmount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:c\x02simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/"1.jpgwmodeparamSTARTleft idden, 201);\n}\nform.viruschairtransworstPagesitionpatch<!--\no-cacfirmstours,000 asiani++){adobe\')[0]id=10both;menu .2.mi.png"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120" sweettr>\r\nname=diegopage swiss-->\n\n#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:c\x03id="cName"worseshots-box-delta\n&lt;bears:48Z<data-rural</a> spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe<img img">, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknows</h5>faq">zh-cn10);\n-1");type=bluestrulydavis.js\';>\r\n<!steel you h2>\r\nform jesus100% menu.\r\n\t\r\nwalesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeaC1osestC!tienehastaotrospartedondenuevohacerformamismomejormundoaquC-dC-assC3loayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaC-snuevasaludforosmedioquienmesespoderchileserC!vecesdecirjosC)estarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocC3moenerojuegoperC:haberestoynuncamujervalorfueralibrogustaigualvotoscasosguC-apuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleC3nplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenC!readiscopedrocercapuedapapelmenorC:tilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniC1oquedapasarbancohijosviajepabloC)stevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallC-jovendichaestantalessalirsuelopesosfinesllamabuscoC)stalleganegroplazahumorpagarjuntadobleislasbolsabaC1ohablaluchaC\x01readicenjugarnotasvalleallC!cargadolorabajoestC)gustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename="amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.\n\nOnejoinedmenu">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo">beyond-scaleacceptservedmarineFootercamera</h1>\n_form"leavesstress" />\r\n.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop"><racingresize--&gt;pacitysexualbureau.jpg" 10,000obtaintitlesamount, Inc.comedymenu" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body">\n* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox">\nSystem DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String\n\nWhiltaylorclear:resortfrenchthough") + "<body>buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink">Images=falsewhile hspace0&amp; \n\nIn powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml" rights.html-blockregExp:hoverwithinvirginphones</tr>\rusing \n\tvar >\');\n\t</td>\n</tr>\nbahasabrasilgalegomagyarpolskisrpskiX1X/Y\bd8-f\x16\x07g.\0d=\x13g9\x01i+\x14d?!f\x01/d8-e\x1b=f\b\x11d;,d8\0d8*e\x05,e\x0f8g.!g\x10\x06h.:e\x1d\x1be\x0f/d;%f\x1c\re\n!f\x176i\x174d8*d::d:\'e\x13\x01h\x07*e71d<\x01d8\x1af\x1f%g\x1c\ve7%d=\x1ch\x01\x14g3;f2!f\x1c\tg=\x11g+\x19f\t\0f\x1c\th/\x04h.:d8-e?\x03f\x16\x07g+ g\x14(f\b7i&\x16i!5d=\x1ch\0\x05f\n\0f\x1c/i\x17.i"\x18g\x1b8e\x053d8\vh==f\x10\x1cg4"d=?g\x14(h=/d;6e\x1c(g:?d8;i"\x18h5\x04f\x16\x19h\'\x06i"\x11e\x1b\x1ee$\rf3(e\x06\fg=\x11g;\x1cf\x146h\x17\x0fe\x06\x05e.9f\x0e(h\r\x10e8\x02e\x1c:f6\bf\x01/g):i\x174e\x0f\x11e8\x03d;\0d9\be%=e\x0f\vg\x14\x1ff4;e\x1b>g\t\x07e\x0f\x11e1\x15e&\x02f\x1e\x1cf\t\vf\x1c:f\x160i\x17;f\x1c\0f\x160f\x169e<\x0fe\f\x17d:,f\x0f\x10d>\x1be\x053d:\x0ef\x1b4e$\x1ah?\x19d8*g3;g;\x1fg\x1f%i\x01\x13f88f\b\x0fe9?e\x11\ne\x056d;\x16e\x0f\x11h!(e.\te\x05(g,,d8\0d<\x1ae\x11\x18h?\x1bh!\fg\x029e\x07;g\t\bf\x1d\x03g\x145e-\x10d8\x16g\x15\fh.>h.!e\x05\rh49f\x15\x19h\x022e\n e\x05%f4;e\n(d;\x16d;,e\x15\x06e\x13\x01e\r\x1ae."g\x0e0e\x1c(d8\nf57e&\x02d=\x15e72g;\x0fg\x15\x19h(\0h/&g;\x06g$>e\f:g\x19;e=\x15f\x1c,g+\x19i\x1c\0h&\x01d;7f <f\x14/f\f\x01e\x1b=i\x19\x05i\x13>f\x0e%e\x1b=e.6e;:h.>f\x1c\ve\x0f\vi\x18\x05h/;f3\x15e>\vd=\rg=.g;\x0ff5\x0ei\0\tf\v)h?\x19f 7e=\x13e\t\re\b\x06g1;f\x0e\x12h!\fe\x1b d8:d:$f\x18\x13f\x1c\0e\x10\x0ei\x1f3d9\x10d8\rh\x03=i\0\x1ah?\x07h!\fd8\x1ag\'\x11f\n\0e\x0f/h\x03=h.>e$\x07e\x10\bd=\x1ce$\'e.6g$>d<\x1ag \x14g)6d8\x13d8\x1ae\x05(i\x03(i!9g\x1b.h?\x19i\x07\fh?\x18f\x18/e<\0e\'\vf\x03\x05e\x065g\x145h\x04\x11f\x16\x07d;6e\x13\x01g\t\fe8.e\n)f\x16\x07e\f\x16h5\x04f:\x10e$\'e-&e-&d9 e\x1c0e\x1d\0f5\x0fh\'\bf\n\x15h5\x04e7%g(\vh&\x01f1\x02f\0\x0ed9\bf\x176e\0\x19e\n\x1fh\x03=d8;h&\x01g\x1b.e\t\rh5\x04h./e\x1f\x0ee8\x02f\x169f3\x15g\x145e=1f\v\x1bh\x01\x18e#0f\x18\x0ed;;d=\x15e\x01%e:7f\x150f\r.g>\x0ee\x1b=f1=h=&d;\vg;\rd=\x06f\x18/d:$f5\x01g\x14\x1fd:\'f\t\0d;%g\x145h/\x1df\x18>g$:d8\0d:\x1be\r\x15d=\rd::e\x11\x18e\b\x06f\x1e\x10e\x1c0e\x1b>f\x17\x05f88e7%e\x057e-&g\x14\x1fg3;e\b\x17g=\x11e\x0f\ve8\x16e-\x10e/\x06g \x01i"\x11i\x01\x13f\x0e\'e\b6e\x1c0e\f:e\x1f:f\x1c,e\x05(e\x1b=g=\x11d8\ni\x07\rh&\x01g,,d:\fe\x16\x1cf,"h?\x1be\x05%e\x0f\vf\x03\x05h?\x19d:\x1bh\0\x03h/\x15e\x0f\x11g\x0e0e\x1f9h.-d;%d8\nf\x14?e:\x1cf\b\x10d8:g\x0e/e"\x03i&\x19f8/e\x10\ff\x176e(1d9\x10e\x0f\x11i\0\x01d8\0e.\x1ae<\0e\x0f\x11d=\x1ce\x13\x01f \x07e\x07\x06f,"h?\x0eh\'#e\x063e\x1c0f\x169d8\0d8\vd;%e\x0f\nh4#d;;f\b\x16h\0\x05e."f\b7d;#h!(g\'/e\b\x06e%3d::f\x150g \x01i\x14\0e\x14.e\x07:g\x0e0g&;g:?e:\x14g\x14(e\b\x17h!(d8\re\x10\fg<\x16h>\x11g;\x1fh.!f\x1f%h/"d8\rh&\x01f\x1c\te\x053f\x1c:f\x1e\x04e>\be$\x1af\x12-f\x14>g;\x04g;\x07f\x14?g-\x16g\x1b4f\x0e%h\x03=e\n\x1bf\x1d%f:\x10f\x19\x02i\x16\x13g\x1c\ve\b0g\x03-i\x17(e\x053i\x14.d8\x13e\f:i\x1d\x1ee88h\v1h/-g\x19>e:&e8\ff\x1c\x1bg>\x0ee%3f/\x14h>\x03g\x1f%h/\x06h\'\x04e.\x1ae;:h..i\x03(i\x17(f\x04\x0fh\'\x01g2>e=)f\x17%f\x1c,f\x0f\x10i+\x18e\x0f\x11h(\0f\x169i\x1d"e\x1f:i\x07\x11e$\x04g\x10\x06f\x1d\x03i\x19\x10e=1g\t\x07i\x136h!\fh?\x18f\x1c\te\b\x06d:+g\t)e\x13\x01g;\x0fh\x10%f7;e\n d8\x13e.6h?\x19g\'\rh/\x1di"\x18h57f\x1d%d8\x1ae\n!e\x05,e\x11\nh.0e=\x15g.\0d;\vh4(i\x07\x0fg\x147d::e=1e\x13\re<\x15g\x14(f\n%e\x11\ni\x03(e\b\x06e?+i\0\x1fe\x12(h/"f\x176e0\x1af3(f\x04\x0fg\x143h/7e-&f !e:\x14h/%e\x0e\x06e\x0f2e\x0f*f\x18/h?\x14e\x1b\x1eh4-d90e\x10\rg\'0d8:d:\x06f\b\x10e\n\x1fh/4f\x18\x0ed>\x1be:\x14e-)e-\x10d8\x13i"\x18g(\ve:\x0fd8\0h\b,f\x1c\x03e\x13!e\x0f*f\x1c\te\x056e.\x03d?\x1df\n$h\0\fd8\x14d;\ne$)g*\x17e\x0f#e\n(f\0\x01g\n6f\0\x01g\t9e\b+h.$d8:e?\x05i!;f\x1b4f\x160e0\x0fh/4f\b\x11e\0\x11d=\x1cd8:e*\x12d=\x13e\f\x05f\v,i\x02#d9\bd8\0f 7e\x1b=e\x06\x05f\x18/e\x10&f 9f\r.g\x145h\'\x06e-&i\x19"e\x057f\x1c\th?\x07g(\vg\x141d:\x0ed::f\t\re\x07:f\x1d%d8\rh?\x07f-#e\x1c(f\x18\x0ef\x18\x1ff\x15\x05d:\ve\x053g3;f \x07i"\x18e\x15\x06e\n!h>\x13e\x05%d8\0g\x1b4e\x1f:g!\0f\x15\x19e-&d:\x06h\'#e;:g-\x11g;\x13f\x1e\x1ce\x05(g\x10\x03i\0\x1ag\x1f%h.!e\b\x12e/9d:\x0eh\t:f\x1c/g\x1b8e\x06\fe\x0f\x11g\x14\x1fg\x1c\x1fg\x1a\x04e;:g+\vg-\tg:\'g1;e\x1e\vg;\x0fi*\fe.\x1eg\x0e0e\b6d=\x1cf\x1d%h\x07*f \x07g->d;%d8\ve\x0e\x1fe\b\x1bf\x17 f3\x15e\x056d8-e\0\vd::d8\0e\b\x07f\f\x07e\r\x17e\x053i\x17-i\x1b\x06e\x1b"g,,d8\te\x053f3(e\x1b f-$g\x05\'g\t\x07f71e\x1c3e\x15\x06d8\x1ae9?e7\x1ef\x17%f\x1c\x1fi+\x18g:\'f\x1c\0h?\x11g;<e\x10\bh!(g$:d8\x13h>\x11h!\fd8:d:$i\0\x1ah/\x04d;7h\'\te>\x17g2>e\r\x0ee.6e:-e.\ff\b\x10f\x04\x1fh\'\te.\th#\x05e>\x17e\b0i\x02.d;6e\b6e:&i#\x1fe\x13\x01h\x19=g\x046h=,h==f\n%d;7h.0h\0\x05f\x169f!\bh!\ff\x14?d::f0\x11g\x14(e\x13\x01d8\x1ch%?f\x0f\x10e\x07:i\x05\x12e:\x17g\x046e\x10\x0ed;\x18f,>g\x03-g\x029d;%e\t\re.\fe\x05(e\x0f\x11e8\x16h.>g=.i"\x06e/<e7%d8\x1ae\f;i\x19"g\x1c\vg\x1c\vg;\x0fe\x058e\x0e\x1fe\x1b e93e\x0f0e\x10\x04g\'\re"\x1ee\n f\x1d\x10f\x16\x19f\x160e"\x1ed9\ve\x10\x0eh\x01\fd8\x1af\x15\bf\x1e\x1cd;\ne94h.:f\x16\x07f\b\x11e\x1b=e\x11\nh/\tg\t\bd8;d?.f\x149e\x0f\x02d8\x0ef\t\x13e\r0e?+d9\x10f\x1c:f"0h\'\x02g\x029e-\x18e\x1c(g2>g%\x1eh\x0e7e>\x17e\b)g\x14(g;\'g;-d= d;,h?\x19d9\bf(!e<\x0fh/-h(\0h\x03=e$\x1fi\x1b\x05h\x19\x0ef\x13\rd=\x1ci#\x0ef <d8\0h57g\'\x11e-&d=\x13h\x022g\x1f-d?!f\x1d!d;6f2;g\x16\x17h?\x10e\n(d:\'d8\x1ad<\x1ah..e/<h\b*e\x05\bg\x14\x1fh\x01\x14g\x1b\x1fe\x0f/f\x18/e\x15\x0fi!\fg;\x13f\x1e\x04d=\x1cg\x14(h0\x03f\x1f%h3\x07f\x16\x19h\x07*e\n(h4\x1fh4#e\x06\x1cd8\x1ah.?i\x17.e.\x1ef\x16=f\x0e%e\x0f\x17h.(h.:i\x02#d8*e\x0f\ri&\be\n e<:e%3f\0\'h\f\x03e\x1b4f\x1c\re\v\x19d<\x11i\x172d;\nf\x17%e."f\x1c\rh\'\0g\x1c\ve\x0f\x02e\n g\x1a\x04h/\x1dd8\0g\x029d?\x1dh/\x01e\x1b>d9&f\x1c\tf\x15\bf5\vh/\x15g\';e\n(f\t\rh\x03=e\x063e.\x1ah\x02!g%(d8\rf\x16-i\x1c\0f1\x02d8\re>\x17e\n\x1ef3\x15d9\vi\x174i\x07\x07g\x14(h\x10%i\x14\0f\n\x15h/\tg\x1b.f \x07g\b1f\x03\x05f\x11\x04e=1f\x1c\td:\x1bh$\x07h#=f\x16\x07e-&f\x1c:d<\x1af\x150e-\x17h#\x05d?.h4-g\t)e\x06\x1cf\x1d\x11e\x05(i\x1d"g2>e\x13\x01e\x056e.\x1ed:\vf\x03\x05f04e93f\x0f\x10g$:d8\ne8\x02h0"h0"f\x19.i\0\x1af\x15\x19e8\bd8\nd< g1;e\b+f-\ff\x1b2f\v%f\x1c\te\b\x1bf\x160i\x05\rd;6e\x0f*h&\x01f\x176d;#h3\x07h(\nh>>e\b0d::g\x14\x1fh."i\x18\x05h\0\x01e8\be1\x15g$:e?\x03g\x10\x06h44e-\x10g62g+\x19d8;i!\fh\x07*g\x046g:\'e\b+g.\0e\r\x15f\x149i\x1d)i\x02#d:\x1bf\x1d%h/4f\t\x13e<\0d;#g \x01e\b i\x19$h/\x01e\b8h\n\x02g\x1b.i\x07\rg\x029f,!f\x158e$\x1ae0\x11h\'\x04e\b\x12h5\x04i\x07\x11f\t>e\b0d;%e\x10\x0ee$\'e\x05(d8;i!5f\x1c\0d=3e\x1b\x1eg-\x14e$)d8\vd?\x1di\x1a\x1cg\x0e0d;#f#\0f\x1f%f\n\x15g%(e0\x0ff\x176f2\x12f\x1c\tf-#e88g\x14\x1ah\x073d;#g\x10\x06g\x1b.e=\x15e\x05,e<\0e$\re\b6i\x07\x11h\x1e\re98g&\x0fg\t\bf\x1c,e="f\b\x10e\x07\x06e$\x07h!\ff\x03\x05e\x1b\x1ee\b0f\0\x1df\x033f\0\x0ef 7e\r\x0fh..h.$h/\x01f\x1c\0e%=d:\'g\x14\x1ff\f\tg\x05\'f\x1c\rh#\x05e9?d8\x1ce\n(f<+i\x07\x07h4-f\x160f\t\vg;\x04e\x1b>i\x1d"f\x1d?e\x0f\x02h\0\x03f\x14?f2;e.9f\x18\x13e$)e\x1c0e\n*e\n\x1bd::d;,e\r\x07g:\'i\0\x1fe:&d::g\t)h0\x03f\x154f5\x01h!\fi\0 f\b\x10f\x16\x07e-\x17i\x1f)e\x1b=h48f\x18\x13e<\0e1\x15g\x1b8i\x17\x1ch!(g\x0e0e=1h\'\x06e&\x02f-$g>\x0ee.9e$\'e0\x0ff\n%i\x01\x13f\x1d!f,>e?\x03f\x03\x05h.8e$\x1af3\x15h\'\x04e.6e1\x05d9&e:\x17h?\x1ef\x0e%g+\ve\r3d8>f\n%f\n\0e7\'e%%h?\x10g\x19;e\x05%d;%f\x1d%g\x10\x06h.:d:\vd;6h\x07*g\x141d8-e\r\x0ee\n\x1ee\x05,e&\be&\bg\x1c\x1ff-#d8\ri\x14\x19e\x05(f\x16\x07e\x10\be\x10\fd;7e\0<e\b+d::g\x1b\x11g\x1d#e\x057d=\x13d8\x16g:*e\x1b"i\x18\x1fe\b\x1bd8\x1af\t?f\v\x05e"\x1ei\x15?f\x1c\td::d?\x1df\f\x01e\x15\x06e.6g;4d?.e\x0f0f9>e7&e\x0f3h\x02!d;=g-\x14f!\be.\x1ei\x19\x05g\x145d?!g;\x0fg\x10\x06g\x14\x1fe\x11=e.#d< d;;e\n!f-#e<\x0fg\t9h\t2d8\vf\x1d%e\r\x0fd<\x1ae\x0f*h\x03=e=\x13g\x046i\x07\rf\x160e\x05\'e.9f\f\x07e/<h?\x10h!\ff\x17%e?\x17h3#e.6h6\x05h?\x07e\x1c\x1fe\x1c0f5\x19f1\x1ff\x14/d;\x18f\x0e(e\x07:g+\x19i\x15?f\x1d-e7\x1ef\t\'h!\fe\b6i\0 d9\vd8\0f\x0e(e9?g\x0e0e\x1c:f\x0f\x0fh?0e\x0f\x18e\f\x16d< g;\x1ff-\ff\t\vd?\x1di\x19)h/>g(\ve\f;g\x16\x17g;\x0fh?\x07h?\x07e\x0e;d9\ve\t\rf\x146e\x05%e94e:&f\x1d\x02e?\x17g>\x0ed8=f\x1c\0i+\x18g\x19;i\x19\x06f\x1c*f\x1d%e\n e7%e\x05\rh4#f\x15\x19g(\vg\t\be\x1d\x17h:+d=\x13i\x07\re:\x06e\x07:e\x14.f\b\x10f\x1c,e="e<\x0fe\x1c\x1fh1\x06e\x07:e\x039d8\x1cf\x169i\x02.g.1e\r\x17d:,f1\x02h\x01\fe\x0f\x16e>\x17h\x01\fd=\rg\x1b8d?!i!5i\x1d"e\b\x06i\x12\x1fg=\x11i!5g!.e.\x1ae\x1b>d>\vg=\x11e\x1d\0g\'/f\x1e\x01i\x14\x19h//g\x1b.g\x1a\x04e.\x1dh4\x1df\x1c:e\x053i#\x0ei\x19)f\x0e\bf\x1d\x03g\x17\x05f/\x12e. g\t)i\x19$d:\x06h)\x15h+\x16g\x16>g\x17\x05e\x0f\nf\x176f1\x02h4-g+\x19g\x029e\x04?g+%f/\x0fe$)d8-e$.h.$h/\x06f/\x0fd8*e$)f4%e-\x17d=\x13e\x0f0g\x01#g;4f\n$f\x1c,i!5d8*f\0\'e.\x18f\x169e88h\'\x01g\x1b8f\x1c:f\b\x18g\x15%e:\x14e=\x13e>\ve8\bf\x169d>?f !e\x1b-h\x02!e8\x02f\b?e1\vf \x0fg\x1b.e\x11\x18e7%e/<h\x074g*\x01g\x046i\x01\x13e\x057f\x1c,g=\x11g;\x13e\x10\bf!#f!\be\n3e\n(e\x0f&e$\x16g>\x0ee\x05\x03e<\x15h57f\x149e\x0f\x18g,,e\x1b\x1bd<\x1ah.!h**f\x18\x0ei\x1a\x10g\'\x01e.\x1de.\x1dh\'\x04h\f\x03f6\bh49e\x051e\x10\fe?\x18h.0d=\x13g3;e8&f\x1d%e\x10\re-\x17g\x19<h!(e<\0f\x14>e\n g\x1b\x1fe\x0f\x17e\b0d:\ff\t\ve$\'i\x07\x0ff\b\x10d::f\x150i\x07\x0fe\x051d:+e\f:e\x1f\x1fe%3e-)e\x0e\x1fe\b\x19f\t\0e\x1c(g;\x13f\x1d\x1fi\0\x1ad?!h6\x05g:\'i\x05\rg=.e=\x13f\x176d<\x18g\'\0f\0\'f\x04\x1ff\b?d:\'i\x01\nf\b2e\x07:e\x0f#f\x0f\x10d:$e01d8\x1ad?\x1de\x01%g(\ve:&e\x0f\x02f\x150d:\vd8\x1af\x154d8*e11d8\x1cf\x03\x05f\x04\x1fg\t9f.\ne\b\x06i!\x1ef\x10\x1ce0\ve1\x1ed:\x0ei\x17(f\b7h4"e\n!e#0i\x1f3e\x0f\ne\x056h4"g;\x0fe\x1d\x1af\f\x01e92i\x03(f\b\x10g+\ve\b)g\x1b\nh\0\x03h\x19\x11f\b\x10i\x03=e\f\x05h#\x05g\x14(f\b6f/\x14h5\x1bf\x16\x07f\x18\x0ef\v\x1be\x15\x06e.\ff\x154g\x1c\x1ff\x18/g\x1c<g\x1d\x1bd<\x19d<4e(\x01f\x1c\x1bi"\x06e\x1f\x1fe\r+g\x14\x1fd<\x18f\x03 h+\x16e#\x07e\x05,e\x051h\t/e%=e\x05\x05e\b\x06g,&e\x10\bi\x19\x04d;6g\t9g\x029d8\re\x0f/h\v1f\x16\x07h5\x04d:\'f 9f\x1c,f\x18\x0ef\x18>e/\x06g"<e\x05,d<\x17f0\x11f\x17\x0ff\x1b4e\n d:+e\x0f\x17e\x10\fe-&e\x10/e\n(i\0\x02e\x10\be\x0e\x1ff\x1d%i\x17.g-\x14f\x1c,f\x16\x07g>\x0ei#\x1fg;?h\t2g(3e.\x1ag;\bd:\x0eg\x14\x1fg\t)d>\x1bf1\x02f\x10\x1cg\v\x10e\n\x1bi\x07\x0fd8%i\x07\rf08h?\x1ce\x06\x19g\x1c\x1ff\x1c\ti\x19\x10g+\x1ed:\te/9h1!h49g\x14(d8\re%=g;\x1de/9e\r\x01e\b\x06d?\x03h?\x1bg\x029h/\x04e=1i\x1f3d<\x18e\n?d8\re0\x11f,#h5\x0fe96d8\x14f\x1c\tg\x029f\x169e\x10\x11e\x05(f\x160d?!g\x14(h.>f\x16=e="h1!h5\x04f <g*\x01g 4i\x1a\x0fg\x1d\0i\x07\re$\'d:\x0ef\x18/f/\x15d8\x1af\x19:h\x03=e\f\x16e7%e.\fg>\x0ee\x15\x06e\x1f\x0eg;\x1fd8\0e\x07:g\t\bf\t\x13i\0 g\x14"e\x13\x01f&\x02e\x065g\x14(d:\x0ed?\x1dg\x15\x19e\x1b g4 d8-e\x1c\ve-\x18e\x02(h44e\x1b>f\x1c\0f\x04\x1bi\x15?f\x1c\x1fe\x0f#d;7g\x10\x06h4"e\x1f:e\x1c0e.\tf\x0e\x12f-&f1\ti\x07\fi\x1d"e\b\x1be;:e$)g):i&\x16e\x05\be.\fe\x16\x04i)1e\n(d8\vi\x1d"d8\re\x06\rh/\x1ad?!f\x04\x0fd9\ti\x183e\x05\th\v1e\x1b=f<\x02d:.e\x06\x1bd:\vg\x0e)e.6g>$d<\x17e\x06\x1cf0\x11e\r3e\x0f/e\x10\rg(1e.6e\x057e\n(g\x14;f\x033e\b0f3(f\x18\x0ee0\x0fe-&f\0\'h\x03=h\0\x03g \x14g!,d;6h\'\x02g\x1c\vf8\x05f%\x1af\x10\x1eg,\x11i&\x16i \x01i;\x04i\x07\x11i\0\x02g\x14(f1\x1fh\v\x0fg\x1c\x1fe.\x1ed8;g.!i\x186f.5h(;e\x06\ng?;h/\x11f\x1d\x03e\b)e\x01\x1ae%=d<<d9\x0ei\0\x1ah./f\x16=e7%g\v\0f\x05\vd9\x1fh.8g\x0e/d?\x1de\x1f9e\x05;f&\x02e?5e$\'e\x1e\vf\x1c:g%(g\x10\x06h\'#e\f?e\x10\rcuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestC!nnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegC:nbuenosvolverpuntossemanahabC-aagostonuevosunidoscarlosequiponiC1osmuchosalgunacorreoimagenpartirarribamarC-ahombreempleoverdadcambiomuchasfueronpasadolC-neaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposserC!neuropamediosfrenteacercademC!sofertacochesmodeloitalialetrasalgC:ncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrC!puestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosC:nicocaminositiosrazC3ndebidopruebatoledotenC-ajesC:sesperococinaorigentiendacientocC!dizhablarserC-alatinafuerzaestiloguerraentrarC)xitolC3pezagendavC-deoevitarpaginametrosjavierpadresfC!cilcabezaC!reassalidaenvC-ojapC3nabusosbienestextosllevarpuedanfuertecomC:nclaseshumanotenidobilbaounidadestC!seditarcreadoP4P;Q\x0fQ\x07Q\x02P>P:P0P:P8P;P8Q\rQ\x02P>P2Q\x01P5P5P3P>P?Q\0P8Q\x02P0P:P5Q\tP5Q\x03P6P5P\x1aP0P:P1P5P7P1Q\vP;P>P=P8P\x12Q\x01P5P?P>P4P-Q\x02P>Q\x02P>P<Q\x07P5P<P=P5Q\x02P;P5Q\x02Q\0P0P7P>P=P0P3P4P5P<P=P5P\x14P;Q\x0fP\x1fQ\0P8P=P0Q\x01P=P8Q\x05Q\x02P5P<P:Q\x02P>P3P>P4P2P>Q\x02Q\x02P0P<P!P(P\x10P<P0Q\x0fP\'Q\x02P>P2P0Q\x01P2P0P<P5P<Q\x03P"P0P:P4P2P0P=P0P<Q\rQ\x02P8Q\rQ\x02Q\x03P\x12P0P<Q\x02P5Q\x05P?Q\0P>Q\x02Q\x03Q\x02P=P0P4P4P=Q\x0fP\x12P>Q\x02Q\x02Q\0P8P=P5P9P\x12P0Q\x01P=P8P<Q\x01P0P<Q\x02P>Q\x02Q\0Q\x03P1P\x1eP=P8P<P8Q\0P=P5P5P\x1eP\x1eP\x1eP;P8Q\x06Q\rQ\x02P0P\x1eP=P0P=P5P<P4P>P<P<P>P9P4P2P5P>P=P>Q\x01Q\x03P4`$\x15`%\x07`$9`%\b`$\x15`%\0`$8`%\x07`$\x15`$>`$\x15`%\v`$\x14`$0`$*`$0`$(`%\x07`$\x0f`$\x15`$\x15`$?`$-`%\0`$\x07`$8`$\x15`$0`$$`%\v`$9`%\v`$\x06`$*`$9`%\0`$/`$9`$/`$>`$$`$\x15`$%`$>jagran`$\x06`$\x1c`$\x1c`%\v`$\x05`$,`$&`%\v`$\x17`$\b`$\x1c`$>`$\x17`$\x0f`$9`$.`$\x07`$(`$5`$9`$/`%\x07`$%`%\x07`$%`%\0`$\x18`$0`$\x1c`$,`$&`%\0`$\x15`$\b`$\x1c`%\0`$5`%\x07`$(`$\b`$(`$\x0f`$9`$0`$\t`$8`$.`%\x07`$\x15`$.`$5`%\v`$2`%\x07`$8`$,`$.`$\b`$&`%\x07`$\x13`$0`$\x06`$.`$,`$8`$-`$0`$,`$(`$\x1a`$2`$.`$(`$\x06`$\x17`$8`%\0`$2`%\0X9Y\x04Y\tX%Y\x04Y\tY\x07X0X\'X"X.X1X9X/X/X\'Y\x04Y\tY\x07X0Y\x07X5Y\bX1X:Y\nX1Y\x03X\'Y\x06Y\bY\x04X\'X(Y\nY\x06X9X1X6X0Y\x04Y\x03Y\x07Y\x06X\'Y\nY\bY\x05Y\x02X\'Y\x04X9Y\x04Y\nX\'Y\x06X\'Y\x04Y\x03Y\x06X-X*Y\tY\x02X(Y\x04Y\bX-X)X\'X.X1Y\x01Y\x02X7X9X(X/X1Y\x03Y\x06X%X0X\'Y\x03Y\x05X\'X\'X-X/X%Y\x04X\'Y\x01Y\nY\x07X(X9X6Y\x03Y\nY\x01X(X-X+Y\bY\x05Y\x06Y\bY\x07Y\bX#Y\x06X\'X,X/X\'Y\x04Y\x07X\'X3Y\x04Y\x05X9Y\x06X/Y\x04Y\nX3X9X(X1X5Y\x04Y\tY\x05Y\x06X0X(Y\x07X\'X#Y\x06Y\x07Y\x05X+Y\x04Y\x03Y\x06X*X\'Y\x04X\'X-Y\nX+Y\x05X5X1X4X1X-X-Y\bY\x04Y\bY\x01Y\nX\'X0X\'Y\x04Y\x03Y\x04Y\x05X1X)X\'Y\x06X*X\'Y\x04Y\x01X#X(Y\bX.X\'X5X#Y\x06X*X\'Y\x06Y\x07X\'Y\x04Y\nX9X6Y\bY\bY\x02X/X\'X(Y\x06X.Y\nX1X(Y\x06X*Y\x04Y\x03Y\x05X4X\'X!Y\bY\x07Y\nX\'X(Y\bY\x02X5X5Y\bY\x05X\'X1Y\x02Y\x05X#X-X/Y\x06X-Y\x06X9X/Y\x05X1X#Y\nX\'X-X)Y\x03X*X(X/Y\bY\x06Y\nX,X(Y\x05Y\x06Y\x07X*X-X*X,Y\x07X)X3Y\x06X)Y\nX*Y\x05Y\x03X1X)X:X2X)Y\x06Y\x01X3X(Y\nX*Y\x04Y\x04Y\x07Y\x04Y\x06X\'X*Y\x04Y\x03Y\x02Y\x04X(Y\x04Y\x05X\'X9Y\x06Y\x07X#Y\bY\x04X4Y\nX!Y\x06Y\bX1X#Y\x05X\'Y\x01Y\nY\x03X(Y\x03Y\x04X0X\'X*X1X*X(X(X#Y\x06Y\x07Y\x05X3X\'Y\x06Y\x03X(Y\nX9Y\x01Y\x02X/X-X3Y\x06Y\x04Y\x07Y\x05X4X9X1X#Y\x07Y\x04X4Y\x07X1Y\x02X7X1X7Y\x04X(profileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>\r\nwrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1\']);\nconfirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.\n\nThe but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})();\r\npaymenttroubleconceptcompareparentsplayersregionsmonitor \'\'The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen\n\nWhen observe</h2>\r\nModern provide" alt="borders.\n\nFor \n\nMany artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>\r\n Countryignoredloss ofjust asGeorgiastrange<head><stopped1\']);\r\nislandsnotableborder:list ofcarried100,000</h3>\n severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})();\n\nburningoperatedegreessource=Richardcloselyplasticentries</tr>\r\ncolor:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br />\n: true,chartertourismclassicproceedexplain</h1>\r\nonline.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn\'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e&quot;tradingleft">\npersonsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy\n\t\t<!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| [];\nDATA[ *kitchenmountedactual dialectmainly _blank\'installexpertsif(typeIt also&copy; ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in\n\t<!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday\'s.html" target=wearingAll Rig;\n})();raising Also, crucialabout">declare-->\n<scfirefoxas muchappliesindex, s, but type = \n\r\n<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>\r\n returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of\n\nSome \'click\'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu">\nmonthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>\nevidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>\n he left).val()false);logicalbankinghome tonaming Arizonacredits);\n});\nfounderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered\']);\n has theunclearEvent\',both innot all\n\n<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&amp;as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don\'tretreat. Some ww.");\nbombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>\n\n. When in bothdismissExplorealways via thespaC1olwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>\n\t\tit intoranked rate oful>\r\n attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture-->\r\n\r\n rows=" objectinverse<footerCustomV><\\/scrsolvingChamberslaverywoundedwhereas!= \'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead\')[0Criticsstudios>&copy;group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr\'+\'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" />\n\t\there isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();\n is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of});\r\n immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0];\n it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen\'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in\']);\r\n marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = \'make a securedBaptistvoting \n\t\tvar March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header\n<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;">\r\npushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>\npeople.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />\r\nAtlantanucleusCounty,purely count">easily build aonclicka givenpointerh&quot;events else {\nditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a >\r\n\r\n\r\nmarket.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks">\n();" rea place\\u003Caabout atr>\r\n\t\tccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>\r\n<ustomVa;&gt;</importsor thatmostly &amp;re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>\r\n\r\n<!organis <br />BeijingcatalC deutscheuropeueuskaragaeilgesvenskaespaC1amensajeusuariotrabajomC)xicopC!ginasiempresistemaoctubreduranteaC1adirempresamomentonuestroprimeratravC)sgraciasnuestraprocesoestadoscalidadpersonanC:meroacuerdomC:sicamiembroofertasalgunospaC-sesejemploderechoademC!sprivadoagregarenlacesposiblehotelessevillaprimeroC:ltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseC1oturismocC3digoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastC-tuloconocersegundoconsejofranciaminutossegundatenemosefectosmC!lagasesiC3nrevistagranadacompraringresogarcC-aacciC3necuadorquienesinclusodeberC!materiahombresmuestrapodrC-amaC1anaC:ltimaestamosoficialtambienningC:nsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern title="LocationcontractvisitorsDownloadwithout right">\nmeasureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2>\n keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" (&quot;graduate</head>\ncommercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>\n\t\t<select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--&gt;\n\ncoveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a>\r\nelectricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: \'http:\'script\'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending&hellip;new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks">\n\t<title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"EspaC1olreleasessubmit" er&quot;additionsymptomsorientedresourceright"><pleasurestationshistory.leaving border=contentscenter">.\n\nSome directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa &quot;allowingDocumentrevision. \n\nThe yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary\n\nAfter guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>\n\taffectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions"campbell<!-- end</span><<br />\r\n_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=" Companyexamples<iframe believespresentsmarshallpart of properly).\n\nThe taxonomymuch of </span>\n" data-srtuguC*sscrollTo project<head>\r\nattorneyemphasissponsorsfancyboxworld\'s wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix\n<head>\narticle <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript">\n&nbsp;</<tr><td height:2/productcountry include footer" &lt;!-- title"></jquery.</form>\n(g.\0d=\x13)(g9\x01i+\x14)hrvatskiitalianoromC"nD\x03tC<rkC\'eX\'X1X/Y\btambiC)nnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuC)sdeportesproyectoproductopC:bliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniC3nimprimirmientrasamC)ricavendedorsociedadrespectorealizarregistropalabrasinterC)sentoncesespecialmiembrosrealidadcC3rdobazaragozapC!ginassocialesbloqueargestiC3nalquilersistemascienciascompletoversiC3ncompletaestudiospC:blicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayorC-aalemaniafunciC3nC:ltimoshaciendoaquellosediciC3nfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojC3venesdistritotC)cnicaconjuntoenergC-atrabajarasturiasrecienteutilizarboletC-nsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallaprC3ximoalmerC-aanimalesquiC)nescorazC3nsecciC3nbuscandoopcionesexteriorconceptotodavC-agalerC-aescribirmedicinalicenciaconsultaaspectoscrC-ticadC3laresjusticiadeberC!nperC-odonecesitamantenerpequeC1orecibidatribunaltenerifecanciC3ncanariasdescargadiversosmallorcarequieretC)cnicodeberC-aviviendafinanzasadelantefuncionaconsejosdifC-cilciudadesantiguasavanzadatC)rminounidadessC!nchezcampaC1asoftonicrevistascontienesectoresmomentosfacultadcrC)ditodiversassupuestofactoressegundospequeC1aP3P>P4P0P5Q\x01P;P8P5Q\x01Q\x02Q\fP1Q\vP;P>P1Q\vQ\x02Q\fQ\rQ\x02P>P<P\x15Q\x01P;P8Q\x02P>P3P>P<P5P=Q\x0fP2Q\x01P5Q\x05Q\rQ\x02P>P9P4P0P6P5P1Q\vP;P8P3P>P4Q\x03P4P5P=Q\fQ\rQ\x02P>Q\x02P1Q\vP;P0Q\x01P5P1Q\x0fP>P4P8P=Q\x01P5P1P5P=P0P4P>Q\x01P0P9Q\x02Q\x04P>Q\x02P>P=P5P3P>Q\x01P2P>P8Q\x01P2P>P9P8P3Q\0Q\vQ\x02P>P6P5P2Q\x01P5P<Q\x01P2P>Q\x0eP;P8Q\bQ\fQ\rQ\x02P8Q\x05P?P>P:P0P4P=P5P9P4P>P<P0P<P8Q\0P0P;P8P1P>Q\x02P5P<Q\x03Q\x05P>Q\x02Q\x0fP4P2Q\x03Q\x05Q\x01P5Q\x02P8P;Q\x0eP4P8P4P5P;P>P<P8Q\0P5Q\x02P5P1Q\x0fQ\x01P2P>P5P2P8P4P5Q\x07P5P3P>Q\rQ\x02P8P<Q\x01Q\x07P5Q\x02Q\x02P5P<Q\vQ\x06P5P=Q\vQ\x01Q\x02P0P;P2P5P4Q\fQ\x02P5P<P5P2P>P4Q\vQ\x02P5P1P5P2Q\vQ\bP5P=P0P<P8Q\x02P8P?P0Q\x02P>P<Q\x03P?Q\0P0P2P;P8Q\x06P0P>P4P=P0P3P>P4Q\vP7P=P0Q\x0eP<P>P3Q\x03P4Q\0Q\x03P3P2Q\x01P5P9P8P4P5Q\x02P:P8P=P>P>P4P=P>P4P5P;P0P4P5P;P5Q\x01Q\0P>P:P8Q\x0eP=Q\x0fP2P5Q\x01Q\fP\x15Q\x01Q\x02Q\fQ\0P0P7P0P=P0Q\bP8X\'Y\x04Y\x04Y\x07X\'Y\x04X*Y\nX,Y\x05Y\nX9X.X\'X5X)X\'Y\x04X0Y\nX9Y\x04Y\nY\x07X,X/Y\nX/X\'Y\x04X"Y\x06X\'Y\x04X1X/X*X-Y\x03Y\x05X5Y\x01X-X)Y\x03X\'Y\x06X*X\'Y\x04Y\x04Y\nY\nY\x03Y\bY\x06X4X(Y\x03X)Y\x01Y\nY\x07X\'X(Y\x06X\'X*X-Y\bX\'X!X#Y\x03X+X1X.Y\x04X\'Y\x04X\'Y\x04X-X(X/Y\x04Y\nY\x04X/X1Y\bX3X\'X6X:X7X*Y\x03Y\bY\x06Y\x07Y\x06X\'Y\x03X3X\'X-X)Y\x06X\'X/Y\nX\'Y\x04X7X(X9Y\x04Y\nY\x03X4Y\x03X1X\'Y\nY\x05Y\x03Y\x06Y\x05Y\x06Y\x07X\'X4X1Y\x03X)X1X&Y\nX3Y\x06X4Y\nX7Y\x05X\'X0X\'X\'Y\x04Y\x01Y\x06X4X(X\'X(X*X9X(X1X1X-Y\x05X)Y\x03X\'Y\x01X)Y\nY\x02Y\bY\x04Y\x05X1Y\x03X2Y\x03Y\x04Y\x05X)X#X-Y\x05X/Y\x02Y\x04X(Y\nY\nX9Y\x06Y\nX5Y\bX1X)X7X1Y\nY\x02X4X\'X1Y\x03X,Y\bX\'Y\x04X#X.X1Y\tY\x05X9Y\x06X\'X\'X(X-X+X9X1Y\bX6X(X4Y\x03Y\x04Y\x05X3X,Y\x04X(Y\x06X\'Y\x06X.X\'Y\x04X/Y\x03X*X\'X(Y\x03Y\x04Y\nX)X(X/Y\bY\x06X#Y\nX6X\'Y\nY\bX,X/Y\x01X1Y\nY\x02Y\x03X*X(X*X#Y\x01X6Y\x04Y\x05X7X(X.X\'Y\x03X+X1X(X\'X1Y\x03X\'Y\x01X6Y\x04X\'X-Y\x04Y\tY\x06Y\x01X3Y\x07X#Y\nX\'Y\x05X1X/Y\bX/X#Y\x06Y\x07X\'X/Y\nY\x06X\'X\'Y\x04X\'Y\x06Y\x05X9X1X6X*X9Y\x04Y\x05X/X\'X.Y\x04Y\x05Y\x05Y\x03Y\x06\0\0\0\0\0\0\0\0\x01\0\x01\0\x01\0\x01\0\x02\0\x02\0\x02\0\x02\0\x04\0\x04\0\x04\0\x04\0\0\x01\x02\x03\x04\x05\x06\x07\x07\x06\x05\x04\x03\x02\x01\0\b\t\n\v\f\r\x0e\x0f\x0f\x0e\r\f\v\n\t\b\x10\x11\x12\x13\x14\x15\x16\x17\x17\x16\x15\x14\x13\x12\x11\x10\x18\x19\x1a\x1b\x1c\x1d\x1e\x1f\x1f\x1e\x1d\x1c\x1b\x1a\x19\x18\x7f\x7f\x7f\x7f\0\0\0\0\0\0\0\0\x7f\x7f\x7f\x7f\x01\0\0\0\x02\0\0\0\x02\0\0\0\x01\0\0\0\x01\0\0\0\x03\0\0\0\x7f\x7f\0\x01\0\0\0\x01\0\0\x7f\x7f\0\x01\0\0\0\b\0\b\0\b\0\b\0\0\0\x01\0\x02\0\x03\0\x04\0\x05\0\x06\0\x07resourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter" value="</select>Australia" class="situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement" title="potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form>\r\nstatementattentionBiography} else {\nsolutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter">\nexceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFranC\'aisHollywoodexpansionstandards</style>\nreductionDecember preferredCambridgeopponentsBusiness confusion>\n<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>\nmountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to</title>\nrelationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>\nsuspectedmargin: 0spiritual</head>\n\nmicrosoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>\n\tsponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered-->\r\n<!--American protectedNovember </style><furnitureInternet onblur="suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir="ltr"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;\n\nsouthwestthe rightradiationmay have unescape(spoken in" href="/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>\ncame fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8" /><![CDATA[">ContactSouthern bgcolor="series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->\n<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id="precedingTechnicalphysicistoccurs innavigatorsection">span id="sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt="in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id="right">\r\nresidenceleave thecontent">are often })();\r\nprobably Professor-button" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor\n&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved\n\nIn the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also\n<head>\n<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained"></div>\n</a></td>depend onsearch">\npieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue="">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.\n\nAfter , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover" style="states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as Serviceslocation and oftenmeasuringand it ispaperbackvalues of\r\n<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href="y:inline;Church ofthe eventvery highofficial -height: content="/cgi-bin/to createafrikaansesperantofranC\'aislatvieE!ulietuviE3D\feE!tinaD\reE!tina`9\x04`8\x17`8"f\x17%f\x1c,h*\x1eg.\0d=\x13e-\x17g9\x01i+\x14e-\x17m\x15\x1cj5-l\x164d8:d;\0d9\bh.!g.\x17f\x1c:g,\x14h.0f\x1c,h(\x0eh+\x16e\r\0f\x1c\re\n!e\x19(d:\x12h\x01\x14g=\x11f\b?e\x1c0d:\'d?1d9\x10i\x03(e\x07:g\t\bg$>f\x0e\x12h!\ff&\x1ci\x03(h\x10=f <h?\x1bd8\0f-%f\x14/d;\x18e.\x1di*\fh/\x01g \x01e\'\x14e\x11\x18d<\x1af\x150f\r.e:\x13f6\bh49h\0\x05e\n\x1ee\x05,e.$h.(h.:e\f:f71e\x1c3e8\x02f\x12-f\x14>e\x19(e\f\x17d:,e8\x02e$\'e-&g\x14\x1fh6\nf\x1d%h6\ng.!g\x10\x06e\x11\x18d?!f\x01/g=\x11serviciosartC-culoargentinabarcelonacualquierpublicadoproductospolC-ticarespuestawikipediasiguientebC:squedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciC3nnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomC-aimC!genescontactardescargarnecesarioatenciC3ntelC)fonocomisiC3ncancionescapacidadencontraranC!lisisfavoritostC)rminosprovinciaetiquetaselementosfuncionesresultadocarC!cterpropiedadprincipionecesidadmunicipalcreaciC3ndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzC!lezdocumentopelC-cularecientesgeneralestarragonaprC!cticanovedadespropuestapacientestC)cnicasobjetivoscontactos`$.`%\x07`$\x02`$2`$?`$\x0f`$9`%\b`$\x02`$\x17`$/`$>`$8`$>`$%`$\x0f`$5`$\x02`$0`$9`%\x07`$\x15`%\v`$\b`$\x15`%\x01`$\x1b`$0`$9`$>`$,`$>`$&`$\x15`$9`$>`$8`$-`%\0`$9`%\x01`$\x0f`$0`$9`%\0`$.`%\b`$\x02`$&`$?`$(`$,`$>`$$diplodocs`$8`$.`$/`$0`%\x02`$*`$(`$>`$.`$*`$$`$>`$+`$?`$0`$\x14`$8`$$`$$`$0`$9`$2`%\v`$\x17`$9`%\x01`$\x06`$,`$>`$0`$&`%\x07`$6`$9`%\x01`$\b`$\x16`%\x07`$2`$/`$&`$?`$\x15`$>`$.`$5`%\x07`$,`$$`%\0`$(`$,`%\0`$\x1a`$.`%\f`$$`$8`$>`$2`$2`%\x07`$\x16`$\x1c`%\t`$,`$.`$&`$&`$$`$%`$>`$(`$9`%\0`$6`$9`$0`$\x05`$2`$\x17`$\x15`$-`%\0`$(`$\x17`$0`$*`$>`$8`$0`$>`$$`$\x15`$?`$\x0f`$\t`$8`%\x07`$\x17`$/`%\0`$9`%\x02`$\x01`$\x06`$\x17`%\x07`$\x1f`%\0`$.`$\x16`%\v`$\x1c`$\x15`$>`$0`$\x05`$-`%\0`$\x17`$/`%\x07`$$`%\x01`$.`$5`%\v`$\x1f`$&`%\x07`$\x02`$\x05`$\x17`$0`$\x10`$8`%\x07`$.`%\x07`$2`$2`$\x17`$>`$9`$>`$2`$\n`$*`$0`$\x1a`$>`$0`$\x10`$8`$>`$&`%\x07`$0`$\x1c`$?`$8`$&`$?`$2`$,`$\x02`$&`$,`$(`$>`$9`%\x02`$\x02`$2`$>`$\x16`$\x1c`%\0`$$`$,`$\x1f`$(`$.`$?`$2`$\x07`$8`%\x07`$\x06`$(`%\x07`$(`$/`$>`$\x15`%\x01`$2`$2`%\t`$\x17`$-`$>`$\x17`$0`%\x07`$2`$\x1c`$\x17`$9`$0`$>`$.`$2`$\x17`%\x07`$*`%\x07`$\x1c`$9`$>`$%`$\x07`$8`%\0`$8`$9`%\0`$\x15`$2`$>`$ `%\0`$\x15`$9`$>`$\x01`$&`%\x02`$0`$$`$9`$$`$8`$>`$$`$/`$>`$&`$\x06`$/`$>`$*`$>`$\x15`$\x15`%\f`$(`$6`$>`$.`$&`%\x07`$\x16`$/`$9`%\0`$0`$>`$/`$\x16`%\x01`$&`$2`$\x17`%\0categoriesexperience</title>\r\nCopyright javascriptconditionseverything<p class="technologybackground<a class="management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox" techniquesprotectionapparentlyas well asunt\', \'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor="#especially content="productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=".indexOf("conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus="<form id="processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png" (document,boundariesexpressionsettlementBackgroundout of theenterprise("https:" unescape("password" democratic<a href="/wrapper">\nmembershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick="considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic" height="link rel=".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class="0px;marginmechanicalstatisticscelebratedGovernment\n\nDuring tdevelopersartificialequivalentoriginatedCommissionattachment<span id="there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang="en" </style>\r\nabsolute; supportingextremely mainstream</strong> popularityemployment</table>\r\n colspan="</form>\n conversionabout the </p></div>integrated" lang="enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class="<a title="(includingparametersprohibited= "http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0" class="completelyillustratefive yearsinstrumentPublishing1" class="psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;\nfunction it was theConventionautomobileProtestantaggressiveafter the Similarly," /></div>collection\r\nfunctionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>\n</.indexOf(\'i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }\n</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt="adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css"\tfunction innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>\n\tdiplomaticcontainingperformingextensionsmay not beconcept of onclick="It is alsofinancial making theLuxembourgadditionalare calledengaged in"script");but it waselectroniconsubmit="\n<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences\n</head>\r\nrecognisedinitializelimited toAlexandriaretirementAdventuresfour years\n\n&lt;!-- increasingdecorationh3 class="origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews" width="1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class="Scientificclass="no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional\n<head>\n<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix">the publicmany yearswhich wereover time,synonymouscontent">\npresumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan="only a fewmeant thatled to the-->\r\n<div <fieldset>Archbishop class="nobeing usedapproachesprivilegesnoscript>\nresults inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript>\r/index.phparrival of-jssdk\'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>\n\t\tcomplaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>\npercentagebest-knowncreating a" dir="ltrLieutenant\n<div id="they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren\'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.\n\nIn the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/" class="geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid="searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured">is said tostructuralreferendummost oftena separate->\n<div id Official worldwide.aria-labelthe planetand it wasd" value="looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id="opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/" title=".com/indextaking thepittsburghcontent">\r<script>(fturned outhaving the</span>\r\n occasionalbecause itstarted tophysically></div>\n created byCurrently, bgcolor="tabindex="disastrousAnalytics also has a><div id="</style>\n<called forsinger and.src = "//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguC*sW"W\x11W(W\x19W*Y\x01X\'X1X3[\fdesarrollocomentarioeducaciC3nseptiembreregistradodirecciC3nubicaciC3npublicidadrespuestasresultadosimportantereservadosartC-culosdiferentessiguientesrepC:blicasituaciC3nministerioprivacidaddirectorioformaciC3npoblaciC3npresidentecont','enidosaccesoriostechnoratipersonalescategorC-aespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolC-ticasanterioresdocumentosnaturalezamaterialesdiferenciaeconC3micatransporterodrC-guezparticiparencuentrandiscusiC3nestructurafundaciC3nfrecuentespermanentetotalmenteP<P>P6P=P>P1Q\x03P4P5Q\x02P<P>P6P5Q\x02P2Q\0P5P<Q\x0fQ\x02P0P:P6P5Q\x07Q\x02P>P1Q\vP1P>P;P5P5P>Q\x07P5P=Q\fQ\rQ\x02P>P3P>P:P>P3P4P0P?P>Q\x01P;P5P2Q\x01P5P3P>Q\x01P0P9Q\x02P5Q\x07P5Q\0P5P7P<P>P3Q\x03Q\x02Q\x01P0P9Q\x02P0P6P8P7P=P8P<P5P6P4Q\x03P1Q\x03P4Q\x03Q\x02P\x1fP>P8Q\x01P:P7P4P5Q\x01Q\fP2P8P4P5P>Q\x01P2Q\x0fP7P8P=Q\x03P6P=P>Q\x01P2P>P5P9P;Q\x0eP4P5P9P?P>Q\0P=P>P<P=P>P3P>P4P5Q\x02P5P9Q\x01P2P>P8Q\x05P?Q\0P0P2P0Q\x02P0P:P>P9P<P5Q\x01Q\x02P>P8P<P5P5Q\x02P6P8P7P=Q\fP>P4P=P>P9P;Q\x03Q\x07Q\bP5P?P5Q\0P5P4Q\x07P0Q\x01Q\x02P8Q\x07P0Q\x01Q\x02Q\fQ\0P0P1P>Q\x02P=P>P2Q\vQ\x05P?Q\0P0P2P>Q\x01P>P1P>P9P?P>Q\x02P>P<P<P5P=P5P5Q\x07P8Q\x01P;P5P=P>P2Q\vP5Q\x03Q\x01P;Q\x03P3P>P:P>P;P>P=P0P7P0P4Q\x02P0P:P>P5Q\x02P>P3P4P0P?P>Q\x07Q\x02P8P\x1fP>Q\x01P;P5Q\x02P0P:P8P5P=P>P2Q\vP9Q\x01Q\x02P>P8Q\x02Q\x02P0P:P8Q\x05Q\x01Q\0P0P7Q\x03P!P0P=P:Q\x02Q\x04P>Q\0Q\x03P<P\x1aP>P3P4P0P:P=P8P3P8Q\x01P;P>P2P0P=P0Q\bP5P9P=P0P9Q\x02P8Q\x01P2P>P8P<Q\x01P2Q\x0fP7Q\fP;Q\x0eP1P>P9Q\x07P0Q\x01Q\x02P>Q\x01Q\0P5P4P8P\x1aQ\0P>P<P5P$P>Q\0Q\x03P<Q\0Q\vP=P:P5Q\x01Q\x02P0P;P8P?P>P8Q\x01P:Q\x02Q\vQ\x01Q\x0fQ\x07P<P5Q\x01Q\x0fQ\x06Q\x06P5P=Q\x02Q\0Q\x02Q\0Q\x03P4P0Q\x01P0P<Q\vQ\x05Q\0Q\vP=P:P0P\x1dP>P2Q\vP9Q\x07P0Q\x01P>P2P<P5Q\x01Q\x02P0Q\x04P8P;Q\fP<P<P0Q\0Q\x02P0Q\x01Q\x02Q\0P0P=P<P5Q\x01Q\x02P5Q\x02P5P:Q\x01Q\x02P=P0Q\bP8Q\x05P<P8P=Q\x03Q\x02P8P<P5P=P8P8P<P5Q\x0eQ\x02P=P>P<P5Q\0P3P>Q\0P>P4Q\x01P0P<P>P<Q\rQ\x02P>P<Q\x03P:P>P=Q\x06P5Q\x01P2P>P5P<P:P0P:P>P9P\x10Q\0Q\x05P8P2Y\x05Y\x06X*X/Y\tX%X1X3X\'Y\x04X1X3X\'Y\x04X)X\'Y\x04X9X\'Y\x05Y\x03X*X(Y\x07X\'X(X1X\'Y\x05X,X\'Y\x04Y\nY\bY\x05X\'Y\x04X5Y\bX1X,X/Y\nX/X)X\'Y\x04X9X6Y\bX%X6X\'Y\x01X)X\'Y\x04Y\x02X3Y\x05X\'Y\x04X9X\'X(X*X-Y\x05Y\nY\x04Y\x05Y\x04Y\x01X\'X*Y\x05Y\x04X*Y\x02Y\tX*X9X/Y\nY\x04X\'Y\x04X4X9X1X#X.X(X\'X1X*X7Y\bY\nX1X9Y\x04Y\nY\x03Y\x05X%X1Y\x01X\'Y\x02X7Y\x04X(X\'X*X\'Y\x04Y\x04X:X)X*X1X*Y\nX(X\'Y\x04Y\x06X\'X3X\'Y\x04X4Y\nX.Y\x05Y\x06X*X/Y\nX\'Y\x04X9X1X(X\'Y\x04Y\x02X5X5X\'Y\x01Y\x04X\'Y\x05X9Y\x04Y\nY\x07X\'X*X-X/Y\nX+X\'Y\x04Y\x04Y\x07Y\x05X\'Y\x04X9Y\x05Y\x04Y\x05Y\x03X*X(X)Y\nY\x05Y\x03Y\x06Y\x03X\'Y\x04X7Y\x01Y\x04Y\x01Y\nX/Y\nY\bX%X/X\'X1X)X*X\'X1Y\nX.X\'Y\x04X5X-X)X*X3X,Y\nY\x04X\'Y\x04Y\bY\x02X*X9Y\x06X/Y\x05X\'Y\x05X/Y\nY\x06X)X*X5Y\x05Y\nY\x05X#X1X4Y\nY\x01X\'Y\x04X0Y\nY\x06X9X1X(Y\nX)X(Y\bX\'X(X)X#Y\x04X9X\'X(X\'Y\x04X3Y\x01X1Y\x05X4X\'Y\x03Y\x04X*X9X\'Y\x04Y\tX\'Y\x04X#Y\bY\x04X\'Y\x04X3Y\x06X)X,X\'Y\x05X9X)X\'Y\x04X5X-Y\x01X\'Y\x04X/Y\nY\x06Y\x03Y\x04Y\x05X\'X*X\'Y\x04X.X\'X5X\'Y\x04Y\x05Y\x04Y\x01X#X9X6X\'X!Y\x03X*X\'X(X)X\'Y\x04X.Y\nX1X1X3X\'X&Y\x04X\'Y\x04Y\x02Y\x04X(X\'Y\x04X#X/X(Y\x05Y\x02X\'X7X9Y\x05X1X\'X3Y\x04Y\x05Y\x06X7Y\x02X)X\'Y\x04Y\x03X*X(X\'Y\x04X1X,Y\x04X\'X4X*X1Y\x03X\'Y\x04Y\x02X/Y\x05Y\nX9X7Y\nY\x03sByTagName(.jpg" alt="1px solid #.gif" alt="transparentinformationapplication" onclick="establishedadvertising.png" alt="environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright">0" height="even thoughreplacementdestinationCorporation<ul class="AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class="hundreds of\n\nHowever, compositionclear:both;cooperationwithin the label for="border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength="switzerlandDevelopmentessentially\n\nAlthough </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics\n\t<div id="illustratedengineeringterritoriesauthoritiesdistributed6" height="sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class="more recentit has beeninvasion of).getTime()fundamentalDespite the"><div id="inspirationexaminationpreparationexplanation<input id="</a></span>versions ofinstrumentsbefore the = \'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content">\n<td class="undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src="/<h1 class="publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=";width:100%independent<h3 class=" onchange=").addClass(interactionOne of the daughter ofaccessoriesbranches of\r\n<div id="the largestdeclarationregulationsInformationtranslationdocumentaryin order to">\n<head>\n<" height="1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class="distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>\n</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>\n selected="high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex="it could be<noscript>\nhaving been\r\n<head>\r\n< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval"></span></in New Yorkadditional compression\n\n<div id="incorporate;</script><attachEventbecame the " target="_carried outSome of thescience andthe time ofContainer">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>\r\nContinentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel="This is the <a href="/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og="><a class="class="textConversion may be usedmanufactureafter beingclearfix">\nquestion ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment\r\n</head>\r\nConversely,>\n<div id="0" width="1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious">this is notthe presentif they areand finallya matter of\r\n\t</div>\r\n\r\n</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>\n<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger\n\t</script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>\n they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world\'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the></div>\r\n\t\treflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=""><a href="themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href="/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in\t\t<div id="it" value="language ofas they areproduced inis that theexplain thediv></div>\nHowever thelead to the\t<a href="/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenD\rinacomentariosuniversidadcondicionesactividadesexperienciatecnologC-aproducciC3npuntuaciC3naplicaciC3ncontraseC1acategorC-asregistrarseprofesionaltratamientoregC-stratesecretarC-aprincipalesprotecciC3nimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociaciC3ndisponiblesevaluaciC3nestudiantesresponsableresoluciC3nguadalajararegistradosoportunidadcomercialesfotografC-aautoridadesingenierC-atelevisiC3ncompetenciaoperacionesestablecidosimplementeactualmentenavegaciC3nconformidadline-height:font-family:" : "http://applicationslink" href="specifically//<![CDATA[\nOrganizationdistribution0px; height:relationshipdevice-width<div class="<label for="registration</noscript>\n/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name="intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class="organisationcivilization19th centuryarchitectureincorporated20th century-container">most notably/></a></div>notification\'undefined\')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang="&lt;/sup&gt;dealing withphiladelphiahistorically);</script>\npadding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd">\r\n<htgeographicalConstitution\', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style="Encyclopediaiframe src="demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time"><a class="In addition,description+conversationcontact withis generallyr" content="representing&lt;math&gt;presentationoccasionally<img width="navigation">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}\n</script>\nChristianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""><a href="/introductionbelonging toclaimed thatconsequences<meta name="Guide to theoverwhelmingagainst the concentrated,\n.nontouch observations</a>\n</div>\nf (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting>&nbsp;</td>container">\nsuch as the influence ofa particularsrc=\'http://navigation" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet\t<ul class="installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures\n\t\t<a href="close to theexamples of is about the(see below)." id="searchprofessionalis availablethe official\t\t</script>\n\n\t\t<div id="accelerationthrough the Hall of Famedescriptionstranslationsinterference type=\'text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the\t<li class="instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class="aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc="http://px; height: available tomanufacturerhuman rightslink href="/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>\r\nconsider thean estimatedthe National<div id="pagresulting incommissionedanalogous toare required/ul>\n</div>\nwas based onand became a&nbsp;&nbsp;t" value="" was capturedno more thanrespectivelycontinue to >\r\n<head>\r\n<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml" title="weight:bold;creating thedisplay:nonereplaced the<img src="/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css" media="People from available onproved to besuggestions"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class="evidence forexplanationsenvironments"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign="top"principle ofat the time,</noscript>\rsaid to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style="input name="the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class="lastworking with\'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the\n</script>\n\nan effort toincrease theto the southspacing="0">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>\nthought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds" content="authority ofnorthwestern</div>\n<div "></div>\r\n consultationcommunity ofthe nationalit should beparticipants align="leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class="splace in thewhere he was<li class="fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class="effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\\s+|\\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers\t<link rel="provided thethe story ofcompetitionsenglish (UK)english (US)P\x1cP>P=P3P>P;P!Q\0P?Q\x01P:P8Q\x01Q\0P?Q\x01P:P8Q\x01Q\0P?Q\x01P:P>Y\x04X9X1X(Y\nX)f-#i+\x14d8-f\x16\x07g.\0d=\x13d8-f\x16\x07g9\x01d=\x13d8-f\x16\x07f\x1c\ti\x19\x10e\x05,e\x0f8d::f0\x11f\x14?e:\x1ci\x18?i\x07\fe74e74g$>d<\x1ad8;d9\tf\x13\rd=\x1cg3;g;\x1ff\x14?g-\x16f3\x15h\'\x04informaciC3nherramientaselectrC3nicodescripciC3nclasificadosconocimientopublicaciC3nrelacionadasinformC!ticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontC!ctenoshabitacionescumplimientorestaurantesdisposiciC3nconsecuenciaelectrC3nicaaplicacionesdesconectadoinstalaciC3nrealizaciC3nutilizaciC3nenciclopediaenfermedadesinstrumentosexperienciasinstituciC3nparticularessubcategoriaQ\x02P>P;Q\fP:P>P P>Q\x01Q\x01P8P8Q\0P0P1P>Q\x02Q\vP1P>P;Q\fQ\bP5P?Q\0P>Q\x01Q\x02P>P<P>P6P5Q\x02P5P4Q\0Q\x03P3P8Q\x05Q\x01P;Q\x03Q\x07P0P5Q\x01P5P9Q\x07P0Q\x01P2Q\x01P5P3P4P0P P>Q\x01Q\x01P8Q\x0fP\x1cP>Q\x01P:P2P5P4Q\0Q\x03P3P8P5P3P>Q\0P>P4P0P2P>P?Q\0P>Q\x01P4P0P=P=Q\vQ\x05P4P>P;P6P=Q\vP8P<P5P=P=P>P\x1cP>Q\x01P:P2Q\vQ\0Q\x03P1P;P5P9P\x1cP>Q\x01P:P2P0Q\x01Q\x02Q\0P0P=Q\vP=P8Q\x07P5P3P>Q\0P0P1P>Q\x02P5P4P>P;P6P5P=Q\x03Q\x01P;Q\x03P3P8Q\x02P5P?P5Q\0Q\fP\x1eP4P=P0P:P>P?P>Q\x02P>P<Q\x03Q\0P0P1P>Q\x02Q\x03P0P?Q\0P5P;Q\x0fP2P>P>P1Q\tP5P>P4P=P>P3P>Q\x01P2P>P5P3P>Q\x01Q\x02P0Q\x02Q\fP8P4Q\0Q\x03P3P>P9Q\x04P>Q\0Q\x03P<P5Q\x05P>Q\0P>Q\bP>P?Q\0P>Q\x02P8P2Q\x01Q\x01Q\vP;P:P0P:P0P6P4Q\vP9P2P;P0Q\x01Q\x02P8P3Q\0Q\x03P?P?Q\vP2P<P5Q\x01Q\x02P5Q\0P0P1P>Q\x02P0Q\x01P:P0P7P0P;P?P5Q\0P2Q\vP9P4P5P;P0Q\x02Q\fP4P5P=Q\fP3P8P?P5Q\0P8P>P4P1P8P7P=P5Q\x01P>Q\x01P=P>P2P5P<P>P<P5P=Q\x02P:Q\x03P?P8Q\x02Q\fP4P>P;P6P=P0Q\0P0P<P:P0Q\x05P=P0Q\x07P0P;P>P P0P1P>Q\x02P0P"P>P;Q\fP:P>Q\x01P>P2Q\x01P5P<P2Q\x02P>Q\0P>P9P=P0Q\x07P0P;P0Q\x01P?P8Q\x01P>P:Q\x01P;Q\x03P6P1Q\vQ\x01P8Q\x01Q\x02P5P<P?P5Q\x07P0Q\x02P8P=P>P2P>P3P>P?P>P<P>Q\tP8Q\x01P0P9Q\x02P>P2P?P>Q\x07P5P<Q\x03P?P>P<P>Q\tQ\fP4P>P;P6P=P>Q\x01Q\x01Q\vP;P:P8P1Q\vQ\x01Q\x02Q\0P>P4P0P=P=Q\vP5P<P=P>P3P8P5P?Q\0P>P5P:Q\x02P!P5P9Q\x07P0Q\x01P<P>P4P5P;P8Q\x02P0P:P>P3P>P>P=P;P0P9P=P3P>Q\0P>P4P5P2P5Q\0Q\x01P8Q\x0fQ\x01Q\x02Q\0P0P=P5Q\x04P8P;Q\fP<Q\vQ\x03Q\0P>P2P=Q\x0fQ\0P0P7P=Q\vQ\x05P8Q\x01P:P0Q\x02Q\fP=P5P4P5P;Q\x0eQ\x0fP=P2P0Q\0Q\x0fP<P5P=Q\fQ\bP5P<P=P>P3P8Q\x05P4P0P=P=P>P9P7P=P0Q\x07P8Q\x02P=P5P;Q\fP7Q\x0fQ\x04P>Q\0Q\x03P<P0P"P5P?P5Q\0Q\fP<P5Q\x01Q\x0fQ\x06P0P7P0Q\tP8Q\x02Q\vP\x1bQ\x03Q\x07Q\bP8P5`$(`$9`%\0`$\x02`$\x15`$0`$(`%\x07`$\x05`$*`$(`%\x07`$\x15`$?`$/`$>`$\x15`$0`%\x07`$\x02`$\x05`$(`%\r`$/`$\x15`%\r`$/`$>`$\x17`$>`$\x07`$!`$,`$>`$0`%\x07`$\x15`$?`$8`%\0`$&`$?`$/`$>`$*`$9`$2`%\x07`$8`$?`$\x02`$9`$-`$>`$0`$$`$\x05`$*`$(`%\0`$5`$>`$2`%\x07`$8`%\x07`$5`$>`$\x15`$0`$$`%\x07`$.`%\x07`$0`%\x07`$9`%\v`$(`%\x07`$8`$\x15`$$`%\x07`$,`$9`%\x01`$$`$8`$>`$\x07`$\x1f`$9`%\v`$\x17`$>`$\x1c`$>`$(`%\x07`$.`$?`$(`$\x1f`$\x15`$0`$$`$>`$\x15`$0`$(`$>`$\t`$(`$\x15`%\x07`$/`$9`$>`$\x01`$8`$,`$8`%\x07`$-`$>`$7`$>`$\x06`$*`$\x15`%\x07`$2`$?`$/`%\x07`$6`%\x01`$0`%\x02`$\x07`$8`$\x15`%\x07`$\x18`$\x02`$\x1f`%\x07`$.`%\x07`$0`%\0`$8`$\x15`$$`$>`$.`%\x07`$0`$>`$2`%\x07`$\x15`$0`$\x05`$\'`$?`$\x15`$\x05`$*`$(`$>`$8`$.`$>`$\x1c`$.`%\x01`$\x1d`%\x07`$\x15`$>`$0`$#`$9`%\v`$$`$>`$\x15`$!`$<`%\0`$/`$9`$>`$\x02`$9`%\v`$\x1f`$2`$6`$,`%\r`$&`$2`$?`$/`$>`$\x1c`%\0`$5`$(`$\x1c`$>`$$`$>`$\x15`%\b`$8`%\x07`$\x06`$*`$\x15`$>`$5`$>`$2`%\0`$&`%\x07`$(`%\x07`$*`%\x02`$0`%\0`$*`$>`$(`%\0`$\t`$8`$\x15`%\x07`$9`%\v`$\x17`%\0`$,`%\b`$ `$\x15`$\x06`$*`$\x15`%\0`$5`$0`%\r`$7`$\x17`$>`$\x02`$5`$\x06`$*`$\x15`%\v`$\x1c`$?`$2`$>`$\x1c`$>`$(`$>`$8`$9`$.`$$`$9`$.`%\x07`$\x02`$\t`$(`$\x15`%\0`$/`$>`$9`%\x02`$&`$0`%\r`$\x1c`$8`%\x02`$\x1a`%\0`$*`$8`$\x02`$&`$8`$5`$>`$2`$9`%\v`$(`$>`$9`%\v`$$`%\0`$\x1c`%\b`$8`%\x07`$5`$>`$*`$8`$\x1c`$(`$$`$>`$(`%\x07`$$`$>`$\x1c`$>`$0`%\0`$\x18`$>`$/`$2`$\x1c`$?`$2`%\x07`$(`%\0`$\x1a`%\x07`$\x1c`$>`$\x02`$\x1a`$*`$$`%\r`$0`$\x17`%\x02`$\x17`$2`$\x1c`$>`$$`%\x07`$,`$>`$9`$0`$\x06`$*`$(`%\x07`$5`$>`$9`$(`$\x07`$8`$\x15`$>`$8`%\x01`$,`$9`$0`$9`$(`%\x07`$\x07`$8`$8`%\x07`$8`$9`$?`$$`$,`$!`$<`%\x07`$\x18`$\x1f`$(`$>`$$`$2`$>`$6`$*`$>`$\x02`$\x1a`$6`%\r`$0`%\0`$,`$!`$<`%\0`$9`%\v`$$`%\x07`$8`$>`$\b`$\x1f`$6`$>`$/`$&`$8`$\x15`$$`%\0`$\x1c`$>`$$`%\0`$5`$>`$2`$>`$9`$\x1c`$>`$0`$*`$\x1f`$(`$>`$0`$\x16`$(`%\x07`$8`$!`$<`$\x15`$.`$?`$2`$>`$\t`$8`$\x15`%\0`$\x15`%\x07`$5`$2`$2`$\x17`$$`$>`$\x16`$>`$(`$>`$\x05`$0`%\r`$%`$\x1c`$9`$>`$\x02`$&`%\x07`$\x16`$>`$*`$9`$2`%\0`$(`$?`$/`$.`$,`$?`$(`$>`$,`%\b`$\x02`$\x15`$\x15`$9`%\0`$\x02`$\x15`$9`$(`$>`$&`%\x07`$$`$>`$9`$.`$2`%\x07`$\x15`$>`$+`%\0`$\x1c`$,`$\x15`$?`$$`%\x01`$0`$$`$.`$>`$\x02`$\x17`$5`$9`%\0`$\x02`$0`%\v`$\x1c`$<`$.`$?`$2`%\0`$\x06`$0`%\v`$*`$8`%\x07`$(`$>`$/`$>`$&`$5`$2`%\x07`$(`%\x07`$\x16`$>`$$`$>`$\x15`$0`%\0`$,`$\t`$(`$\x15`$>`$\x1c`$5`$>`$,`$*`%\x02`$0`$>`$,`$!`$<`$>`$8`%\f`$&`$>`$6`%\x07`$/`$0`$\x15`$?`$/`%\x07`$\x15`$9`$>`$\x02`$\x05`$\x15`$8`$0`$,`$(`$>`$\x0f`$5`$9`$>`$\x02`$8`%\r`$%`$2`$.`$?`$2`%\x07`$2`%\x07`$\x16`$\x15`$5`$?`$7`$/`$\x15`%\r`$0`$\x02`$8`$.`%\x02`$9`$%`$>`$(`$>X*X3X*X7Y\nX9Y\x05X4X\'X1Y\x03X)X(Y\bX\'X3X7X)X\'Y\x04X5Y\x01X-X)Y\x05Y\bX\'X6Y\nX9X\'Y\x04X.X\'X5X)X\'Y\x04Y\x05X2Y\nX/X\'Y\x04X9X\'Y\x05X)X\'Y\x04Y\x03X\'X*X(X\'Y\x04X1X/Y\bX/X(X1Y\x06X\'Y\x05X,X\'Y\x04X/Y\bY\x04X)X\'Y\x04X9X\'Y\x04Y\x05X\'Y\x04Y\x05Y\bY\x02X9X\'Y\x04X9X1X(Y\nX\'Y\x04X3X1Y\nX9X\'Y\x04X,Y\bX\'Y\x04X\'Y\x04X0Y\x07X\'X(X\'Y\x04X-Y\nX\'X)X\'Y\x04X-Y\x02Y\bY\x02X\'Y\x04Y\x03X1Y\nY\x05X\'Y\x04X9X1X\'Y\x02Y\x05X-Y\x01Y\bX8X)X\'Y\x04X+X\'Y\x06Y\nY\x05X4X\'Y\x07X/X)X\'Y\x04Y\x05X1X#X)X\'Y\x04Y\x02X1X"Y\x06X\'Y\x04X4X(X\'X(X\'Y\x04X-Y\bX\'X1X\'Y\x04X,X/Y\nX/X\'Y\x04X#X3X1X)X\'Y\x04X9Y\x04Y\bY\x05Y\x05X,Y\x05Y\bX9X)X\'Y\x04X1X-Y\x05Y\x06X\'Y\x04Y\x06Y\x02X\'X7Y\x01Y\x04X3X7Y\nY\x06X\'Y\x04Y\x03Y\bY\nX*X\'Y\x04X/Y\x06Y\nX\'X(X1Y\x03X\'X*Y\x07X\'Y\x04X1Y\nX\'X6X*X-Y\nX\'X*Y\nX(X*Y\bY\x02Y\nX*X\'Y\x04X#Y\bY\x04Y\tX\'Y\x04X(X1Y\nX/X\'Y\x04Y\x03Y\x04X\'Y\x05X\'Y\x04X1X\'X(X7X\'Y\x04X4X.X5Y\nX3Y\nX\'X1X\'X*X\'Y\x04X+X\'Y\x04X+X\'Y\x04X5Y\x04X\'X)X\'Y\x04X-X/Y\nX+X\'Y\x04X2Y\bX\'X1X\'Y\x04X.Y\x04Y\nX,X\'Y\x04X,Y\x05Y\nX9X\'Y\x04X9X\'Y\x05Y\x07X\'Y\x04X,Y\x05X\'Y\x04X\'Y\x04X3X\'X9X)Y\x05X4X\'Y\x07X/Y\x07X\'Y\x04X1X&Y\nX3X\'Y\x04X/X.Y\bY\x04X\'Y\x04Y\x01Y\x06Y\nX)X\'Y\x04Y\x03X*X\'X(X\'Y\x04X/Y\bX1Y\nX\'Y\x04X/X1Y\bX3X\'X3X*X:X1Y\x02X*X5X\'Y\x05Y\nY\x05X\'Y\x04X(Y\x06X\'X*X\'Y\x04X9X8Y\nY\x05entertainmentunderstanding = function().jpg" width="configuration.png" width="<body class="Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=""><img src="/distinguishedthousands of communicationclear"></div>investigationfavicon.ico" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch" type="form method="as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of" maxlength="return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type="the number ofthe original comprehensiverefers to the</ul>\n</div>\nphilosophicallocation.hrefwas publishedSan Francisco(function(){\n<div id="mainsophisticatedmathematical /head>\r\n<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder="; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript" src="/(function() {are available\n\t<link rel=" src=\'http://interested inconventional " alt="" /></are generallyhas also beenmost popular correspondingcredited withtyle="border:</a></span></.gif" width="<iframe src="table class="inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name="or" content="controversialproperty="og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style="known as the shortly afterfor instance,described as /head>\n<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant" border="0">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name="searchattributed tocourse of themathematicianby the end ofat the end of" border="0" technological.removeClass(branch of theevidence that![endif]-->\r\nInstitute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href="confused with<link href="/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>\n</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription" determine theavailable forAccording to wide range of\t<div class="more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover="because they async = true;problems withseems to havethe result of src="http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld\'s firstclassified asbottom of the(particularlyalign="left" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout="New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to\t<meta name="are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to\t\t<ul class="visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style="equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these\n<div class="input class="replaced withis one of theeducation andinfluenced byreputation as\n<meta name="accommodation</div>\n</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the\n<div style="almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in" value="" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class="mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass="headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;\n</script>\n<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle="marginincluding thebahasa Melayunorsk bokmC%lnorsk nynorskslovenE!D\rinainternacionalcalificaciC3ncomunicaciC3nconstrucciC3n"><div class="disambiguationDomainName\', \'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->\n</><meta name="implementationinfrastructurerepresentationborder-bottom:</head>\n<body>=http%3A%2F%2F<form method="method="post" /favicon.ico" });\n</script>\n.setAttribute(Administration= new Array();<![endif]-->\r\ndisplay:block;Unfortunately,">&nbsp;</div>/favicon.ico">=\'stylesheet\' identification, for example,<li><a href="/an alternativeas a result ofpt"></script>\ntype="submit" \n(function() {recommendationform action="/transformationreconstruction.style.display According to hidden" name="along with thedocument.body.approximately Communicationspost" action="meaning &quot;--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover="the governmenthref="https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->\n\ndepends on theUniversity of in contrast to placeholder="in the case ofinternational constitutionalstyle="border-: function() {Because of the-strict.dtd">\n<table class="accompanied byaccount of the<script src="/nature of the the people in in addition tos); js.id = id" width="100%"regarding the Roman Catholican independentfollowing the .gif" width="1the following discriminationarchaeologicalprime minister.js"></script>combination of marginwidth="createElement(w.attachEvent(</a></td></tr>src="https://aIn particular, align="left" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html" title="(function () {comes from theapplication of<span class="sbelieved to beement(\'script\'</a>\n</li>\n<livery different><span class="option value="(also known as\t<li><a href="><input name="separated fromreferred to as valign="top">founder of theattempting to carbon dioxide\n\n<div class="class="search-/body>\n</html>opportunity tocommunications</head>\r\n<body style="width:Tia:?ng Via;\x07tchanges in theborder-color:#0" border="0" </span></div><was discovered" type="text" );\n</script>\n\nDepartment of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>\n\n<div iwas consideredpercent of the" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href=\'http://whether or notThere are alsothere are manya small numberother parts ofimpossible to class="buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=" method="post"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign="right">many countriesfor many yearsearliest knownbecause it waspt"></script>\r valign="top" inhabitants offollowing year\r\n<div class="million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style="color:although therebest known forsubmit" name="multiplicationmore than one recognition ofCouncil of theedition of the <meta name="Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class="descendants of<span class="i align="right"</head>\n<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the\t<span class="is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class="<span class="t(Math.random()most prominentdescription ofConstantinoplewere published<div class="seappears in the1" height="1" most importantwhich includeswhich had beendestruction ofthe population\n\t<div class="possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle="clear:b\r\n</script>\r\n<was founded ininterview with_id" content="capital of the\r\n<link rel="srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class="cperformance of(function() {\rif and only ifregions of theleading to therelations withUnited Nationsstyle="height:other than theype" content="Association of\n</head>\n<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>\n<link rel=" return false;the purpose ofthe ability to;color:#fff}\n.\n<span class="the subject ofdefinitions of>\r\n<link rel="claim that thehave developed<table width="celebration ofFollowing the to distinguish<span class="btakes place inunder the namenoted that the><![endif]-->\nstyle="margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id="was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>\r\n\r\nenvironmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made" src="http://interpreted assecond half ofcrolling="no" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class="footerand especiallytype="button" </span></span>which included>\n<meta name="considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process <div class="the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class="ptext" name="q"\t\t<div class="the scientificrepresented bymathematicianselected by thethat have been><div class="cdiv id="headerin particular,converted into);\n</script>\n<philosophical srpskohrvatskitia:?ng Via;\x07tP Q\x03Q\x01Q\x01P:P8P9Q\0Q\x03Q\x01Q\x01P:P8P9investigaciC3nparticipaciC3nP:P>Q\x02P>Q\0Q\vP5P>P1P;P0Q\x01Q\x02P8P:P>Q\x02P>Q\0Q\vP9Q\x07P5P;P>P2P5P:Q\x01P8Q\x01Q\x02P5P<Q\vP\x1dP>P2P>Q\x01Q\x02P8P:P>Q\x02P>Q\0Q\vQ\x05P>P1P;P0Q\x01Q\x02Q\fP2Q\0P5P<P5P=P8P:P>Q\x02P>Q\0P0Q\x0fQ\x01P5P3P>P4P=Q\x0fQ\x01P:P0Q\x07P0Q\x02Q\fP=P>P2P>Q\x01Q\x02P8P#P:Q\0P0P8P=Q\vP2P>P?Q\0P>Q\x01Q\vP:P>Q\x02P>Q\0P>P9Q\x01P4P5P;P0Q\x02Q\fP?P>P<P>Q\tQ\fQ\x0eQ\x01Q\0P5P4Q\x01Q\x02P2P>P1Q\0P0P7P>P<Q\x01Q\x02P>Q\0P>P=Q\vQ\x03Q\x07P0Q\x01Q\x02P8P5Q\x02P5Q\x07P5P=P8P5P\x13P;P0P2P=P0Q\x0fP8Q\x01Q\x02P>Q\0P8P8Q\x01P8Q\x01Q\x02P5P<P0Q\0P5Q\bP5P=P8Q\x0fP!P:P0Q\x07P0Q\x02Q\fP?P>Q\rQ\x02P>P<Q\x03Q\x01P;P5P4Q\x03P5Q\x02Q\x01P:P0P7P0Q\x02Q\fQ\x02P>P2P0Q\0P>P2P:P>P=P5Q\x07P=P>Q\0P5Q\bP5P=P8P5P:P>Q\x02P>Q\0P>P5P>Q\0P3P0P=P>P2P:P>Q\x02P>Q\0P>P<P P5P:P;P0P<P0X\'Y\x04Y\x05Y\x06X*X/Y\tY\x05Y\x06X*X/Y\nX\'X*X\'Y\x04Y\x05Y\bX6Y\bX9X\'Y\x04X(X1X\'Y\x05X,X\'Y\x04Y\x05Y\bX\'Y\x02X9X\'Y\x04X1X3X\'X&Y\x04Y\x05X4X\'X1Y\x03X\'X*X\'Y\x04X#X9X6X\'X!X\'Y\x04X1Y\nX\'X6X)X\'Y\x04X*X5Y\x05Y\nY\x05X\'Y\x04X\'X9X6X\'X!X\'Y\x04Y\x06X*X\'X&X,X\'Y\x04X#Y\x04X9X\'X(X\'Y\x04X*X3X,Y\nY\x04X\'Y\x04X#Y\x02X3X\'Y\x05X\'Y\x04X6X:X7X\'X*X\'Y\x04Y\x01Y\nX/Y\nY\bX\'Y\x04X*X1X-Y\nX(X\'Y\x04X,X/Y\nX/X)X\'Y\x04X*X9Y\x04Y\nY\x05X\'Y\x04X#X.X(X\'X1X\'Y\x04X\'Y\x01Y\x04X\'Y\x05X\'Y\x04X#Y\x01Y\x04X\'Y\x05X\'Y\x04X*X\'X1Y\nX.X\'Y\x04X*Y\x02Y\x06Y\nX)X\'Y\x04X\'Y\x04X9X\'X(X\'Y\x04X.Y\bX\'X7X1X\'Y\x04Y\x05X,X*Y\x05X9X\'Y\x04X/Y\nY\x03Y\bX1X\'Y\x04X3Y\nX\'X-X)X9X(X/X\'Y\x04Y\x04Y\x07X\'Y\x04X*X1X(Y\nX)X\'Y\x04X1Y\bX\'X(X7X\'Y\x04X#X/X(Y\nX)X\'Y\x04X\'X.X(X\'X1X\'Y\x04Y\x05X*X-X/X)X\'Y\x04X\'X:X\'Y\x06Y\ncursor:pointer;</title>\n<meta " href="http://"><span class="members of the window.locationvertical-align:/a> | <a href="<!doctype html>media="screen" <option value="favicon.ico" />\n\t\t<div class="characteristics" method="get" /body>\n</html>\nshortcut icon" document.write(padding-bottom:representativessubmit" value="align="center" throughout the science fiction\n <div class="submit" class="one of the most valign="top"><was established);\r\n</script>\r\nreturn false;">).style.displaybecause of the document.cookie<form action="/}body{margin:0;Encyclopedia ofversion of the .createElement(name" content="</div>\n</div>\n\nadministrative </body>\n</html>history of the "><input type="portion of the as part of the &nbsp;<a href="other countries">\n<div class="</span></span><In other words,display: block;control of the introduction of/>\n<meta name="as well as the in recent years\r\n\t<div class="</div>\n\t</div>\ninspired by thethe end of the compatible withbecame known as style="margin:.js"></script>< International there have beenGerman language style="color:#Communist Partyconsistent withborder="0" cell marginheight="the majority of" align="centerrelated to the many different Orthodox Churchsimilar to the />\n<link rel="swas one of the until his death})();\n</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling="no" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign="center">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style="width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>\n\t<div class="consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method="post" was followed by&amp;mdash; thethe applicationjs"></script>\r\nul></div></div>after the deathwith respect tostyle="padding:is particularlydisplay:inline; type="submit" is divided intod8-f\x16\x07 (g.\0d=\x13)responsabilidadadministraciC3ninternacionalescorrespondiente`$\t`$*`$/`%\v`$\x17`$*`%\x02`$0`%\r`$5`$9`$.`$>`$0`%\x07`$2`%\v`$\x17`%\v`$\x02`$\x1a`%\x01`$(`$>`$5`$2`%\x07`$\x15`$?`$(`$8`$0`$\x15`$>`$0`$*`%\x01`$2`$?`$8`$\x16`%\v`$\x1c`%\x07`$\x02`$\x1a`$>`$9`$?`$\x0f`$-`%\x07`$\x1c`%\x07`$\x02`$6`$>`$.`$?`$2`$9`$.`$>`$0`%\0`$\x1c`$>`$\x17`$0`$#`$,`$(`$>`$(`%\x07`$\x15`%\x01`$.`$>`$0`$,`%\r`$2`%\t`$\x17`$.`$>`$2`$?`$\x15`$.`$9`$?`$2`$>`$*`%\x03`$7`%\r`$ `$,`$"`$<`$$`%\x07`$-`$>`$\x1c`$*`$>`$\x15`%\r`$2`$?`$\x15`$\x1f`%\r`$0`%\x07`$(`$\x16`$?`$2`$>`$+`$&`%\f`$0`$>`$(`$.`$>`$.`$2`%\x07`$.`$$`$&`$>`$(`$,`$>`$\x1c`$>`$0`$5`$?`$\x15`$>`$8`$\x15`%\r`$/`%\v`$\x02`$\x1a`$>`$9`$$`%\x07`$*`$9`%\x01`$\x01`$\x1a`$,`$$`$>`$/`$>`$8`$\x02`$5`$>`$&`$&`%\x07`$\x16`$(`%\x07`$*`$?`$\x1b`$2`%\x07`$5`$?`$6`%\x07`$7`$0`$>`$\x1c`%\r`$/`$\t`$$`%\r`$$`$0`$.`%\x01`$\x02`$,`$\b`$&`%\v`$(`%\v`$\x02`$\t`$*`$\x15`$0`$#`$*`$"`$<`%\x07`$\x02`$8`%\r`$%`$?`$$`$+`$?`$2`%\r`$.`$.`%\x01`$\x16`%\r`$/`$\x05`$\x1a`%\r`$\x1b`$>`$\x1b`%\x02`$\x1f`$$`%\0`$8`$\x02`$\x17`%\0`$$`$\x1c`$>`$\x0f`$\x17`$>`$5`$?`$-`$>`$\x17`$\x18`$#`%\r`$\x1f`%\x07`$&`%\x02`$8`$0`%\x07`$&`$?`$(`%\v`$\x02`$9`$$`%\r`$/`$>`$8`%\x07`$\x15`%\r`$8`$\x17`$>`$\x02`$\'`%\0`$5`$?`$6`%\r`$5`$0`$>`$$`%\x07`$\x02`$&`%\b`$\x1f`%\r`$8`$(`$\x15`%\r`$6`$>`$8`$>`$.`$(`%\x07`$\x05`$&`$>`$2`$$`$,`$?`$\x1c`$2`%\0`$*`%\x01`$0`%\x02`$7`$9`$?`$\x02`$&`%\0`$.`$?`$$`%\r`$0`$\x15`$5`$?`$$`$>`$0`%\x01`$*`$/`%\x07`$8`%\r`$%`$>`$(`$\x15`$0`%\v`$!`$<`$.`%\x01`$\x15`%\r`$$`$/`%\v`$\x1c`$(`$>`$\x15`%\x03`$*`$/`$>`$*`%\v`$8`%\r`$\x1f`$\x18`$0`%\x07`$2`%\x02`$\x15`$>`$0`%\r`$/`$5`$?`$\x1a`$>`$0`$8`%\x02`$\x1a`$(`$>`$.`%\x02`$2`%\r`$/`$&`%\x07`$\x16`%\x07`$\x02`$9`$.`%\x07`$6`$>`$8`%\r`$\x15`%\x02`$2`$.`%\b`$\x02`$(`%\x07`$$`%\b`$/`$>`$0`$\x1c`$?`$8`$\x15`%\x07rss+xml" title="-type" content="title" content="at the same time.js"></script>\n<" method="post" </span></a></li>vertical-align:t/jquery.min.js">.click(function( style="padding-})();\n</script>\n</span><a href="<a href="http://); return false;text-decoration: scrolling="no" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif" border="0"</body>\n</html>\noverflow:hidden;img src="http://addEventListenerresponsible for s.js"></script>\n/favicon.ico" />operating system" style="width:1target="_blank">State Universitytext-align:left;\ndocument.write(, including the around the world);\r\n</script>\r\n<" style="height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>\n\t\t</div>\ndisplay: none;">" />\n<link rel="\n (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the align="center">University Pressdominated by theSecond World Wardistribution of style="position:the rest of the characterized by rel="nofollow">derives from therather than the a combination ofstyle="width:100English-speakingcomputer scienceborder="0" alt="the existence ofDemocratic Party" style="margin-For this reason,.js"></script>\n\tsByTagName(s)[0]js"></script>\r\n<.js"></script>\r\nlink rel="icon" \' alt=\'\' class=\'formation of theversions of the </a></div></div>/page>\n <page>\n<div class="contbecame the firstbahasa Indonesiaenglish (simple)N\x15N;N;N7N=N9N:N,Q\x05Q\0P2P0Q\x02Q\x01P:P8P:P>P<P?P0P=P8P8Q\x0fP2P;Q\x0fP5Q\x02Q\x01Q\x0fP\x14P>P1P0P2P8Q\x02Q\fQ\x07P5P;P>P2P5P:P0Q\0P0P7P2P8Q\x02P8Q\x0fP\x18P=Q\x02P5Q\0P=P5Q\x02P\x1eQ\x02P2P5Q\x02P8Q\x02Q\fP=P0P?Q\0P8P<P5Q\0P8P=Q\x02P5Q\0P=P5Q\x02P:P>Q\x02P>Q\0P>P3P>Q\x01Q\x02Q\0P0P=P8Q\x06Q\vP:P0Q\x07P5Q\x01Q\x02P2P5Q\x03Q\x01P;P>P2P8Q\x0fQ\x05P?Q\0P>P1P;P5P<Q\vP?P>P;Q\x03Q\x07P8Q\x02Q\fQ\x0fP2P;Q\x0fQ\x0eQ\x02Q\x01Q\x0fP=P0P8P1P>P;P5P5P:P>P<P?P0P=P8Q\x0fP2P=P8P<P0P=P8P5Q\x01Q\0P5P4Q\x01Q\x02P2P0X\'Y\x04Y\x05Y\bX\'X6Y\nX9X\'Y\x04X1X&Y\nX3Y\nX)X\'Y\x04X\'Y\x06X*Y\x02X\'Y\x04Y\x05X4X\'X1Y\x03X\'X*Y\x03X\'Y\x04X3Y\nX\'X1X\'X*X\'Y\x04Y\x05Y\x03X*Y\bX(X)X\'Y\x04X3X9Y\bX/Y\nX)X\'X-X5X\'X&Y\nX\'X*X\'Y\x04X9X\'Y\x04Y\x05Y\nX)X\'Y\x04X5Y\bX*Y\nX\'X*X\'Y\x04X\'Y\x06X*X1Y\x06X*X\'Y\x04X*X5X\'Y\x05Y\nY\x05X\'Y\x04X%X3Y\x04X\'Y\x05Y\nX\'Y\x04Y\x05X4X\'X1Y\x03X)X\'Y\x04Y\x05X1X&Y\nX\'X*robots" content="<div id="footer">the United States<img src="http://.jpg|right|thumb|.js"></script>\r\n<location.protocolframeborder="0" s" />\n<meta name="</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:" rel="nofollow" President of the twentieth centuryevision>\n </pageInternet Explorera.async = true;\r\ninformation about<div id="header">" action="http://<a href="https://<div id="content"</div>\r\n</div>\r\n<derived from the <img src=\'http://according to the \n</body>\n</html>\nstyle="font-size:script language="Arial, Helvetica,</a><span class="</script><script political partiestd></tr></table><href="http://www.interpretation ofrel="stylesheet" document.write(\'<charset="utf-8">\nbeginning of the revealed that thetelevision series" rel="nofollow"> target="_blank">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass="clearfix">/div>\r\n</div>\r\n\r\nthree-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class="in some countriesmin.js"></script>of the populationofficial language<img src="images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>\r\n</html>\rN\x15N;N;N7N=N9N:N,\ntake advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class="headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype="text/css">\nthe InternationalAccording to the pe="text/css" />\ncoincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;" target="_blank" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type="application/anguage" content="<meta http-equiv="Privacy Policy</a>e("%3Cscript src=\'" target="_blank">On the other hand,.jpg|thumb|right|2</div><div class="<div style="float:nineteenth century</body>\r\n</html>\r\n<img src="http://s;text-align:centerfont-weight: bold; According to the difference between" frameborder="0" " style="position:link href="http://html4/loose.dtd">\nduring this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type="text" <span style="font-onreadystatechange\t<div class="cleardocument.location. For example, the a wide variety of <!DOCTYPE html>\r\n<&nbsp;&nbsp;&nbsp;"><a href="http://style="float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype="text/css" />it is possible to Harvard Universitytylesheet" href="/the main characterOxford University name="keywords" cstyle="text-align:the United Kingdomfederal government<div style="margin depending on the description of the<div class="header.min.js"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc="http://staticsuggested that the" src="http://www.a large number of Telecommunications" rel="nofollow" tHoly Roman Emperoralmost exclusively" border="0" alt="Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle="background-<li><em><a href="/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src="http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref="https://www.recent developmentBoard of Directors<div class="search| <a href="http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>\r\n</div>\r\n\r\n<a href="index.phpwas established inmin.js"></script>\nparticipate in thea strong influencestyle="margin-top:represented by thegraduated from theTraditionally, theElement("script");However, since the/div>\n</div>\n<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype="image/x-icon/div>\n<div class=" class="clearfix"><div class="footer\t\t</div>\n\t\t</div>\nthe motion pictureP\x11Q\nP;P3P0Q\0Q\x01P:P8P1Q\nP;P3P0Q\0Q\x01P:P8P$P5P4P5Q\0P0Q\x06P8P8P=P5Q\x01P:P>P;Q\fP:P>Q\x01P>P>P1Q\tP5P=P8P5Q\x01P>P>P1Q\tP5P=P8Q\x0fP?Q\0P>P3Q\0P0P<P<Q\vP\x1eQ\x02P?Q\0P0P2P8Q\x02Q\fP1P5Q\x01P?P;P0Q\x02P=P>P<P0Q\x02P5Q\0P8P0P;Q\vP?P>P7P2P>P;Q\x0fP5Q\x02P?P>Q\x01P;P5P4P=P8P5Q\0P0P7P;P8Q\x07P=Q\vQ\x05P?Q\0P>P4Q\x03P:Q\x06P8P8P?Q\0P>P3Q\0P0P<P<P0P?P>P;P=P>Q\x01Q\x02Q\fQ\x0eP=P0Q\x05P>P4P8Q\x02Q\x01Q\x0fP8P7P1Q\0P0P=P=P>P5P=P0Q\x01P5P;P5P=P8Q\x0fP8P7P<P5P=P5P=P8Q\x0fP:P0Q\x02P5P3P>Q\0P8P8P\x10P;P5P:Q\x01P0P=P4Q\0`$&`%\r`$5`$>`$0`$>`$.`%\b`$(`%\x01`$\x05`$2`$*`%\r`$0`$&`$>`$(`$-`$>`$0`$$`%\0`$/`$\x05`$(`%\x01`$&`%\x07`$6`$9`$?`$(`%\r`$&`%\0`$\x07`$\x02`$!`$?`$/`$>`$&`$?`$2`%\r`$2`%\0`$\x05`$\'`$?`$\x15`$>`$0`$5`%\0`$!`$?`$/`%\v`$\x1a`$?`$\x1f`%\r`$ `%\x07`$8`$.`$>`$\x1a`$>`$0`$\x1c`$\x02`$\x15`%\r`$6`$(`$&`%\x01`$(`$?`$/`$>`$*`%\r`$0`$/`%\v`$\x17`$\x05`$(`%\x01`$8`$>`$0`$\x11`$(`$2`$>`$\x07`$(`$*`$>`$0`%\r`$\x1f`%\0`$6`$0`%\r`$$`%\v`$\x02`$2`%\v`$\x15`$8`$-`$>`$+`$<`%\r`$2`%\b`$6`$6`$0`%\r`$$`%\x07`$\x02`$*`%\r`$0`$&`%\x07`$6`$*`%\r`$2`%\x07`$/`$0`$\x15`%\x07`$\x02`$&`%\r`$0`$8`%\r`$%`$?`$$`$?`$\t`$$`%\r`$*`$>`$&`$\t`$(`%\r`$9`%\x07`$\x02`$\x1a`$?`$\x1f`%\r`$ `$>`$/`$>`$$`%\r`$0`$>`$\x1c`%\r`$/`$>`$&`$>`$*`%\x01`$0`$>`$(`%\x07`$\x1c`%\v`$!`$<`%\x07`$\x02`$\x05`$(`%\x01`$5`$>`$&`$6`%\r`$0`%\x07`$#`%\0`$6`$?`$\x15`%\r`$7`$>`$8`$0`$\x15`$>`$0`%\0`$8`$\x02`$\x17`%\r`$0`$9`$*`$0`$?`$#`$>`$.`$,`%\r`$0`$>`$\x02`$!`$,`$\x1a`%\r`$\x1a`%\v`$\x02`$\t`$*`$2`$,`%\r`$\'`$.`$\x02`$$`%\r`$0`%\0`$8`$\x02`$*`$0`%\r`$\x15`$\t`$.`%\r`$.`%\0`$&`$.`$>`$\'`%\r`$/`$.`$8`$9`$>`$/`$$`$>`$6`$,`%\r`$&`%\v`$\x02`$.`%\0`$!`$?`$/`$>`$\x06`$\b`$*`%\0`$\x0f`$2`$.`%\v`$,`$>`$\x07`$2`$8`$\x02`$\x16`%\r`$/`$>`$\x06`$*`$0`%\x07`$6`$(`$\x05`$(`%\x01`$,`$\x02`$\'`$,`$>`$\x1c`$<`$>`$0`$(`$5`%\0`$(`$$`$.`$*`%\r`$0`$.`%\x01`$\x16`$*`%\r`$0`$6`%\r`$(`$*`$0`$?`$5`$>`$0`$(`%\x01`$\x15`$8`$>`$(`$8`$.`$0`%\r`$%`$(`$\x06`$/`%\v`$\x1c`$?`$$`$8`%\v`$.`$5`$>`$0X\'Y\x04Y\x05X4X\'X1Y\x03X\'X*X\'Y\x04Y\x05Y\x06X*X/Y\nX\'X*X\'Y\x04Y\x03Y\x05X(Y\nY\bX*X1X\'Y\x04Y\x05X4X\'Y\x07X/X\'X*X9X/X/X\'Y\x04X2Y\bX\'X1X9X/X/X\'Y\x04X1X/Y\bX/X\'Y\x04X%X3Y\x04X\'Y\x05Y\nX)X\'Y\x04Y\x01Y\bX*Y\bX4Y\bX(X\'Y\x04Y\x05X3X\'X(Y\x02X\'X*X\'Y\x04Y\x05X9Y\x04Y\bY\x05X\'X*X\'Y\x04Y\x05X3Y\x04X3Y\x04X\'X*X\'Y\x04X,X1X\'Y\x01Y\nY\x03X3X\'Y\x04X\'X3Y\x04X\'Y\x05Y\nX)X\'Y\x04X\'X*X5X\'Y\x04X\'X*keywords" content="w3.org/1999/xhtml"><a target="_blank" text/html; charset=" target="_blank"><table cellpadding="autocomplete="off" text-align: center;to last version by background-color: #" href="http://www./div></div><div id=<a href="#" class=""><img src="http://cript" src="http://\n<script language="//EN" "http://www.wencodeURIComponent(" href="javascript:<div class="contentdocument.write(\'<scposition: absolute;script src="http:// style="margin-top:.min.js"></script>\n</div>\n<div class="w3.org/1999/xhtml" \n\r\n</body>\r\n</html>distinction between/" target="_blank"><link href="http://encoding="utf-8"?>\nw.addEventListener?action="http://www.icon" href="http:// style="background:type="text/css" />\nmeta property="og:t<input type="text" style="text-align:the development of tylesheet" type="tehtml; charset=utf-8is considered to betable width="100%" In addition to the contributed to the differences betweendevelopment of the It is important to </script>\n\n<script style="font-size:1></span><span id=gbLibrary of Congress<img src="http://imEnglish translationAcademy of Sciencesdiv style="display:construction of the.getElementById(id)in conjunction withElement(\'script\'); <meta property="og:P\x11Q\nP;P3P0Q\0Q\x01P:P8\n type="text" name=">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src="http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style="background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet" href="/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland\n</script>\n<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv="X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0" cellpadding="0" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E"));<a href="http://www.<li><a href="http://site_name" content="text-decoration:nonestyle="display: none<meta http-equiv="X-new Date().getTime() type="image/x-icon"</span><span class="language="javascriptwindow.location.href<a href="javascript:-->\r\n<script type="t<a href=\'http://www.hortcut icon" href="</div>\r\n<div class="<script src="http://" rel="stylesheet" t</div>\n<script type=/a> <a href="http:// allowTransparency="X-UA-Compatible" conrelationship between\n</script>\r\n<script </a></li></ul></div>associated with the programming language</a><a href="http://</a></li><li class="form action="http://<div style="display:type="text" name="q"<table width="100%" background-position:" border="0" width="rel="shortcut icon" h6><ul><li><a href=" <meta http-equiv="css" media="screen" responsible for the " type="application/" style="background-html; charset=utf-8" allowtransparency="stylesheet" type="te\r\n<meta http-equiv="></span><span class="0" cellspacing="0">;\n</script>\n<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type="hidden" name="javascript:void(0);"effectiveness of the autocomplete="off" generally considered><input type="text" "></script>\r\n<scriptthroughout the worldcommon misconceptionassociation with the</div>\n</div>\n<div cduring his lifetime,corresponding to thetype="image/x-icon" an increasing numberdiplomatic relationsare often consideredmeta charset="utf-8" <input type="text" examples include the"><img src="http://iparticipation in thethe establishment of\n</div>\n<div class="&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset="utf-8"> type="text/css" />\ninterchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type="text/csstype="submit" name="families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguC*s (Europeu)P#P:Q\0P0Q\x17P=Q\x01Q\fP:P0Q\x03P:Q\0P0Q\x17P=Q\x01Q\fP:P0P P>Q\x01Q\x01P8P9Q\x01P:P>P9P<P0Q\x02P5Q\0P8P0P;P>P2P8P=Q\x04P>Q\0P<P0Q\x06P8P8Q\x03P?Q\0P0P2P;P5P=P8Q\x0fP=P5P>P1Q\x05P>P4P8P<P>P8P=Q\x04P>Q\0P<P0Q\x06P8Q\x0fP\x18P=Q\x04P>Q\0P<P0Q\x06P8Q\x0fP P5Q\x01P?Q\x03P1P;P8P:P8P:P>P;P8Q\x07P5Q\x01Q\x02P2P>P8P=Q\x04P>Q\0P<P0Q\x06P8Q\x0eQ\x02P5Q\0Q\0P8Q\x02P>Q\0P8P8P4P>Q\x01Q\x02P0Q\x02P>Q\x07P=P>X\'Y\x04Y\x05X*Y\bX\'X,X/Y\bY\x06X\'Y\x04X\'X4X*X1X\'Y\x03X\'X*X\'Y\x04X\'Y\x02X*X1X\'X-X\'X*html; charset=UTF-8" setTimeout(function()display:inline-block;<input type="submit" type = \'text/javascri<img src="http://www." "http://www.w3.org/shortcut icon" href="" autocomplete="off" </a></div><div class=</a></li>\n<li class="css" type="text/css" <form action="http://xt/css" href="http://link rel="alternate" \r\n<script type="text/ onclick="javascript:(new Date).getTime()}height="1" width="1" People\'s Republic of <a href="http://www.text-decoration:underthe beginning of the </div>\n</div>\n</div>\nestablishment of the </div></div></div></d#viewport{min-height:\n<script src="http://option><option value=often referred to as /option>\n<option valu<!DOCTYPE html>\n<!--[International Airport>\n<a href="http://www</a><a href="http://w`8 `82`8)`82`9\x04`8\x17`8"a\x03%a\x03\x10a\x03 a\x03\x17a\x03#a\x03\x1aa\x03\x18f-#i+\x14d8-f\x16\x07 (g9\x01i+\x14)`$(`$?`$0`%\r`$&`%\x07`$6`$!`$>`$\t`$(`$2`%\v`$!`$\x15`%\r`$7`%\x07`$$`%\r`$0`$\x1c`$>`$(`$\x15`$>`$0`%\0`$8`$\x02`$,`$\x02`$\'`$?`$$`$8`%\r`$%`$>`$*`$(`$>`$8`%\r`$5`%\0`$\x15`$>`$0`$8`$\x02`$8`%\r`$\x15`$0`$#`$8`$>`$.`$\x17`%\r`$0`%\0`$\x1a`$?`$\x1f`%\r`$ `%\v`$\x02`$5`$?`$\x1c`%\r`$\x1e`$>`$(`$\x05`$.`%\x07`$0`$?`$\x15`$>`$5`$?`$-`$?`$(`%\r`$(`$\x17`$>`$!`$?`$/`$>`$\x01`$\x15`%\r`$/`%\v`$\x02`$\x15`$?`$8`%\x01`$0`$\x15`%\r`$7`$>`$*`$9`%\x01`$\x01`$\x1a`$$`%\0`$*`%\r`$0`$,`$\x02`$\'`$(`$\x1f`$?`$*`%\r`$*`$#`%\0`$\x15`%\r`$0`$?`$\x15`%\x07`$\x1f`$*`%\r`$0`$>`$0`$\x02`$-`$*`%\r`$0`$>`$*`%\r`$$`$.`$>`$2`$?`$\x15`%\v`$\x02`$0`$+`$<`%\r`$$`$>`$0`$(`$?`$0`%\r`$.`$>`$#`$2`$?`$.`$?`$\x1f`%\x07`$!description" content="document.location.prot.getElementsByTagName(<!DOCTYPE html>\n<html <meta charset="utf-8">:url" content="http://.css" rel="stylesheet"style type="text/css">type="text/css" href="w3.org/1999/xhtml" xmltype="text/javascript" method="get" action="link rel="stylesheet" = document.getElementtype="image/x-icon" />cellpadding="0" cellsp.css" type="text/css" </a></li><li><a href="" width="1" height="1""><a href="http://www.style="display:none;">alternate" type="appli-//W3C//DTD XHTML 1.0 ellspacing="0" cellpad type="hidden" value="/a>&nbsp;<span role="s\n<input type="hidden" language="JavaScript" document.getElementsBg="0" cellspacing="0" ype="text/css" media="type=\'text/javascript\'with the exception of ype="text/css" rel="st height="1" width="1" =\'+encodeURIComponent(<link rel="alternate" \nbody, tr, input, textmeta name="robots" conmethod="post" action=">\n<a href="http://www.css" rel="stylesheet" </div></div><div classlanguage="javascript">aria-hidden="true">B7<ript" type="text/javasl=0;})();\n(function(){background-image: url(/a></li><li><a href="h\t\t<li><a href="http://ator" aria-hidden="tru> <a href="http://www.language="javascript" /option>\n<option value/div></div><div class=rator" aria-hidden="tre=(new Date).getTime()portuguC*s (do Brasil)P>Q\0P3P0P=P8P7P0Q\x06P8P8P2P>P7P<P>P6P=P>Q\x01Q\x02Q\fP>P1Q\0P0P7P>P2P0P=P8Q\x0fQ\0P5P3P8Q\x01Q\x02Q\0P0Q\x06P8P8P2P>P7P<P>P6P=P>Q\x01Q\x02P8P>P1Q\x0fP7P0Q\x02P5P;Q\fP=P0<!DOCTYPE html PUBLIC "nt-Type" content="text/<meta http-equiv="Conteransitional//EN" "http:<html xmlns="http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = \'text/javascript\';<meta name="descriptionparentNode.insertBefore<input type="hidden" najs" type="text/javascri(document).ready(functiscript type="text/javasimage" content="http://UA-Compatible" content=tml; charset=utf-8" />\nlink rel="shortcut icon<link rel="stylesheet" </script>\n<script type== document.createElemen<a target="_blank" href= document.getElementsBinput type="text" name=a.type = \'text/javascrinput type="hidden" namehtml; charset=utf-8" />dtd">\n<html xmlns="http-//W3C//DTD HTML 4.01 TentsByTagName(\'script\')input type="hidden" nam<script type="text/javas" style="display:none;">document.getElementById(=document.createElement(\' type=\'text/javascript\'input type="text" name="d.getElementsByTagName(snical" href="http://www.C//DTD HTML 4.01 Transit<style type="text/css">\n\n<style type="text/css">ional.dtd">\n<html xmlns=http-equiv="Content-Typeding="0" cellspacing="0"html; charset=utf-8" />\n style="display:none;"><<li><a href="http://www. type=\'text/javascript\'>P4P5Q\x0fQ\x02P5P;Q\fP=P>Q\x01Q\x02P8Q\x01P>P>Q\x02P2P5Q\x02Q\x01Q\x02P2P8P8P?Q\0P>P8P7P2P>P4Q\x01Q\x02P2P0P1P5P7P>P?P0Q\x01P=P>Q\x01Q\x02P8`$*`%\x01`$8`%\r`$$`$?`$\x15`$>`$\x15`$>`$\x02`$\x17`%\r`$0`%\x07`$8`$\t`$(`%\r`$9`%\v`$\x02`$(`%\x07`$5`$?`$\'`$>`$(`$8`$-`$>`$+`$?`$\x15`%\r`$8`$?`$\x02`$\x17`$8`%\x01`$0`$\x15`%\r`$7`$?`$$`$\x15`%\t`$*`%\0`$0`$>`$\x07`$\x1f`$5`$?`$\x1c`%\r`$\x1e`$>`$*`$(`$\x15`$>`$0`%\r`$0`$5`$>`$\b`$8`$\x15`%\r`$0`$?`$/`$$`$>',"\u06f7%\u018c'T%\x85'W%\xd7%O%g%\xa6&\u0193%\u01e5&>&*&'&^&\x88\u0178\u0c3e&\u01ad&\u0192&)&^&%&'&\x82&P&1&\xb1&3&]&m&u&E&t&C&\xcf&V&V&/&>&6&\u0f76\u177co&p&@&E&M&P&x&@&F&e&\xcc&7&:&(&D&0&C&)&.&F&-&1&(&L&F&1\u025e*\u03ea\u21f3&\u1372&K&;&)&E&H&P&0&?&9&V&\x81&-&v&a&,&E&)&?&=&'&'&B&\u0d2e&\u0503&\u0316*&*8&%&%&&&%,)&\x9a&>&\x86&7&]&F&2&>&J&6&n&2&%&?&\x8e&2&6&J&g&-&0&,&*&J&*&O&)&6&(&<&B&N&.&P&@&2&.&W&M&%\u053c\x84(,(<&,&\u03da&\u18c7&-&,(%&(&%&(\u013b0&X&D&\x81&j&'&J&(&.&B&3&Z&R&h&3&E&E&<\xc6-\u0360\u1ef3&%8?&@&,&Z&@&0&J&,&^&x&_&6&C&6&C\u072c\u2a25&f&-&-&-&-&,&J&2&8&z&8&C&Y&8&-&d&\u1e78\xcc-&7&1&F&7&t&W&7&I&.&.&^&=\u0f9c\u19d3&8(>&/&/&\u077b')'\u1065')'%@/&0&%\u043e\u09c0*&*@&C\u053d\u05d4\u0274\u05eb4\u0dd7\u071a\u04d16\u0d84&/\u0178\u0303Z&*%\u0246\u03ff&\u0134&1\xa8\u04b4\u0174"),
+ae(Xe),se=Xe,re}var BrotliDecode=BrotliDecodeClosure();window.ra=BrotliDecode; \ No newline at end of file
diff --git a/python/_brotli.cc b/python/_brotli.cc
index a6f925e..d4075bd 100644
--- a/python/_brotli.cc
+++ b/python/_brotli.cc
@@ -414,7 +414,7 @@ static BROTLI_BOOL decompress_stream(BrotliDecoderState* dec,
(*output).insert((*output).end(), buffer, buffer + buffer_length);
}
}
- ok = result != BROTLI_DECODER_RESULT_ERROR;
+ ok = result != BROTLI_DECODER_RESULT_ERROR && !available_in;
Py_END_ALLOW_THREADS
return ok;
@@ -672,7 +672,7 @@ static PyObject* brotli_decompress(PyObject *self, PyObject *args, PyObject *key
if (available_out != 0)
output.insert(output.end(), next_out, next_out + available_out);
}
- ok = result == BROTLI_DECODER_RESULT_SUCCESS;
+ ok = result == BROTLI_DECODER_RESULT_SUCCESS && !available_in;
BrotliDecoderDestroyInstance(state);
Py_END_ALLOW_THREADS
@@ -703,13 +703,14 @@ PyDoc_STRVAR(brotli_doc, "Implementation module for the Brotli library.");
static struct PyModuleDef brotli_module = {
PyModuleDef_HEAD_INIT,
- "_brotli",
- brotli_doc,
- 0,
- brotli_methods,
- NULL,
- NULL,
- NULL
+ "_brotli", /* m_name */
+ brotli_doc, /* m_doc */
+ 0, /* m_size */
+ brotli_methods, /* m_methods */
+ NULL, /* m_reload */
+ NULL, /* m_traverse */
+ NULL, /* m_clear */
+ NULL /* m_free */
};
#else
#define INIT_BROTLI init_brotli
diff --git a/python/bro.py b/python/bro.py
index 7a094b4..7a094b4 100755..100644
--- a/python/bro.py
+++ b/python/bro.py
diff --git a/python/tests/decompress_test.py b/python/tests/decompress_test.py
index 7a9e9e3..814e563 100644
--- a/python/tests/decompress_test.py
+++ b/python/tests/decompress_test.py
@@ -31,6 +31,10 @@ class TestDecompress(_test_utils.TestCase):
self._decompress(test_data)
self._check_decompression(test_data)
+ def test_garbage_appended(self):
+ with self.assertRaises(brotli.error):
+ brotli.decompress(brotli.compress(b'a') + b'a')
+
_test_utils.generate_test_methods(TestDecompress, for_decompression=True)
diff --git a/python/tests/decompressor_test.py b/python/tests/decompressor_test.py
index 99667bc..05918ad 100644
--- a/python/tests/decompressor_test.py
+++ b/python/tests/decompressor_test.py
@@ -43,6 +43,15 @@ class TestDecompressor(_test_utils.TestCase):
self._decompress(test_data)
self._check_decompression(test_data)
+ def test_garbage_appended(self):
+ with self.assertRaises(brotli.error):
+ self.decompressor.process(brotli.compress(b'a') + b'a')
+
+ def test_already_finished(self):
+ self.decompressor.process(brotli.compress(b'a'))
+ with self.assertRaises(brotli.error):
+ self.decompressor.process(b'a')
+
_test_utils.generate_test_methods(TestDecompressor, for_decompression=True)
diff --git a/research/BUILD b/research/BUILD
index 7b7d81b..7b7d81b 100755..100644
--- a/research/BUILD
+++ b/research/BUILD
diff --git a/research/brotli_decoder.c b/research/brotli_decoder.c
index b1d556d..4b0bc4a 100644
--- a/research/brotli_decoder.c
+++ b/research/brotli_decoder.c
@@ -38,6 +38,7 @@ void cleanup(Context* ctx) {
void fail(Context* ctx, const char* message) {
fprintf(stderr, "%s\n", message);
+ cleanup(ctx);
exit(1);
}
diff --git a/research/dictionary_generator.cc b/research/dictionary_generator.cc
index 00cfaba..dcdf2fa 100755..100644
--- a/research/dictionary_generator.cc
+++ b/research/dictionary_generator.cc
@@ -1,3 +1,4 @@
+#include <climits>
#include <cstddef>
#include <cstdio>
#include <cstring>
@@ -8,6 +9,16 @@
#include "./durchschlag.h"
#include "./sieve.h"
+/* This isn't a definitive list of "--foo" arguments, only those that take an
+ * additional "=#" integer parameter, like "--foo=20" or "--foo=32K".
+ */
+#define LONG_ARG_BLOCK_LEN "--block_len="
+#define LONG_ARG_SLICE_LEN "--slice_len="
+#define LONG_ARG_TARGET_DICT_LEN "--target_dict_len="
+#define LONG_ARG_MIN_SLICE_POP "--min_slice_pop="
+#define LONG_ARG_CHUNK_LEN "--chunk_len="
+#define LONG_ARG_OVERLAP_LEN "--overlap_len="
+
#define METHOD_DM 0
#define METHOD_SIEVE 1
#define METHOD_DURCHSCHLAG 2
@@ -93,11 +104,20 @@ static void printHelp(const char* name) {
" --dsh use 'durchschlag' engine (default)\n"
" --purify rewrite samples; unique text parts are zeroed out\n"
" --sieve use 'sieve' engine\n"
- " -b# set block length for 'durchschlag'; default: 1024\n"
- " -s# set slice length for 'distill', 'durchschlag', 'purify'\n"
+ " -b#, --block_len=#\n"
+ " set block length for 'durchschlag'; default: 1024\n"
+ " -s#, --slice_len=#\n"
+ " set slice length for 'distill', 'durchschlag', 'purify'\n"
" and 'sieve'; default: 16\n"
- " -t# set target dictionary size (limit); default: 16K\n"
- " -u# set minimum slice population (for rewrites); default: 2\n"
+ " -t#, --target_dict_len=#\n"
+ " set target dictionary length (limit); default: 16K\n"
+ " -u#, --min_slice_pop=#\n"
+ " set minimum slice population (for rewrites); default: 2\n"
+ " -c#, --chunk_len=#\n"
+ " if positive, samples are cut into chunks of this length;\n"
+ " default: 0; cannot mix with 'rewrite samples'\n"
+ " -o#, --overlap_len=#\n"
+ " set chunk overlap length; default 0\n"
"# is a decimal number with optional k/K/m/M suffix.\n"
"WARNING: 'distill' and 'purify' will overwrite original samples!\n"
" Completely unique samples might become empty files.\n\n");
@@ -110,6 +130,8 @@ int main(int argc, char const* argv[]) {
size_t targetSize = 16 << 10;
size_t blockSize = 1024;
size_t minimumPopulation = 2;
+ size_t chunkLen = 0;
+ size_t overlapLen = 0;
std::vector<uint8_t> data;
std::vector<size_t> sizes;
@@ -119,66 +141,115 @@ int main(int argc, char const* argv[]) {
if (argv[i] == nullptr) {
continue;
}
+
if (argv[i][0] == '-') {
- if (argv[i][1] == '-') {
+ char arg1 = argv[i][1];
+ const char* arg2 = arg1 ? &argv[i][2] : nullptr;
+ if (arg1 == '-') {
if (dictionaryArg != -1) {
fprintf(stderr,
"Method should be specified before dictionary / sample '%s'\n",
argv[i]);
exit(1);
}
- if (std::strcmp("--sieve", argv[i]) == 0) {
+
+ /* Look for "--long_arg" via exact match. */
+ if (std::strcmp(argv[i], "--sieve") == 0) {
method = METHOD_SIEVE;
continue;
}
- if (std::strcmp("--dm", argv[i]) == 0) {
+ if (std::strcmp(argv[i], "--dm") == 0) {
method = METHOD_DM;
continue;
}
- if (std::strcmp("--dsh", argv[i]) == 0) {
+ if (std::strcmp(argv[i], "--dsh") == 0) {
method = METHOD_DURCHSCHLAG;
continue;
}
- if (std::strcmp("--distill", argv[i]) == 0) {
+ if (std::strcmp(argv[i], "--distill") == 0) {
method = METHOD_DISTILL;
continue;
}
- if (std::strcmp("--purify", argv[i]) == 0) {
+ if (std::strcmp(argv[i], "--purify") == 0) {
method = METHOD_PURIFY;
continue;
}
- printHelp(fileName(argv[0]));
- fprintf(stderr, "Invalid option '%s'\n", argv[i]);
- exit(1);
+
+ /* Look for "--long_arg=#" via prefix match. */
+ if (std::strncmp(argv[i], LONG_ARG_BLOCK_LEN,
+ std::strlen(LONG_ARG_BLOCK_LEN)) == 0) {
+ arg1 = 'b';
+ arg2 = &argv[i][std::strlen(LONG_ARG_BLOCK_LEN)];
+ } else if (std::strncmp(argv[i], LONG_ARG_SLICE_LEN,
+ std::strlen(LONG_ARG_SLICE_LEN)) == 0) {
+ arg1 = 's';
+ arg2 = &argv[i][std::strlen(LONG_ARG_SLICE_LEN)];
+ } else if (std::strncmp(argv[i], LONG_ARG_TARGET_DICT_LEN,
+ std::strlen(LONG_ARG_TARGET_DICT_LEN)) == 0) {
+ arg1 = 't';
+ arg2 = &argv[i][std::strlen(LONG_ARG_TARGET_DICT_LEN)];
+ } else if (std::strncmp(argv[i], LONG_ARG_MIN_SLICE_POP,
+ std::strlen(LONG_ARG_MIN_SLICE_POP)) == 0) {
+ arg1 = 'u';
+ arg2 = &argv[i][std::strlen(LONG_ARG_MIN_SLICE_POP)];
+ } else if (std::strncmp(argv[i], LONG_ARG_CHUNK_LEN,
+ std::strlen(LONG_ARG_CHUNK_LEN)) == 0) {
+ arg1 = 'c';
+ arg2 = &argv[i][std::strlen(LONG_ARG_CHUNK_LEN)];
+ } else if (std::strncmp(argv[i], LONG_ARG_OVERLAP_LEN,
+ std::strlen(LONG_ARG_OVERLAP_LEN)) == 0) {
+ arg1 = 'o';
+ arg2 = &argv[i][std::strlen(LONG_ARG_OVERLAP_LEN)];
+ } else {
+ printHelp(fileName(argv[0]));
+ fprintf(stderr, "Invalid option '%s'\n", argv[i]);
+ exit(1);
+ }
}
- if (argv[i][1] == 'b') {
- blockSize = readInt(&argv[i][2]);
+
+ /* Look for "-f" short args or "--foo=#" long args. */
+ if (arg1 == 'b') {
+ blockSize = readInt(arg2);
if (blockSize < 16 || blockSize > 65536) {
printHelp(fileName(argv[0]));
fprintf(stderr, "Invalid option '%s'\n", argv[i]);
exit(1);
}
- } else if (argv[i][1] == 's') {
- sliceLen = readInt(&argv[i][2]);
+ } else if (arg1 == 's') {
+ sliceLen = readInt(arg2);
if (sliceLen < 4 || sliceLen > 256) {
printHelp(fileName(argv[0]));
fprintf(stderr, "Invalid option '%s'\n", argv[i]);
exit(1);
}
- } else if (argv[i][1] == 't') {
- targetSize = readInt(&argv[i][2]);
+ } else if (arg1 == 't') {
+ targetSize = readInt(arg2);
if (targetSize < 256 || targetSize > (1 << 25)) {
printHelp(fileName(argv[0]));
fprintf(stderr, "Invalid option '%s'\n", argv[i]);
exit(1);
}
- } else if (argv[i][1] == 'u') {
- minimumPopulation = readInt(&argv[i][2]);
+ } else if (arg1 == 'u') {
+ minimumPopulation = readInt(arg2);
if (minimumPopulation < 256 || minimumPopulation > 65536) {
printHelp(fileName(argv[0]));
fprintf(stderr, "Invalid option '%s'\n", argv[i]);
exit(1);
}
+ } else if (arg1 == 'c') {
+ chunkLen = readInt(arg2);
+ if (chunkLen < 0 || chunkLen > INT_MAX) {
+ printHelp(fileName(argv[0]));
+ fprintf(stderr, "Invalid option '%s'\n", argv[i]);
+ exit(1);
+ }
+ } else if (arg1 == 'o') {
+ overlapLen = readInt(arg2);
+ if (overlapLen < 0 || overlapLen > INT_MAX) {
+ printHelp(fileName(argv[0]));
+ fprintf(stderr, "Invalid option '%s'\n", argv[i]);
+ exit(1);
+ }
} else {
printHelp(fileName(argv[0]));
fprintf(stderr, "Unrecognized option '%s'\n", argv[i]);
@@ -186,21 +257,44 @@ int main(int argc, char const* argv[]) {
}
continue;
}
+
if (dictionaryArg == -1) {
if (method != METHOD_DISTILL && method != METHOD_PURIFY) {
dictionaryArg = i;
continue;
}
}
+
std::string content = readFile(argv[i]);
- data.insert(data.end(), content.begin(), content.end());
- total += content.size();
- pathArgs.push_back(i);
- sizes.push_back(content.size());
+ if (chunkLen == 0) {
+ pathArgs.push_back(i);
+ data.insert(data.end(), content.begin(), content.end());
+ total += content.size();
+ sizes.push_back(content.size());
+ continue;
+ } else if (chunkLen <= overlapLen) {
+ printHelp(fileName(argv[0]));
+ fprintf(stderr, "Invalid chunkLen - overlapLen combination\n");
+ exit(1);
+ }
+ for (size_t chunkStart = 0;
+ chunkStart < content.size();
+ chunkStart += chunkLen - overlapLen) {
+ std::string chunk = content.substr(chunkStart, chunkLen);
+ data.insert(data.end(), chunk.begin(), chunk.end());
+ total += chunk.size();
+ sizes.push_back(chunk.size());
+ }
}
+
bool wantDictionary = (dictionaryArg == -1);
if (method == METHOD_DISTILL || method == METHOD_PURIFY) {
wantDictionary = false;
+ if (chunkLen != 0) {
+ printHelp(fileName(argv[0]));
+ fprintf(stderr, "Cannot mix 'rewrite samples' with positive chunk_len\n");
+ exit(1);
+ }
}
if (wantDictionary || total == 0) {
printHelp(fileName(argv[0]));
diff --git a/research/draw_histogram.cc b/research/draw_histogram.cc
index b0192a2..6ea4069 100644
--- a/research/draw_histogram.cc
+++ b/research/draw_histogram.cc
@@ -178,20 +178,23 @@ int main(int argc, char* argv[]) {
FILE* fin = fopen(argv[1], "r");
FILE* fout = fopen(argv[2], "wb");
- uint8_t** pixel = new uint8_t*[height];
- int** histo = new int*[height];
- for (int i = 0; i < height; i++) {
- pixel[i] = new uint8_t[width];
- histo[i] = new int[width];
- }
+ if (fin != nullptr && fout != nullptr) {
+ uint8_t** pixel = new uint8_t*[height];
+ int** histo = new int*[height];
+ for (int i = 0; i < height; i++) {
+ pixel[i] = new uint8_t[width];
+ histo[i] = new int[width];
+ }
- BuildHistogram(fin, histo);
- fclose(fin);
+ BuildHistogram(fin, histo);
- ConvertToPixels(histo, pixel);
+ ConvertToPixels(histo, pixel);
+
+ DrawPixels(pixel, fout);
+ }
- DrawPixels(pixel, fout);
- fclose(fout);
+ if (fin) fclose(fin);
+ if (fout) fclose(fout);
return 0;
}
diff --git a/research/durchschlag.cc b/research/durchschlag.cc
index 2fbf41b..2fbf41b 100755..100644
--- a/research/durchschlag.cc
+++ b/research/durchschlag.cc
diff --git a/research/durchschlag.h b/research/durchschlag.h
index adbc531..adbc531 100755..100644
--- a/research/durchschlag.h
+++ b/research/durchschlag.h
diff --git a/research/sieve.cc b/research/sieve.cc
index 4d147e1..4d147e1 100755..100644
--- a/research/sieve.cc
+++ b/research/sieve.cc
diff --git a/research/sieve.h b/research/sieve.h
index 6c65dc8..6c65dc8 100755..100644
--- a/research/sieve.h
+++ b/research/sieve.h
diff --git a/scripts/.bintray.json b/scripts/.bintray.json
index ef2ea9d..17f99ed 100644
--- a/scripts/.bintray.json
+++ b/scripts/.bintray.json
@@ -5,7 +5,7 @@
"subject": "eustas"
},
- "version": {"name": "snapshot"},
+ "version": {"name": "latest"},
"files": [
{
diff --git a/scripts/.travis.sh b/scripts/.travis.sh
index 367cdfa..b5ad13a 100755
--- a/scripts/.travis.sh
+++ b/scripts/.travis.sh
@@ -6,7 +6,7 @@ case "$1" in
"install")
case "${TRAVIS_OS_NAME}" in
"osx")
- brew update
+ brew update >/dev/null
brew install binutils
case "${CC}" in
@@ -17,6 +17,7 @@ case "$1" in
case "${BUILD_SYSTEM}" in
"bazel")
+ brew cask install homebrew/cask-versions/adoptopenjdk8
brew install bazel
;;
esac
diff --git a/scripts/appveyor.yml b/scripts/appveyor.yml
index e22a8c6..e52f65a 100644
--- a/scripts/appveyor.yml
+++ b/scripts/appveyor.yml
@@ -54,7 +54,7 @@ install:
)
)
- IF "%BUILD_SYSTEM%"=="bazel" (
- appveyor DownloadFile https://github.com/bazelbuild/bazel/releases/download/0.18.0/bazel-0.18.0-windows-x86_64.exe -FileName bazel.exe
+ appveyor DownloadFile https://github.com/bazelbuild/bazel/releases/download/2.2.0/bazel-2.2.0-windows-x86_64.exe -FileName bazel.exe
)
before_build:
@@ -106,6 +106,6 @@ deploy:
subject: eustas
repo: brotli
package: bin
- version: snapshot
+ version: latest
publish: true
override: true
diff --git a/scripts/libbrotlicommon.pc.in b/scripts/libbrotlicommon.pc.in
index 2a8cf7a..10ca969 100644
--- a/scripts/libbrotlicommon.pc.in
+++ b/scripts/libbrotlicommon.pc.in
@@ -7,5 +7,5 @@ Name: libbrotlicommon
URL: https://github.com/google/brotli
Description: Brotli common dictionary library
Version: @PACKAGE_VERSION@
-Libs: -L${libdir} -lbrotlicommon
+Libs: -L${libdir} -R${libdir} -lbrotlicommon
Cflags: -I${includedir}
diff --git a/scripts/libbrotlidec.pc.in b/scripts/libbrotlidec.pc.in
index 6f8ef2e..e7c3124 100644
--- a/scripts/libbrotlidec.pc.in
+++ b/scripts/libbrotlidec.pc.in
@@ -7,6 +7,6 @@ Name: libbrotlidec
URL: https://github.com/google/brotli
Description: Brotli decoder library
Version: @PACKAGE_VERSION@
-Libs: -L${libdir} -lbrotlidec
+Libs: -L${libdir} -R${libdir} -lbrotlidec
Requires.private: libbrotlicommon >= 1.0.2
Cflags: -I${includedir}
diff --git a/scripts/libbrotlienc.pc.in b/scripts/libbrotlienc.pc.in
index 2098afe..4dd0811 100644
--- a/scripts/libbrotlienc.pc.in
+++ b/scripts/libbrotlienc.pc.in
@@ -7,6 +7,6 @@ Name: libbrotlienc
URL: https://github.com/google/brotli
Description: Brotli encoder library
Version: @PACKAGE_VERSION@
-Libs: -L${libdir} -lbrotlienc
+Libs: -L${libdir} -R${libdir} -lbrotlienc
Requires.private: libbrotlicommon >= 1.0.2
Cflags: -I${includedir}
diff --git a/scripts/sources.lst b/scripts/sources.lst
index 5e8e817..19a6d00 100644
--- a/scripts/sources.lst
+++ b/scripts/sources.lst
@@ -5,7 +5,10 @@ BROTLI_CLI_C = \
c/tools/brotli.c
BROTLI_COMMON_C = \
+ c/common/constants.c \
+ c/common/context.c \
c/common/dictionary.c \
+ c/common/platform.c \
c/common/transform.c
BROTLI_COMMON_H = \
@@ -35,12 +38,14 @@ BROTLI_ENC_C = \
c/enc/block_splitter.c \
c/enc/brotli_bit_stream.c \
c/enc/cluster.c \
+ c/enc/command.c \
c/enc/compress_fragment.c \
c/enc/compress_fragment_two_pass.c \
c/enc/dictionary_hash.c \
c/enc/encode.c \
c/enc/encoder_dict.c \
c/enc/entropy_encode.c \
+ c/enc/fast_log.c \
c/enc/histogram.c \
c/enc/literal_cost.c \
c/enc/memory.c \
diff --git a/setup.py b/setup.py
index 1491db3..25626ec 100644
--- a/setup.py
+++ b/setup.py
@@ -142,7 +142,7 @@ DESCRIPTION = 'Python bindings for the Brotli compression library'
AUTHOR = 'The Brotli Authors'
-LICENSE = 'Apache 2.0'
+LICENSE = 'MIT'
PLATFORMS = ['Posix', 'MacOS X', 'Windows']
@@ -150,7 +150,7 @@ CLASSIFIERS = [
'Development Status :: 4 - Beta',
'Environment :: Console',
'Intended Audience :: Developers',
- 'License :: OSI Approved :: Apache Software License',
+ 'License :: OSI Approved :: MIT License',
'Operating System :: MacOS :: MacOS X',
'Operating System :: Microsoft :: Windows',
'Operating System :: POSIX :: Linux',
@@ -181,7 +181,10 @@ EXT_MODULES = [
'_brotli',
sources=[
'python/_brotli.cc',
+ 'c/common/constants.c',
+ 'c/common/context.c',
'c/common/dictionary.c',
+ 'c/common/platform.c',
'c/common/transform.c',
'c/dec/bit_reader.c',
'c/dec/decode.c',
@@ -193,12 +196,14 @@ EXT_MODULES = [
'c/enc/block_splitter.c',
'c/enc/brotli_bit_stream.c',
'c/enc/cluster.c',
+ 'c/enc/command.c',
'c/enc/compress_fragment.c',
'c/enc/compress_fragment_two_pass.c',
'c/enc/dictionary_hash.c',
'c/enc/encode.c',
'c/enc/encoder_dict.c',
'c/enc/entropy_encode.c',
+ 'c/enc/fast_log.c',
'c/enc/histogram.c',
'c/enc/literal_cost.c',
'c/enc/memory.c',
diff --git a/tests/roundtrip_test.sh b/tests/roundtrip_test.sh
index 90027af..0a0b910 100755
--- a/tests/roundtrip_test.sh
+++ b/tests/roundtrip_test.sh
@@ -20,15 +20,17 @@ c/dec/decode.c
"""
for file in $INPUTS; do
- for quality in 1 6 9 11; do
- echo "Roundtrip testing $file at quality $quality"
- compressed=${TMP_DIR}/${file##*/}.br
- uncompressed=${TMP_DIR}/${file##*/}.unbr
- $BROTLI -fq $quality $file -o $compressed
- $BROTLI $compressed -fdo $uncompressed
- diff -q $file $uncompressed
- # Test the streaming version
- cat $file | $BROTLI -cq $quality | $BROTLI -cd >$uncompressed
- diff -q $file $uncompressed
- done
+ if [ -f $file ]; then
+ for quality in 1 6 9 11; do
+ echo "Roundtrip testing $file at quality $quality"
+ compressed=${TMP_DIR}/${file##*/}.br
+ uncompressed=${TMP_DIR}/${file##*/}.unbr
+ $BROTLI -fq $quality $file -o $compressed
+ $BROTLI $compressed -fdo $uncompressed
+ diff -q $file $uncompressed
+ # Test the streaming version
+ cat $file | $BROTLI -cq $quality | $BROTLI -cd >$uncompressed
+ diff -q $file $uncompressed
+ done
+ fi
done